metagRoot

F451134

General Info

Members	Datasets	Scaffolds	Average Seq Length
474	193	474	354

Family's Representative Sequence

Representative Sequence	3300005337\|Ga0070682_100000051\|Ga0070682_10000005161
Length	389
Sequence	LKKPAANAEPSVFVKKSRLILATLVLFAVPILYLLFWPVPISPQAWSPSAAPTLTGEYQQNSTLANTTRLSLGTEGQGPGNGYAPEDVAFDATGRIYAGLDDGRIIRLAADGTNPETFANTHGRPLGLAFDQEGNLIVADATKGLLSIARDGSIAVLTTEAXXQAFGCTNDLDVAADGTIYFTDASSKFPLTQFTDDLLEHGPNGRLLAYDPKAKTTRTILSDLAFANGVAVSPDQSFVLVVETGKYRVHRVALNKQTAAQNDPQLAGDTRDLEIFIDNLPGFPDGISSNGKDRFWLALVAPRDAVLDKLLPHPFLRKIVARIPKSLQPTPKRYSFVLGLDLNGRVVDNLQNGSADCYAEIANAVEHDGTLYFGSIGESTIGRFPLSTH

Samples

	Sample ID	Description	Type	Environment
1	3300001432	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
2	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
3	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
4	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
5	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
6	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
7	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
8	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
9	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
10	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
11	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
12	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
13	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
14	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
15	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
16	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
17	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
18	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
21	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
22	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
23	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
24	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
25	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
26	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
27	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
28	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
29	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
30	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
31	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
32	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
33	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
34	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
35	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
36	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
37	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
38	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
41	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
42	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
43	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
44	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
45	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
48	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
49	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
50	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
51	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
52	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
53	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
54	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
55	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
56	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
57	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
58	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
59	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
60	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
61	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
62	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
63	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
64	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
65	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
68	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
69	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
70	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
71	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
72	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
73	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
74	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
76	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
77	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
78	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
80	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
81	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
83	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
84	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
85	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
86	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
87	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
88	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
89	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
90	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
91	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
92	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
93	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
94	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
95	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
96	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
97	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
98	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
99	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
100	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
143	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
146	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
147	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
148	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
149	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
150	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
151	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
152	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
153	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
154	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
155	3300038699	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26	Metagenome	Rhizosphere
156	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
157	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
158	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
159	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
160	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
161	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
162	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
163	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
164	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
165	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
166	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
167	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
168	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
169	3300049517	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control	Metagenome	Rhizosphere
170	3300049519	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought	Metagenome	Rhizosphere
171	3300049520	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought	Metagenome	Rhizosphere
172	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
173	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
174	3300049654	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control	Metagenome	Rhizosphere
175	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
176	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
177	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
178	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
179	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
180	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
181	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
182	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
183	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
184	3300049851	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought	Metagenome	Rhizosphere
185	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
186	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
187	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
188	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
189	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
190	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
191	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
192	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
193	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	1.27
Rhizosphere	98.73
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24034J14986_100440	3300001432	Bacteria	2404
2	JGI24748J21848_1000001	3300002074	Bacteria	444271
3	JGI24034J26672_10000001	3300002239	Bacteria	1118280
4	JGI24751J29686_10000107	3300002459	Bacteria	44982
5	JGI25406J46586_10024058	3300003203	Unclassified	2395
6	Ga0065714_10064435	3300005288	Bacteria	121919
7	Ga0065704_10008014	3300005289	Bacteria	2651
8	Ga0065704_10084422	3300005289	Bacteria	3336
9	Ga0065712_10000118	3300005290	Bacteria	121959
10	Ga0065712_10103059	3300005290	Bacteria	1991
11	Ga0065715_10089159	3300005293	Bacteria	13317
12	Ga0065715_10090332	3300005293	Bacteria	7197
13	Ga0065715_10100976	3300005293	Unclassified	3248
14	Ga0065707_10001813	3300005295	Bacteria	12883
15	Ga0065707_10002355	3300005295	Bacteria	4769
16	Ga0065707_10089940	3300005295	Bacteria	4246
17	Ga0065707_10118895	3300005295	Bacteria	2174
18	Ga0065707_10207817	3300005295	Unclassified	1280
19	Ga0070676_10170411	3300005328	Bacteria	1408
20	Ga0070670_100001037	3300005331	Bacteria	22003
21	Ga0070670_100006797	3300005331	Bacteria	9682
22	Ga0070670_100017767	3300005331	Bacteria	6102
23	Ga0070670_100402082	3300005331	Bacteria	1209
24	Ga0068869_100047020	3300005334	Bacteria	3114
25	Ga0068869_100367107	3300005334	Unclassified	1177
26	Ga0070682_100000051	3300005337	Bacteria	123476
27	Ga0070682_100006511	3300005337	Bacteria	6554
28	Ga0070682_100131811	3300005337	Bacteria	1693
29	Ga0068868_100104260	3300005338	Bacteria	2298
30	Ga0070660_100160206	3300005339	Bacteria	1813
31	Ga0070689_100011345	3300005340	Bacteria	6380
32	Ga0070689_100062497	3300005340	Bacteria	2897
33	Ga0070687_100002881	3300005343	Bacteria	6576
34	Ga0070687_100048840	3300005343	Bacteria	2177
35	Ga0070661_100106855	3300005344	Bacteria	2087
36	Ga0070692_10005514	3300005345	Bacteria	5405
37	Ga0070692_10025863	3300005345	Bacteria	2896
38	Ga0070692_10041275	3300005345	Bacteria	2363
39	Ga0070668_100017258	3300005347	Bacteria	5404
40	Ga0070669_100000729	3300005353	Bacteria	23953
41	Ga0070669_100057326	3300005353	Bacteria	2857
42	Ga0070669_100160393	3300005353	Bacteria	1747
43	Ga0070675_100045501	3300005354	Bacteria	3591
44	Ga0070671_100005506	3300005355	Bacteria	10097
45	Ga0070671_100015002	3300005355	Bacteria	6257
46	Ga0070674_100188446	3300005356	Bacteria	1585
47	Ga0070673_100103237	3300005364	Bacteria	2352
48	Ga0070673_100272014	3300005364	Bacteria	1483
49	Ga0070673_100294352	3300005364	Bacteria	1427
50	Ga0070659_100025535	3300005366	Bacteria	4539
51	Ga0070667_100083675	3300005367	Bacteria	2734
52	Ga0070703_10000016	3300005406	Bacteria	86253
53	Ga0070705_100002198	3300005440	Bacteria	9899
54	Ga0070705_100057547	3300005440	Bacteria	2294
55	Ga0070705_100061237	3300005440	Unclassified	2236
56	Ga0070705_100087424	3300005440	Bacteria	1932
57	Ga0070700_100000092	3300005441	Bacteria	60316
58	Ga0070700_100013167	3300005441	Unclassified	4640
59	Ga0070700_100056881	3300005441	Bacteria	2453
60	Ga0070700_100070766	3300005441	Bacteria	2225
61	Ga0070700_100121832	3300005441	Bacteria	1749
62	Ga0070694_100000063	3300005444	Bacteria	51217
63	Ga0070694_100009763	3300005444	Bacteria	5895
64	Ga0070694_100060784	3300005444	Bacteria	2578
65	Ga0070694_100149474	3300005444	Bacteria	1704
66	Ga0070708_100002362	3300005445	Bacteria	14604
67	Ga0070708_100119219	3300005445	Bacteria	2432
68	Ga0070708_100198310	3300005445	Unclassified	1878
69	Ga0070678_100061722	3300005456	Bacteria	2764
70	Ga0070681_10000475	3300005458	Bacteria	32749
71	Ga0070681_10002322	3300005458	Bacteria	17395
72	Ga0070681_10011510	3300005458	Bacteria	8759
73	Ga0070681_10022916	3300005458	Bacteria	6276
74	Ga0068867_100014031	3300005459	Bacteria	5676
75	Ga0068867_100128799	3300005459	Bacteria	1964
76	Ga0068867_100176971	3300005459	Bacteria	1693
77	Ga0068867_100248409	3300005459	Bacteria	1446
78	Ga0070706_100000097	3300005467	Bacteria	106315
79	Ga0070706_100021984	3300005467	Bacteria	5874
80	Ga0070706_100044529	3300005467	Unclassified	4099
81	Ga0070706_100048731	3300005467	Unclassified	3909
82	Ga0070706_100057046	3300005467	Unclassified	3603
83	Ga0070706_100102850	3300005467	Bacteria	2656
84	Ga0070706_100280604	3300005467	Bacteria	1555
85	Ga0070707_100000329	3300005468	Bacteria	46639
86	Ga0070707_100026729	3300005468	Bacteria	5482
87	Ga0070707_100295094	3300005468	Bacteria	1575
88	Ga0070707_100297096	3300005468	Bacteria	1569
89	Ga0070698_100000741	3300005471	Bacteria	35145
90	Ga0070698_100003588	3300005471	Bacteria	17057
91	Ga0070698_100006142	3300005471	Bacteria	13081
92	Ga0070698_100029558	3300005471	Bacteria	5690
93	Ga0070698_100218586	3300005471	Bacteria	1839
94	Ga0070699_100009745	3300005518	Bacteria	8311
95	Ga0070699_100032501	3300005518	Unclassified	4506
96	Ga0070699_100038140	3300005518	Bacteria	4161
97	Ga0070699_100046797	3300005518	Bacteria	3743
98	Ga0070699_100090965	3300005518	Bacteria	2668
99	Ga0070699_100128462	3300005518	Bacteria	2233
100	Ga0070679_100000307	3300005530	Bacteria	41692
101	Ga0070679_100082638	3300005530	Bacteria	3202
102	Ga0070679_100254363	3300005530	Unclassified	1712
103	Ga0070697_100000176	3300005536	Bacteria	52306
104	Ga0070697_100000422	3300005536	Bacteria	32600
105	Ga0070697_100026034	3300005536	Bacteria	4667
106	Ga0070697_100037011	3300005536	Bacteria	3942
107	Ga0070697_100204012	3300005536	Bacteria	1681
108	Ga0068853_100041243	3300005539	Unclassified	3941
109	Ga0068853_100051590	3300005539	Unclassified	3541
110	Ga0068853_100096548	3300005539	Bacteria	2608
111	Ga0070672_100053475	3300005543	Unclassified	3157
112	Ga0070672_100084769	3300005543	Bacteria	2545
113	Ga0070672_100201802	3300005543	Unclassified	1663
114	Ga0070686_100119190	3300005544	Bacteria	1810
115	Ga0070695_100085727	3300005545	Bacteria	2092
116	Ga0070695_100200118	3300005545	Unclassified	1427
117	Ga0070696_100012112	3300005546	Bacteria	5779
118	Ga0070696_100063431	3300005546	Bacteria	2588
119	Ga0070696_100091205	3300005546	Bacteria	2170
120	Ga0070696_100112188	3300005546	Unclassified	1964
121	Ga0070693_100000305	3300005547	Bacteria	22777
122	Ga0070693_100140516	3300005547	Bacteria	1520
123	Ga0070704_100024541	3300005549	Bacteria	3957
124	Ga0070704_100035441	3300005549	Unclassified	3392
125	Ga0070704_100049291	3300005549	Bacteria	2954
126	Ga0070704_100110844	3300005549	Unclassified	2088
127	Ga0070704_100111045	3300005549	Unclassified	2086
128	Ga0070704_100127655	3300005549	Unclassified	1965
129	Ga0068855_100187489	3300005563	Bacteria	2335
130	Ga0070664_100011220	3300005564	Bacteria	7268
131	Ga0068857_100000277	3300005577	Bacteria	35101
132	Ga0068857_100067092	3300005577	Bacteria	3193
133	Ga0068854_100105233	3300005578	Bacteria	2121
134	Ga0068854_100265952	3300005578	Bacteria	1375
135	Ga0068854_100286878	3300005578	Bacteria	1327
136	Ga0070702_100003303	3300005615	Bacteria	7192
137	Ga0070702_100010068	3300005615	Bacteria	4646
138	Ga0070702_100012541	3300005615	Bacteria	4250
139	Ga0070702_100044301	3300005615	Bacteria	2511
140	Ga0070702_100059397	3300005615	Bacteria	2219
141	Ga0070702_100137640	3300005615	Bacteria	1551
142	Ga0068859_100008476	3300005617	Bacteria	10403
143	Ga0068859_100020359	3300005617	Bacteria	6660
144	Ga0068859_100032266	3300005617	Bacteria	5261
145	Ga0068859_100047168	3300005617	Unclassified	4328
146	Ga0068859_100103698	3300005617	Bacteria	2902
147	Ga0068859_100118669	3300005617	Bacteria	2711
148	Ga0068859_100373080	3300005617	Bacteria	1522
149	Ga0068864_100049800	3300005618	Bacteria	3604
150	Ga0068864_100138889	3300005618	Bacteria	2190
151	Ga0068864_100153925	3300005618	Unclassified	2085
152	Ga0068864_100164498	3300005618	Unclassified	2019
153	Ga0068861_100037632	3300005719	Bacteria	3597
154	Ga0068861_100060062	3300005719	Bacteria	2913
155	Ga0068870_10000847	3300005840	Bacteria	11937
156	Ga0068863_100054786	3300005841	Bacteria	3778
157	Ga0068863_100128061	3300005841	Bacteria	2423
158	Ga0068863_100199973	3300005841	Bacteria	1922
159	Ga0068863_100389466	3300005841	Unclassified	1362
160	Ga0068858_100000127	3300005842	Bacteria	79484
161	Ga0068858_100052025	3300005842	Unclassified	3790
162	Ga0068860_100016251	3300005843	Bacteria	7255
163	Ga0068860_100068559	3300005843	Unclassified	3370
164	Ga0068860_100069540	3300005843	Bacteria	3346
165	Ga0068860_100076808	3300005843	Unclassified	3176
166	Ga0068860_100091434	3300005843	Bacteria	2899
167	Ga0068860_100267765	3300005843	Bacteria	1667
168	Ga0068862_100018981	3300005844	Bacteria	5732
169	Ga0068862_100072219	3300005844	Bacteria	2981
170	Ga0068862_100097844	3300005844	Unclassified	2562
171	Ga0081539_10000067	3300005985	Bacteria	246361
172	Ga0081539_10003247	3300005985	Bacteria	20448
173	Ga0070715_10000016	3300006163	Bacteria	134692
174	Ga0070716_100000002	3300006173	Bacteria	396037
175	Ga0070716_100032718	3300006173	Bacteria	2839
176	Ga0070716_100155244	3300006173	Bacteria	1477
177	Ga0097621_100001354	3300006237	Bacteria	16867
178	Ga0097621_100030325	3300006237	Unclassified	4280
179	Ga0068871_100003285	3300006358	Bacteria	11094
180	Ga0068871_100020571	3300006358	Bacteria	5058
181	Ga0075428_100070337	3300006844	Bacteria	3826
182	Ga0075430_100053081	3300006846	Bacteria	3413
183	Ga0075433_10071843	3300006852	Unclassified	3042
184	Ga0075433_10081337	3300006852	Bacteria	2856
185	Ga0075433_10107418	3300006852	Bacteria	2474
186	Ga0075433_10115436	3300006852	Bacteria	2382
187	Ga0075433_10175350	3300006852	Bacteria	1908
188	Ga0075433_10184019	3300006852	Unclassified	1859
189	Ga0075433_10427957	3300006852	Unclassified	1167
190	Ga0075434_100011641	3300006871	Bacteria	8308
191	Ga0075434_100058548	3300006871	Bacteria	3829
192	Ga0075434_100086559	3300006871	Bacteria	3133
193	Ga0075434_100106514	3300006871	Bacteria	2813
194	Ga0075434_100215584	3300006871	Bacteria	1939
195	Ga0075429_100029076	3300006880	Bacteria	4800
196	Ga0075429_100030125	3300006880	Bacteria	4714
197	Ga0075436_100000002	3300006914	Bacteria	475522
198	Ga0075436_100005932	3300006914	Bacteria	8393
199	Ga0097620_100008476	3300006931	Bacteria	10403
200	Ga0097620_100020357	3300006931	Bacteria	6660
201	Ga0097620_100032266	3300006931	Bacteria	5261
202	Ga0097620_100047167	3300006931	Unclassified	4328
203	Ga0097620_100103698	3300006931	Bacteria	2902
204	Ga0097620_100118666	3300006931	Bacteria	2711
205	Ga0097620_100373072	3300006931	Bacteria	1522
206	Ga0075435_100004298	3300007076	Archaea	9789
207	Ga0099794_10053400	3300007265	Bacteria	1949
208	Ga0105240_10036772	3300009093	Bacteria	6296
209	Ga0111539_10001469	3300009094	Bacteria	31496
210	Ga0111539_10007977	3300009094	Bacteria	13504
211	Ga0111539_10010383	3300009094	Bacteria	11722
212	Ga0111539_10190749	3300009094	Bacteria	2391
213	Ga0105245_10112462	3300009098	Bacteria	2534
214	Ga0105247_10000004	3300009101	Bacteria	455497
215	Ga0105247_10001490	3300009101	Bacteria	16786
216	Ga0105247_10017782	3300009101	Unclassified	4263
217	Ga0105247_10020829	3300009101	Bacteria	3944
218	Ga0105247_10112102	3300009101	Bacteria	1757
219	Ga0114129_10009796	3300009147	Bacteria	13667
220	Ga0114129_10026332	3300009147	Bacteria	8236
221	Ga0114129_10034670	3300009147	Bacteria	7129
222	Ga0114129_10058691	3300009147	Bacteria	5382
223	Ga0114129_10058822	3300009147	Bacteria	5376
224	Ga0114129_10064939	3300009147	Bacteria	5094
225	Ga0114129_10175631	3300009147	Bacteria	2918
226	Ga0114129_10290869	3300009147	Bacteria	2180
227	Ga0105243_10000037	3300009148	Bacteria	175237
228	Ga0105243_10000716	3300009148	Bacteria	31854
229	Ga0105243_10018544	3300009148	Bacteria	5273
230	Ga0105241_10007502	3300009174	Bacteria	8026
231	Ga0105241_10133418	3300009174	Bacteria	2013
232	Ga0105241_10273680	3300009174	Bacteria	1439
233	Ga0105241_10288409	3300009174	Unclassified	1404
234	Ga0105242_10003056	3300009176	Bacteria	13077
235	Ga0105242_10009846	3300009176	Bacteria	7324
236	Ga0105242_10012945	3300009176	Bacteria	6432
237	Ga0105242_10040203	3300009176	Bacteria	3768
238	Ga0105242_10054067	3300009176	Bacteria	3281
239	Ga0105242_10096887	3300009176	Bacteria	2493
240	Ga0105248_10001663	3300009177	Bacteria	24717
241	Ga0105248_10006785	3300009177	Bacteria	12552
242	Ga0105248_10087353	3300009177	Unclassified	3509
243	Ga0105248_10093639	3300009177	Bacteria	3384
244	Ga0105248_10094229	3300009177	Bacteria	3372
245	Ga0105248_10484060	3300009177	Bacteria	1395
246	Ga0105237_10004213	3300009545	Bacteria	16744
247	Ga0105237_10091570	3300009545	Unclassified	3030
248	Ga0105238_10009780	3300009551	Bacteria	9600
249	Ga0105238_10012483	3300009551	Bacteria	8569
250	Ga0105249_10000375	3300009553	Bacteria	44344
251	Ga0105249_10094702	3300009553	Unclassified	2799
252	Ga0105249_10116389	3300009553	Bacteria	2534
253	Ga0105249_10235325	3300009553	Bacteria	1808
254	Ga0105249_10454220	3300009553	Bacteria	1320
255	Ga0105239_10006596	3300010375	Bacteria	13441
256	Ga0105239_10057653	3300010375	Bacteria	4260
257	Ga0105246_10097828	3300011119	Bacteria	2130
258	Ga0105246_10159609	3300011119	Bacteria	1716
259	Ga0157373_10095163	3300013100	Bacteria	2096
260	Ga0157378_10000017	3300013297	Bacteria	139053
261	Ga0157378_10006778	3300013297	Bacteria	9998
262	Ga0157378_10013835	3300013297	Bacteria	7056
263	Ga0157378_10032061	3300013297	Bacteria	4642
264	Ga0157378_10035485	3300013297	Unclassified	4411
265	Ga0157378_10039624	3300013297	Unclassified	4179
266	Ga0157378_10188500	3300013297	Bacteria	1944
267	Ga0157378_10255001	3300013297	Unclassified	1681
268	Ga0163162_10000162	3300013306	Bacteria	61820
269	Ga0163162_10005889	3300013306	Bacteria	11859
270	Ga0163162_10011561	3300013306	Bacteria	8612
271	Ga0163162_10037774	3300013306	Bacteria	4820
272	Ga0163162_10111935	3300013306	Bacteria	2828
273	Ga0163162_10321683	3300013306	Bacteria	1679
274	Ga0157372_10025429	3300013307	Bacteria	6437
275	Ga0157372_10037304	3300013307	Bacteria	5360
276	Ga0157372_10339621	3300013307	Unclassified	1749
277	Ga0157375_10003589	3300013308	Bacteria	13467
278	Ga0157375_10009176	3300013308	Bacteria	8670
279	Ga0157375_10009563	3300013308	Bacteria	8511
280	Ga0157375_10155130	3300013308	Bacteria	2428
281	Ga0157375_10162790	3300013308	Bacteria	2374
282	Ga0157375_10451188	3300013308	Unclassified	1451
283	Ga0163163_10000183	3300014325	Bacteria	64505
284	Ga0163163_10014165	3300014325	Bacteria	7323
285	Ga0163163_10075029	3300014325	Bacteria	3375
286	Ga0163163_10096456	3300014325	Bacteria	2977
287	Ga0163163_10183612	3300014325	Bacteria	2139
288	Ga0163163_10294133	3300014325	Bacteria	1676
289	Ga0157380_10004802	3300014326	Bacteria	9419
290	Ga0157380_10031735	3300014326	Unclassified	4058
291	Ga0157380_10104433	3300014326	Bacteria	2366
292	Ga0157380_10171378	3300014326	Bacteria	1897
293	Ga0157380_10215200	3300014326	Bacteria	1715
294	Ga0157380_10234928	3300014326	Bacteria	1649
295	Ga0157379_10087129	3300014968	Bacteria	2800
296	Ga0157379_10126615	3300014968	Bacteria	2298
297	Ga0157379_10192085	3300014968	Bacteria	1845
298	Ga0157379_10225433	3300014968	Unclassified	1699
299	Ga0157379_10406746	3300014968	Unclassified	1252
300	Ga0163161_10011938	3300017792	Bacteria	6027
301	Ga0207697_10018321	3300025315	Bacteria	2872
302	Ga0207653_10000362	3300025885	Bacteria	21697
303	Ga0207653_10015893	3300025885	Unclassified	2362
304	Ga0207710_10000002	3300025900	Bacteria	1251998
305	Ga0207710_10000718	3300025900	Bacteria	18428
306	Ga0207710_10120622	3300025900	Unclassified	1252
307	Ga0207688_10048726	3300025901	Bacteria	2367
308	Ga0207688_10073734	3300025901	Bacteria	1941
309	Ga0207647_10000502	3300025904	Bacteria	31375
310	Ga0207685_10000045	3300025905	Bacteria	49189
311	Ga0207684_10000023	3300025910	Bacteria	334838
312	Ga0207684_10003181	3300025910	Bacteria	16135
313	Ga0207684_10091066	3300025910	Bacteria	2599
314	Ga0207654_10002853	3300025911	Bacteria	8764
315	Ga0207654_10016605	3300025911	Bacteria	3836
316	Ga0207707_10000006	3300025912	Bacteria	374131
317	Ga0207707_10003187	3300025912	Bacteria	14567
318	Ga0207707_10155562	3300025912	Bacteria	1999
319	Ga0207695_10064972	3300025913	Unclassified	3753
320	Ga0207671_10006170	3300025914	Bacteria	10770
321	Ga0207660_10001704	3300025917	Bacteria	14738
322	Ga0207660_10249068	3300025917	Bacteria	1402
323	Ga0207662_10044857	3300025918	Unclassified	2612
324	Ga0207662_10059605	3300025918	Bacteria	2288
325	Ga0207662_10098923	3300025918	Unclassified	1805
326	Ga0207652_10000216	3300025921	Bacteria	61049
327	Ga0207646_10001617	3300025922	Bacteria	27481
328	Ga0207646_10009172	3300025922	Bacteria	9808
329	Ga0207646_10029914	3300025922	Bacteria	4944
330	Ga0207646_10047165	3300025922	Bacteria	3865
331	Ga0207646_10091650	3300025922	Bacteria	2720
332	Ga0207646_10199099	3300025922	Bacteria	1809
333	Ga0207681_10000428	3300025923	Bacteria	29304
334	Ga0207681_10129872	3300025923	Bacteria	1861
335	Ga0207694_10009652	3300025924	Bacteria	7276
336	Ga0207694_10019982	3300025924	Bacteria	5067
337	Ga0207650_10000001	3300025925	Bacteria	1545726
338	Ga0207650_10001704	3300025925	Bacteria	15617
339	Ga0207650_10253272	3300025925	Bacteria	1426
340	Ga0207687_10131486	3300025927	Bacteria	1887
341	Ga0207644_10000500	3300025931	Bacteria	25221
342	Ga0207690_10041056	3300025932	Bacteria	3029
343	Ga0207686_10000003	3300025934	Bacteria	376934
344	Ga0207686_10000335	3300025934	Bacteria	33878
345	Ga0207686_10006124	3300025934	Bacteria	6460
346	Ga0207686_10048297	3300025934	Bacteria	2636
347	Ga0207709_10000017	3300025935	Bacteria	470753
348	Ga0207709_10002084	3300025935	Bacteria	12889
349	Ga0207670_10053929	3300025936	Unclassified	2711
350	Ga0207665_10000007	3300025939	Bacteria	177869
351	Ga0207665_10224008	3300025939	Bacteria	1379
352	Ga0207691_10060123	3300025940	Bacteria	3454
353	Ga0207691_10240199	3300025940	Bacteria	1566
354	Ga0207711_10015352	3300025941	Bacteria	6356
355	Ga0207711_10060154	3300025941	Bacteria	3273
356	Ga0207711_10105707	3300025941	Bacteria	2497
357	Ga0207689_10033647	3300025942	Bacteria	4258
358	Ga0207689_10106290	3300025942	Unclassified	2306
359	Ga0207679_10350186	3300025945	Unclassified	1287
360	Ga0207651_10031030	3300025960	Bacteria	3411
361	Ga0207651_10075623	3300025960	Bacteria	2404
362	Ga0207651_10089844	3300025960	Bacteria	2244
363	Ga0207712_10000313	3300025961	Bacteria	44454
364	Ga0207712_10005923	3300025961	Bacteria	7707
365	Ga0207712_10015243	3300025961	Bacteria	4955
366	Ga0207712_10103991	3300025961	Bacteria	2117
367	Ga0207712_10126191	3300025961	Bacteria	1943
368	Ga0207640_10071801	3300025981	Bacteria	2333
369	Ga0207640_10102091	3300025981	Bacteria	2014
370	Ga0207677_10050492	3300026023	Bacteria	2814
371	Ga0207677_10072229	3300026023	Bacteria	2439
372	Ga0207703_10000092	3300026035	Bacteria	104797
373	Ga0207703_10146409	3300026035	Unclassified	2055
374	Ga0207703_10449486	3300026035	Archaea	1203
375	Ga0207639_10076154	3300026041	Bacteria	2641
376	Ga0207639_10192937	3300026041	Bacteria	1741
377	Ga0207639_10280555	3300026041	Bacteria	1465
378	Ga0207708_10000061	3300026075	Bacteria	92741
379	Ga0207708_10003905	3300026075	Bacteria	10970
380	Ga0207708_10013566	3300026075	Bacteria	6091
381	Ga0207708_10017238	3300026075	Bacteria	5436
382	Ga0207708_10047175	3300026075	Bacteria	3280
383	Ga0207708_10054701	3300026075	Bacteria	3043
384	Ga0207641_10078426	3300026088	Bacteria	2861
385	Ga0207641_10189235	3300026088	Bacteria	1891
386	Ga0207641_10207900	3300026088	Bacteria	1808
387	Ga0207641_10332554	3300026088	Unclassified	1444
388	Ga0207648_10068784	3300026089	Bacteria	3086
389	Ga0207648_10093384	3300026089	Unclassified	2631
390	Ga0207648_10121433	3300026089	Bacteria	2297
391	Ga0207676_10048727	3300026095	Bacteria	3291
392	Ga0207676_10404850	3300026095	Bacteria	1276
393	Ga0207674_10000192	3300026116	Bacteria	75255
394	Ga0207674_10091726	3300026116	Unclassified	3028
395	Ga0207674_10125168	3300026116	Bacteria	2536
396	Ga0207675_100014671	3300026118	Bacteria	7307
397	Ga0207675_100026095	3300026118	Bacteria	5438
398	Ga0207675_100027623	3300026118	Bacteria	5285
399	Ga0207675_100229660	3300026118	Unclassified	1790
400	Ga0207683_10438529	3300026121	Bacteria	1204
401	Ga0207428_10026938	3300027907	Bacteria	4789
402	Ga0207428_10052940	3300027907	Bacteria	3239
403	Ga0268265_10131230	3300028380	Bacteria	2082
404	Ga0268265_10357995	3300028380	Bacteria	1335
405	Ga0268264_10006536	3300028381	Bacteria	9817
406	Ga0268264_10017556	3300028381	Bacteria	5861
407	Ga0268264_10047834	3300028381	Bacteria	3557
408	Ga0268264_10057568	3300028381	Unclassified	3251
409	Ga0268264_10107710	3300028381	Bacteria	2435
410	Ga0268264_10323282	3300028381	Unclassified	1459
411	Ga0316578_10183728	3300031728	Bacteria	1260
412	Ga0307406_10014187	3300031901	Bacteria	4580
413	Ga0307416_100122911	3300032002	Unclassified	2318
414	Ga0307416_100258963	3300032002	Unclassified	1699
415	Ga0373941_0018329	3300035115	Bacteria	1933
416	Ga0373942_0001683	3300035207	Bacteria	5610
417	Ga0373931_0057633	3300035691	Bacteria	2084
418	Ga0316584_0066870	3300036712	Bacteria	2693
419	Ga0395900_0456803	3300037418	Bacteria	1233
420	Ga0395898_0213879	3300037466	Bacteria	1839
421	Ga0395901_0208807	3300038443	Bacteria	2045
422	Ga0242422_01887	3300038699	Unclassified	1443
423	Ga0453684_0489857	3300044712	Bacteria	1363
424	Ga0451576_0285465	3300045051	Unclassified	1725
425	Ga0451576_0291048	3300045051	Bacteria	1708
426	Ga0495663_0000123	3300046525	Bacteria	32150
427	Ga0495598_0000081	3300046537	Bacteria	15622
428	Ga0495621_0001399	3300046539	Bacteria	6244
429	Ga0495621_0044770	3300046539	Bacteria	1565
430	Ga0495668_0125824	3300046616	Unclassified	1403
431	Ga0495659_0083658	3300046664	Bacteria	1215
432	Ga0496104_0241393	3300048907	Bacteria	1719
433	Ga0496106_0006150	3300048909	Bacteria	8878
434	Ga0496108_0121254	3300048911	Unclassified	2243
435	Ga0496108_0222206	3300048911	Bacteria	1641
436	Ga0496112_0325221	3300048915	Bacteria	1482
437	Ga0496113_0024408	3300048916	Bacteria	4298
438	Ga0501290_009437	3300049513	Unclassified	1241
439	Ga0501294_003978	3300049517	Unclassified	1394
440	Ga0501296_000186	3300049519	Bacteria	6568
441	Ga0501297_000526	3300049520	Unclassified	3450
442	Ga0501298_007083	3300049521	Bacteria	1853
443	Ga0501038_0007200	3300049574	Bacteria	10280
444	Ga0501207_006484	3300049654	Bacteria	1644
445	Ga0501217_014372	3300049661	Unclassified	1787
446	Ga0501223_004364	3300049663	Unclassified	3031
447	Ga0501224_015123	3300049664	Unclassified	1143
448	Ga0501233_012765	3300049668	Bacteria	1692
449	Ga0501235_012482	3300049669	Unclassified	1869
450	Ga0501225_0005819	3300049705	Bacteria	3608
451	Ga0501234_002720	3300049707	Bacteria	2783
452	Ga0501266_007985	3300049763	Unclassified	1331
453	Ga0501283_003794	3300049779	Bacteria	2015
454	Ga0501212_014223	3300049851	Unclassified	1176
455	nmdc:mga05p37_33973_c1	3300050507	Bacteria	6247
456	nmdc:mga09592_26766_c1	3300050508	Bacteria	4780
457	nmdc:mga09592_50430_c1	3300050508	Bacteria	3510
458	nmdc:mga0qj67_48770_c1	3300050509	Bacteria	3346
459	nmdc:mga06r32_377354_c1	3300050510	Bacteria	1401
460	nmdc:mga08y16_151743_c1	3300050511	Bacteria	2408
461	nmdc:mga08y16_271891_c1	3300050511	Unclassified	1749
462	nmdc:mga08y16_72243_c1	3300050511	Bacteria	3596
463	nmdc:mga0rr50_124616_c1	3300050513	Bacteria	2055
464	nmdc:mga0rr50_218664_c1	3300050513	Bacteria	1572
465	nmdc:mga0rr50_61_c1	3300050513	Bacteria	64779
466	nmdc:mga08x19_3718_c1	3300050514	Bacteria	9084
467	nmdc:mga08x19_9_c1	3300050514	Bacteria	418852
468	nmdc:mga0a205_165893_c1	3300050515	Unclassified	2104
469	nmdc:mga0a205_220628_c1	3300050515	Unclassified	1781
470	nmdc:mga0a205_258340_c1	3300050515	Bacteria	1620
471	nmdc:mga0a205_432662_c1	3300050515	Bacteria	1177
472	nmdc:mga0a205_53986_c1	3300050515	Unclassified	3879
473	nmdc:mga0a205_6874_c1	3300050515	Bacteria	5707
474	Ga0530510_0026566	3300061734	Unclassified	4145

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005441	Ga0070700_100056881	Ga0070700_1000568812	289
2	3300049763	Ga0501266_007985	Ga0501266_007985_264_1298	302
3	3300049851	Ga0501212_014223	Ga0501212_014223_108_1142	302
4	3300005356	Ga0070674_100188446	Ga0070674_1001884462	307
5	3300013297	Ga0157378_10006778	Ga0157378_100067787	309
6	3300005536	Ga0070697_100037011	Ga0070697_1000370111	312
7	3300037418	Ga0395900_0456803	Ga0395900_0456803_22_975	315
8	3300046616	Ga0495668_0125824	Ga0495668_0125824_158_1354	318
9	3300005353	Ga0070669_100057326	Ga0070669_1000573261	326
10	3300006852	Ga0075433_10175350	Ga0075433_101753502	327
11	3300006871	Ga0075434_100011641	Ga0075434_1000116415	327
12	3300025912	Ga0207707_10155562	Ga0207707_101555621	330
13	3300005467	Ga0070706_100000097	Ga0070706_10000009724	331
14	3300005985	Ga0081539_10000067	Ga0081539_10000067127	331
15	3300025910	Ga0207684_10000023	Ga0207684_10000023156	331
16	3300038443	Ga0395901_0208807	Ga0395901_0208807_858_1931	331
17	3300005288	Ga0065714_10064435	Ga0065714_100644356	332
18	3300005290	Ga0065712_10000118	Ga0065712_100001187	332
19	3300005293	Ga0065715_10089159	Ga0065715_100891596	332
20	3300005343	Ga0070687_100048840	Ga0070687_1000488402	332
21	3300005367	Ga0070667_100083675	Ga0070667_1000836753	332
22	3300005456	Ga0070678_100061722	Ga0070678_1000617222	332
23	3300005578	Ga0068854_100105233	Ga0068854_1001052332	332
24	3300005615	Ga0070702_100010068	Ga0070702_1000100685	332
25	3300006358	Ga0068871_100020571	Ga0068871_1000205713	332
26	3300010375	Ga0105239_10057653	Ga0105239_100576533	332
27	3300025901	Ga0207688_10048726	Ga0207688_100487263	332
28	3300025981	Ga0207640_10071801	Ga0207640_100718012	332
29	3300026121	Ga0207683_10438529	Ga0207683_104385291	332
30	3300005354	Ga0070675_100045501	Ga0070675_1000455012	333
31	3300005539	Ga0068853_100096548	Ga0068853_1000965482	333
32	3300005543	Ga0070672_100084769	Ga0070672_1000847692	333
33	3300005578	Ga0068854_100265952	Ga0068854_1002659522	333
34	3300009101	Ga0105247_10017782	Ga0105247_100177822	333
35	3300009177	Ga0105248_10087353	Ga0105248_100873534	333
36	3300009553	Ga0105249_10454220	Ga0105249_104542202	333
37	3300025981	Ga0207640_10102091	Ga0207640_101020912	333
38	3300026041	Ga0207639_10280555	Ga0207639_102805552	333
39	3300026075	Ga0207708_10017238	Ga0207708_100172381	333
40	3300026088	Ga0207641_10189235	Ga0207641_101892352	333
41	3300026118	Ga0207675_100027623	Ga0207675_1000276233	333
42	3300031728	Ga0316578_10183728	Ga0316578_101837281	333
43	3300036712	Ga0316584_0066870	Ga0316584_0066870_1192_2265	333
44	3300005459	Ga0068867_100248409	Ga0068867_1002484092	334
45	3300014326	Ga0157380_10104433	Ga0157380_101044332	335
46	3300025315	Ga0207697_10018321	Ga0207697_100183211	335
47	3300025918	Ga0207662_10098923	Ga0207662_100989232	335
48	3300005844	Ga0068862_100018981	Ga0068862_1000189811	336
49	3300026089	Ga0207648_10093384	Ga0207648_100933842	336
50	3300003203	JGI25406J46586_10024058	JGI25406J46586_100240582	337
51	3300009147	Ga0114129_10009796	Ga0114129_100097967	337
52	3300009177	Ga0105248_10484060	Ga0105248_104840601	337
53	3300005331	Ga0070670_100017767	Ga0070670_1000177671	338
54	3300005355	Ga0070671_100005506	Ga0070671_10000550610	338
55	3300005577	Ga0068857_100067092	Ga0068857_1000670924	338
56	3300009147	Ga0114129_10058691	Ga0114129_100586915	338
57	3300026116	Ga0207674_10125168	Ga0207674_101251683	338
58	3300050515	nmdc:mga0a205_432662_c1	nmdc:mga0a205_432662_c1_100_1167	338
59	3300005293	Ga0065715_10100976	Ga0065715_101009765	339
60	3300005440	Ga0070705_100061237	Ga0070705_1000612371	339
61	3300005458	Ga0070681_10011510	Ga0070681_100115102	339
62	3300005530	Ga0070679_100254363	Ga0070679_1002543632	339
63	3300005545	Ga0070695_100200118	Ga0070695_1002001182	339
64	3300005546	Ga0070696_100112188	Ga0070696_1001121882	339
65	3300005549	Ga0070704_100110844	Ga0070704_1001108441	339
66	3300005617	Ga0068859_100008476	Ga0068859_1000084764	339
67	3300006931	Ga0097620_100008476	Ga0097620_1000084766	339
68	3300009101	Ga0105247_10001490	Ga0105247_1000149024	339
69	3300009177	Ga0105248_10094229	Ga0105248_100942294	339
70	3300009545	Ga0105237_10091570	Ga0105237_100915702	339
71	3300025900	Ga0207710_10000718	Ga0207710_1000071824	339
72	3300025900	Ga0207710_10120622	Ga0207710_101206221	339
73	3300025911	Ga0207654_10016605	Ga0207654_100166054	339
74	3300025912	Ga0207707_10003187	Ga0207707_100031875	339
75	3300025960	Ga0207651_10089844	Ga0207651_100898443	339
76	3300025961	Ga0207712_10015243	Ga0207712_100152432	339
77	3300028381	Ga0268264_10323282	Ga0268264_103232822	339
78	3300048915	Ga0496112_0325221	Ga0496112_0325221_47_1072	339
79	3300002459	JGI24751J29686_10000107	JGI24751J29686_100001072	340
80	3300005331	Ga0070670_100001037	Ga0070670_10000103712	340
81	3300013308	Ga0157375_10155130	Ga0157375_101551302	340
82	3300014325	Ga0163163_10000183	Ga0163163_1000018334	340
83	3300025925	Ga0207650_10000001	Ga0207650_10000001518	340
84	3300005289	Ga0065704_10008014	Ga0065704_100080143	341
85	3300005295	Ga0065707_10207817	Ga0065707_102078171	341
86	3300005441	Ga0070700_100121832	Ga0070700_1001218322	341
87	3300005543	Ga0070672_100201802	Ga0070672_1002018022	341
88	3300009553	Ga0105249_10116389	Ga0105249_101163891	341
89	3300013307	Ga0157372_10025429	Ga0157372_100254297	341
90	3300013308	Ga0157375_10162790	Ga0157375_101627903	341
91	3300014326	Ga0157380_10234928	Ga0157380_102349281	341
92	3300025923	Ga0207681_10129872	Ga0207681_101298721	341
93	3300025940	Ga0207691_10240199	Ga0207691_102401991	341
94	3300025961	Ga0207712_10103991	Ga0207712_101039912	341
95	3300026118	Ga0207675_100229660	Ga0207675_1002296601	341
96	3300049513	Ga0501290_009437	Ga0501290_009437_203_1231	341
97	3300005295	Ga0065707_10118895	Ga0065707_101188952	342
98	3300005843	Ga0068860_100267765	Ga0068860_1002677652	342
99	3300009177	Ga0105248_10093639	Ga0105248_100936393	342
100	3300009551	Ga0105238_10012483	Ga0105238_100124833	342
101	3300013306	Ga0163162_10011561	Ga0163162_1001156112	342
102	3300014968	Ga0157379_10087129	Ga0157379_100871293	342
103	3300025924	Ga0207694_10009652	Ga0207694_100096522	342
104	3300025941	Ga0207711_10060154	Ga0207711_100601542	342
105	3300028381	Ga0268264_10107710	Ga0268264_101077103	342
106	3300006880	Ga0075429_100029076	Ga0075429_1000290765	343
107	3300009147	Ga0114129_10290869	Ga0114129_102908692	343
108	3300013306	Ga0163162_10005889	Ga0163162_100058895	343
109	3300050508	nmdc:mga09592_26766_c1	nmdc:mga09592_26766_c1_2836_3906	343
110	3300005328	Ga0070676_10170411	Ga0070676_101704111	344
111	3300005459	Ga0068867_100128799	Ga0068867_1001287991	344
112	3300005615	Ga0070702_100137640	Ga0070702_1001376401	344
113	3300005985	Ga0081539_10003247	Ga0081539_100032473	344
114	3300013297	Ga0157378_10039624	Ga0157378_100396241	344
115	3300013297	Ga0157378_10188500	Ga0157378_101885002	344
116	3300014326	Ga0157380_10171378	Ga0157380_101713782	344
117	3300025917	Ga0207660_10249068	Ga0207660_102490681	344
118	3300005290	Ga0065712_10103059	Ga0065712_101030591	347
119	3300005406	Ga0070703_10000016	Ga0070703_1000001666	347
120	3300005445	Ga0070708_100198310	Ga0070708_1001983101	347
121	3300005518	Ga0070699_100090965	Ga0070699_1000909652	347
122	3300014326	Ga0157380_10031735	Ga0157380_100317355	347
123	3300025885	Ga0207653_10000362	Ga0207653_1000036212	347
124	3300005843	Ga0068860_100068559	Ga0068860_1000685594	349
125	3300009176	Ga0105242_10054067	Ga0105242_100540672	349
126	3300005518	Ga0070699_100032501	Ga0070699_1000325014	350
127	3300006871	Ga0075434_100215584	Ga0075434_1002155841	351
128	3300006914	Ga0075436_100005932	Ga0075436_1000059326	351
129	3300050509	nmdc:mga0qj67_48770_c1	nmdc:mga0qj67_48770_c1_2007_3071	351
130	3300050510	nmdc:mga06r32_377354_c1	nmdc:mga06r32_377354_c1_124_1188	351
131	3300005536	Ga0070697_100000422	Ga0070697_10000042225	352
132	3300009176	Ga0105242_10096887	Ga0105242_100968872	352
133	3300005353	Ga0070669_100160393	Ga0070669_1001603931	353
134	3300005543	Ga0070672_100053475	Ga0070672_1000534754	353
135	3300005843	Ga0068860_100076808	Ga0068860_1000768081	353
136	3300006914	Ga0075436_100000002	Ga0075436_100000002298	353
137	3300007076	Ga0075435_100004298	Ga0075435_1000042984	353
138	3300009176	Ga0105242_10003056	Ga0105242_1000305610	353
139	3300013306	Ga0163162_10037774	Ga0163162_100377746	353
140	3300013308	Ga0157375_10009563	Ga0157375_100095633	353
141	3300014325	Ga0163163_10183612	Ga0163163_101836122	353
142	3300025934	Ga0207686_10000335	Ga0207686_100003358	353
143	3300025940	Ga0207691_10060123	Ga0207691_100601235	353
144	3300026089	Ga0207648_10121433	Ga0207648_101214333	353
145	3300028381	Ga0268264_10057568	Ga0268264_100575685	353
146	3300048907	Ga0496104_0241393	Ga0496104_0241393_603_1670	353
147	3300050513	nmdc:mga0rr50_61_c1	nmdc:mga0rr50_61_c1_13699_14760	353
148	3300050514	nmdc:mga08x19_9_c1	nmdc:mga08x19_9_c1_74331_75392	353
149	3300005289	Ga0065704_10084422	Ga0065704_100844222	354
150	3300005293	Ga0065715_10090332	Ga0065715_100903325	354
151	3300005295	Ga0065707_10001813	Ga0065707_100018132	354
152	3300005331	Ga0070670_100402082	Ga0070670_1004020821	354
153	3300005334	Ga0068869_100367107	Ga0068869_1003671071	354
154	3300005337	Ga0070682_100006511	Ga0070682_10000651110	354
155	3300005337	Ga0070682_100131811	Ga0070682_1001318112	354
156	3300005338	Ga0068868_100104260	Ga0068868_1001042602	354
157	3300005339	Ga0070660_100160206	Ga0070660_1001602061	354
158	3300005343	Ga0070687_100002881	Ga0070687_1000028818	354
159	3300005344	Ga0070661_100106855	Ga0070661_1001068552	354
160	3300005345	Ga0070692_10005514	Ga0070692_100055143	354
161	3300005345	Ga0070692_10025863	Ga0070692_100258632	354
162	3300005345	Ga0070692_10041275	Ga0070692_100412752	354
163	3300005364	Ga0070673_100103237	Ga0070673_1001032372	354
164	3300005364	Ga0070673_100272014	Ga0070673_1002720142	354
165	3300005364	Ga0070673_100294352	Ga0070673_1002943521	354
166	3300005366	Ga0070659_100025535	Ga0070659_1000255351	354
167	3300005440	Ga0070705_100002198	Ga0070705_10000219810	354
168	3300005441	Ga0070700_100000092	Ga0070700_10000009233	354
169	3300005441	Ga0070700_100013167	Ga0070700_1000131676	354
170	3300005444	Ga0070694_100060784	Ga0070694_1000607845	354
171	3300005445	Ga0070708_100002362	Ga0070708_10000236214	354
172	3300005445	Ga0070708_100119219	Ga0070708_1001192192	354
173	3300005458	Ga0070681_10000475	Ga0070681_1000047520	354
174	3300005458	Ga0070681_10002322	Ga0070681_100023226	354
175	3300005458	Ga0070681_10022916	Ga0070681_100229161	354
176	3300005459	Ga0068867_100014031	Ga0068867_1000140316	354
177	3300005459	Ga0068867_100176971	Ga0068867_1001769712	354
178	3300005467	Ga0070706_100021984	Ga0070706_1000219848	354
179	3300005468	Ga0070707_100026729	Ga0070707_1000267293	354
180	3300005468	Ga0070707_100297096	Ga0070707_1002970962	354
181	3300005471	Ga0070698_100006142	Ga0070698_1000061427	354
182	3300005471	Ga0070698_100029558	Ga0070698_1000295585	354
183	3300005518	Ga0070699_100009745	Ga0070699_1000097451	354
184	3300005518	Ga0070699_100038140	Ga0070699_1000381406	354
185	3300005518	Ga0070699_100128462	Ga0070699_1001284621	354
186	3300005530	Ga0070679_100000307	Ga0070679_10000030719	354
187	3300005530	Ga0070679_100082638	Ga0070679_1000826385	354
188	3300005536	Ga0070697_100026034	Ga0070697_1000260342	354
189	3300005539	Ga0068853_100041243	Ga0068853_1000412435	354
190	3300005539	Ga0068853_100051590	Ga0068853_1000515901	354
191	3300005546	Ga0070696_100012112	Ga0070696_1000121126	354
192	3300005546	Ga0070696_100091205	Ga0070696_1000912052	354
193	3300005547	Ga0070693_100000305	Ga0070693_10000030514	354
194	3300005547	Ga0070693_100140516	Ga0070693_1001405161	354
195	3300005549	Ga0070704_100024541	Ga0070704_1000245412	354
196	3300005549	Ga0070704_100111045	Ga0070704_1001110452	354
197	3300005563	Ga0068855_100187489	Ga0068855_1001874892	354
198	3300005564	Ga0070664_100011220	Ga0070664_1000112206	354
199	3300005577	Ga0068857_100000277	Ga0068857_10000027726	354
200	3300005615	Ga0070702_100003303	Ga0070702_1000033033	354
201	3300005615	Ga0070702_100059397	Ga0070702_1000593971	354
202	3300005617	Ga0068859_100032266	Ga0068859_1000322663	354
203	3300005617	Ga0068859_100047168	Ga0068859_1000471682	354
204	3300005617	Ga0068859_100103698	Ga0068859_1001036982	354
205	3300005617	Ga0068859_100118669	Ga0068859_1001186692	354
206	3300005617	Ga0068859_100373080	Ga0068859_1003730802	354
207	3300005618	Ga0068864_100049800	Ga0068864_1000498002	354
208	3300005618	Ga0068864_100138889	Ga0068864_1001388892	354
209	3300005618	Ga0068864_100153925	Ga0068864_1001539253	354
210	3300005618	Ga0068864_100164498	Ga0068864_1001644982	354
211	3300005840	Ga0068870_10000847	Ga0068870_100008475	354
212	3300005841	Ga0068863_100128061	Ga0068863_1001280613	354
213	3300005841	Ga0068863_100389466	Ga0068863_1003894662	354
214	3300005843	Ga0068860_100016251	Ga0068860_1000162513	354
215	3300005843	Ga0068860_100069540	Ga0068860_1000695402	354
216	3300005844	Ga0068862_100072219	Ga0068862_1000722191	354
217	3300006173	Ga0070716_100032718	Ga0070716_1000327182	354
218	3300006237	Ga0097621_100001354	Ga0097621_10000135413	354
219	3300006237	Ga0097621_100030325	Ga0097621_1000303254	354
220	3300006358	Ga0068871_100003285	Ga0068871_1000032859	354
221	3300006844	Ga0075428_100070337	Ga0075428_1000703375	354
222	3300006846	Ga0075430_100053081	Ga0075430_1000530812	354
223	3300006852	Ga0075433_10081337	Ga0075433_100813372	354
224	3300006852	Ga0075433_10107418	Ga0075433_101074182	354
225	3300006852	Ga0075433_10184019	Ga0075433_101840192	354
226	3300006871	Ga0075434_100058548	Ga0075434_1000585482	354
227	3300006871	Ga0075434_100106514	Ga0075434_1001065142	354
228	3300006931	Ga0097620_100032266	Ga0097620_1000322665	354
229	3300006931	Ga0097620_100047167	Ga0097620_1000471672	354
230	3300006931	Ga0097620_100103698	Ga0097620_1001036983	354
231	3300006931	Ga0097620_100118666	Ga0097620_1001186662	354
232	3300006931	Ga0097620_100373072	Ga0097620_1003730722	354
233	3300009093	Ga0105240_10036772	Ga0105240_100367724	354
234	3300009094	Ga0111539_10001469	Ga0111539_1000146917	354
235	3300009094	Ga0111539_10010383	Ga0111539_1001038311	354
236	3300009094	Ga0111539_10190749	Ga0111539_101907491	354
237	3300009101	Ga0105247_10020829	Ga0105247_100208295	354
238	3300009147	Ga0114129_10026332	Ga0114129_1002633210	354
239	3300009147	Ga0114129_10064939	Ga0114129_100649392	354
240	3300009148	Ga0105243_10018544	Ga0105243_100185445	354
241	3300009174	Ga0105241_10133418	Ga0105241_101334182	354
242	3300009174	Ga0105241_10273680	Ga0105241_102736802	354
243	3300009174	Ga0105241_10288409	Ga0105241_102884092	354
244	3300009176	Ga0105242_10040203	Ga0105242_100402032	354
245	3300009177	Ga0105248_10006785	Ga0105248_100067856	354
246	3300009545	Ga0105237_10004213	Ga0105237_1000421315	354
247	3300009551	Ga0105238_10009780	Ga0105238_100097804	354
248	3300009553	Ga0105249_10235325	Ga0105249_102353251	354
249	3300011119	Ga0105246_10097828	Ga0105246_100978282	354
250	3300011119	Ga0105246_10159609	Ga0105246_101596091	354
251	3300013100	Ga0157373_10095163	Ga0157373_100951632	354
252	3300013306	Ga0163162_10111935	Ga0163162_101119352	354
253	3300013307	Ga0157372_10037304	Ga0157372_100373047	354
254	3300013307	Ga0157372_10339621	Ga0157372_103396212	354
255	3300013308	Ga0157375_10003589	Ga0157375_100035894	354
256	3300014325	Ga0163163_10014165	Ga0163163_100141655	354
257	3300014325	Ga0163163_10075029	Ga0163163_100750295	354
258	3300014325	Ga0163163_10096456	Ga0163163_100964561	354
259	3300014325	Ga0163163_10294133	Ga0163163_102941332	354
260	3300014968	Ga0157379_10126615	Ga0157379_101266152	354
261	3300014968	Ga0157379_10225433	Ga0157379_102254332	354
262	3300025885	Ga0207653_10015893	Ga0207653_100158932	354
263	3300025904	Ga0207647_10000502	Ga0207647_1000050231	354
264	3300025912	Ga0207707_10000006	Ga0207707_10000006189	354
265	3300025913	Ga0207695_10064972	Ga0207695_100649725	354
266	3300025914	Ga0207671_10006170	Ga0207671_100061705	354
267	3300025917	Ga0207660_10001704	Ga0207660_1000170411	354
268	3300025918	Ga0207662_10059605	Ga0207662_100596052	354
269	3300025921	Ga0207652_10000216	Ga0207652_1000021651	354
270	3300025922	Ga0207646_10029914	Ga0207646_100299141	354
271	3300025922	Ga0207646_10091650	Ga0207646_100916502	354
272	3300025924	Ga0207694_10019982	Ga0207694_100199823	354
273	3300025925	Ga0207650_10253272	Ga0207650_102532722	354
274	3300025932	Ga0207690_10041056	Ga0207690_100410561	354
275	3300025934	Ga0207686_10048297	Ga0207686_100482972	354
276	3300025941	Ga0207711_10105707	Ga0207711_101057072	354
277	3300025942	Ga0207689_10033647	Ga0207689_100336472	354
278	3300025942	Ga0207689_10106290	Ga0207689_101062902	354
279	3300025945	Ga0207679_10350186	Ga0207679_103501861	354
280	3300025960	Ga0207651_10031030	Ga0207651_100310303	354
281	3300025960	Ga0207651_10075623	Ga0207651_100756232	354
282	3300025961	Ga0207712_10005923	Ga0207712_100059239	354
283	3300026023	Ga0207677_10050492	Ga0207677_100504922	354
284	3300026035	Ga0207703_10449486	Ga0207703_104494862	354
285	3300026041	Ga0207639_10076154	Ga0207639_100761542	354
286	3300026041	Ga0207639_10192937	Ga0207639_101929372	354
287	3300026075	Ga0207708_10000061	Ga0207708_1000006133	354
288	3300026075	Ga0207708_10003905	Ga0207708_100039053	354
289	3300026075	Ga0207708_10047175	Ga0207708_100471753	354
290	3300026088	Ga0207641_10078426	Ga0207641_100784262	354
291	3300026088	Ga0207641_10332554	Ga0207641_103325541	354
292	3300026089	Ga0207648_10068784	Ga0207648_100687841	354
293	3300026095	Ga0207676_10048727	Ga0207676_100487273	354
294	3300026095	Ga0207676_10404850	Ga0207676_104048501	354
295	3300026116	Ga0207674_10000192	Ga0207674_1000019218	354
296	3300026116	Ga0207674_10091726	Ga0207674_100917262	354
297	3300028380	Ga0268265_10131230	Ga0268265_101312301	354
298	3300028380	Ga0268265_10357995	Ga0268265_103579952	354
299	3300028381	Ga0268264_10006536	Ga0268264_100065366	354
300	3300031901	Ga0307406_10014187	Ga0307406_100141873	354
301	3300032002	Ga0307416_100122911	Ga0307416_1001229113	354
302	3300032002	Ga0307416_100258963	Ga0307416_1002589632	354
303	3300035115	Ga0373941_0018329	Ga0373941_0018329_496_1569	354
304	3300035207	Ga0373942_0001683	Ga0373942_0001683_924_1997	354
305	3300035691	Ga0373931_0057633	Ga0373931_0057633_927_2000	354
306	3300037466	Ga0395898_0213879	Ga0395898_0213879_345_1421	354
307	3300038699	Ga0242422_01887	Ga0242422_01887_158_1231	354
308	3300045051	Ga0451576_0291048	Ga0451576_0291048_30_1106	354
309	3300048911	Ga0496108_0222206	Ga0496108_0222206_222_1295	354
310	3300048916	Ga0496113_0024408	Ga0496113_0024408_3098_4171	354
311	3300049574	Ga0501038_0007200	Ga0501038_0007200_3532_4599	354
312	3300049654	Ga0501207_006484	Ga0501207_006484_326_1399	354
313	3300049661	Ga0501217_014372	Ga0501217_014372_112_1185	354
314	3300049668	Ga0501233_012765	Ga0501233_012765_395_1468	354
315	3300049705	Ga0501225_0005819	Ga0501225_0005819_1872_2945	354
316	3300049707	Ga0501234_002720	Ga0501234_002720_1682_2755	354
317	3300050511	nmdc:mga08y16_271891_c1	nmdc:mga08y16_271891_c1_335_1408	354
318	3300050513	nmdc:mga0rr50_124616_c1	nmdc:mga0rr50_124616_c1_831_1901	354
319	3300050513	nmdc:mga0rr50_218664_c1	nmdc:mga0rr50_218664_c1_268_1341	354
320	3300050515	nmdc:mga0a205_165893_c1	nmdc:mga0a205_165893_c1_364_1437	354
321	3300050515	nmdc:mga0a205_258340_c1	nmdc:mga0a205_258340_c1_214_1284	354
322	3300050515	nmdc:mga0a205_6874_c1	nmdc:mga0a205_6874_c1_2006_3079	354
323	3300061734	Ga0530510_0026566	Ga0530510_0026566_1447_2514	354
324	3300005331	Ga0070670_100006797	Ga0070670_1000067972	355
325	3300005340	Ga0070689_100011345	Ga0070689_1000113454	355
326	3300005440	Ga0070705_100087424	Ga0070705_1000874243	355
327	3300005549	Ga0070704_100049291	Ga0070704_1000492913	355
328	3300005843	Ga0068860_100091434	Ga0068860_1000914342	355
329	3300009174	Ga0105241_10007502	Ga0105241_100075024	355
330	3300013297	Ga0157378_10032061	Ga0157378_100320613	355
331	3300013297	Ga0157378_10255001	Ga0157378_102550011	355
332	3300013308	Ga0157375_10451188	Ga0157375_104511882	355
333	3300014968	Ga0157379_10406746	Ga0157379_104067462	355
334	3300025911	Ga0207654_10002853	Ga0207654_100028534	355
335	3300025925	Ga0207650_10001704	Ga0207650_1000170414	355
336	3300025936	Ga0207670_10053929	Ga0207670_100539292	355
337	3300026035	Ga0207703_10146409	Ga0207703_101464093	355
338	3300028381	Ga0268264_10017556	Ga0268264_100175562	355
339	3300048911	Ga0496108_0121254	Ga0496108_0121254_237_1349	355
340	3300050514	nmdc:mga08x19_3718_c1	nmdc:mga08x19_3718_c1_6319_7389	355
341	3300005334	Ga0068869_100047020	Ga0068869_1000470202	356
342	3300005337	Ga0070682_100000051	Ga0070682_10000005161	356
343	3300005444	Ga0070694_100009763	Ga0070694_1000097634	356
344	3300005444	Ga0070694_100149474	Ga0070694_1001494741	356
345	3300005467	Ga0070706_100044529	Ga0070706_1000445294	356
346	3300005467	Ga0070706_100102850	Ga0070706_1001028501	356
347	3300005468	Ga0070707_100295094	Ga0070707_1002950941	356
348	3300005536	Ga0070697_100204012	Ga0070697_1002040121	356
349	3300005546	Ga0070696_100063431	Ga0070696_1000634312	356
350	3300005549	Ga0070704_100035441	Ga0070704_1000354412	356
351	3300005549	Ga0070704_100127655	Ga0070704_1001276552	356
352	3300005719	Ga0068861_100060062	Ga0068861_1000600624	356
353	3300006852	Ga0075433_10115436	Ga0075433_101154362	356
354	3300006871	Ga0075434_100086559	Ga0075434_1000865592	356
355	3300007265	Ga0099794_10053400	Ga0099794_100534002	356
356	3300009098	Ga0105245_10112462	Ga0105245_101124622	356
357	3300009148	Ga0105243_10000716	Ga0105243_1000071610	356
358	3300009176	Ga0105242_10009846	Ga0105242_100098464	356
359	3300009177	Ga0105248_10001663	Ga0105248_1000166314	356
360	3300009553	Ga0105249_10094702	Ga0105249_100947022	356
361	3300010375	Ga0105239_10006596	Ga0105239_1000659611	356
362	3300013297	Ga0157378_10000017	Ga0157378_1000001792	356
363	3300013297	Ga0157378_10013835	Ga0157378_100138352	356
364	3300013297	Ga0157378_10035485	Ga0157378_100354856	356
365	3300013308	Ga0157375_10009176	Ga0157375_100091763	356
366	3300014326	Ga0157380_10004802	Ga0157380_100048022	356
367	3300025901	Ga0207688_10073734	Ga0207688_100737342	356
368	3300025910	Ga0207684_10091066	Ga0207684_100910661	356
369	3300025927	Ga0207687_10131486	Ga0207687_101314861	356
370	3300025934	Ga0207686_10006124	Ga0207686_100061246	356
371	3300025935	Ga0207709_10002084	Ga0207709_100020848	356
372	3300025941	Ga0207711_10015352	Ga0207711_100153527	356
373	3300025961	Ga0207712_10126191	Ga0207712_101261912	356
374	3300026023	Ga0207677_10072229	Ga0207677_100722293	356
375	3300026118	Ga0207675_100026095	Ga0207675_1000260954	356
376	3300044712	Ga0453684_0489857	Ga0453684_0489857_24_1094	356
377	3300045051	Ga0451576_0285465	Ga0451576_0285465_23_1093	356
378	3300046525	Ga0495663_0000123	Ga0495663_0000123_24907_26052	356
379	3300046664	Ga0495659_0083658	Ga0495659_0083658_60_1136	356
380	3300048909	Ga0496106_0006150	Ga0496106_0006150_4682_5752	356
381	3300049517	Ga0501294_003978	Ga0501294_003978_255_1328	356
382	3300049519	Ga0501296_000186	Ga0501296_000186_5329_6402	356
383	3300049520	Ga0501297_000526	Ga0501297_000526_2309_3382	356
384	3300049521	Ga0501298_007083	Ga0501298_007083_24_1097	356
385	3300049663	Ga0501223_004364	Ga0501223_004364_176_1249	356
386	3300049664	Ga0501224_015123	Ga0501224_015123_57_1130	356
387	3300049669	Ga0501235_012482	Ga0501235_012482_146_1219	356
388	3300049779	Ga0501283_003794	Ga0501283_003794_321_1394	356
389	3300005295	Ga0065707_10002355	Ga0065707_100023556	357
390	3300005295	Ga0065707_10089940	Ga0065707_100899403	357
391	3300005340	Ga0070689_100062497	Ga0070689_1000624973	357
392	3300005347	Ga0070668_100017258	Ga0070668_1000172582	357
393	3300005353	Ga0070669_100000729	Ga0070669_10000072921	357
394	3300005440	Ga0070705_100057547	Ga0070705_1000575472	357
395	3300005441	Ga0070700_100070766	Ga0070700_1000707664	357
396	3300005444	Ga0070694_100000063	Ga0070694_10000006341	357
397	3300005467	Ga0070706_100048731	Ga0070706_1000487316	357
398	3300005467	Ga0070706_100057046	Ga0070706_1000570462	357
399	3300005467	Ga0070706_100280604	Ga0070706_1002806041	357
400	3300005468	Ga0070707_100000329	Ga0070707_10000032930	357
401	3300005471	Ga0070698_100000741	Ga0070698_10000074110	357
402	3300005471	Ga0070698_100003588	Ga0070698_10000358811	357
403	3300005471	Ga0070698_100218586	Ga0070698_1002185861	357
404	3300005518	Ga0070699_100046797	Ga0070699_1000467974	357
405	3300005536	Ga0070697_100000176	Ga0070697_1000001766	357
406	3300005544	Ga0070686_100119190	Ga0070686_1001191901	357
407	3300005545	Ga0070695_100085727	Ga0070695_1000857272	357
408	3300005578	Ga0068854_100286878	Ga0068854_1002868781	357
409	3300005615	Ga0070702_100044301	Ga0070702_1000443013	357
410	3300005617	Ga0068859_100020359	Ga0068859_1000203594	357
411	3300005719	Ga0068861_100037632	Ga0068861_1000376325	357
412	3300005841	Ga0068863_100054786	Ga0068863_1000547863	357
413	3300005841	Ga0068863_100199973	Ga0068863_1001999732	357
414	3300005842	Ga0068858_100052025	Ga0068858_1000520252	357
415	3300005844	Ga0068862_100097844	Ga0068862_1000978442	357
416	3300006163	Ga0070715_10000016	Ga0070715_1000001698	357
417	3300006173	Ga0070716_100000002	Ga0070716_10000000217	357
418	3300006173	Ga0070716_100155244	Ga0070716_1001552442	357
419	3300006852	Ga0075433_10071843	Ga0075433_100718434	357
420	3300006852	Ga0075433_10427957	Ga0075433_104279571	357
421	3300006880	Ga0075429_100030125	Ga0075429_1000301253	357
422	3300006931	Ga0097620_100020357	Ga0097620_1000203578	357
423	3300009094	Ga0111539_10007977	Ga0111539_100079774	357
424	3300009101	Ga0105247_10112102	Ga0105247_101121022	357
425	3300009147	Ga0114129_10034670	Ga0114129_100346702	357
426	3300009147	Ga0114129_10058822	Ga0114129_100588224	357
427	3300009147	Ga0114129_10175631	Ga0114129_101756312	357
428	3300009148	Ga0105243_10000037	Ga0105243_10000037156	357
429	3300009176	Ga0105242_10012945	Ga0105242_100129455	357
430	3300009553	Ga0105249_10000375	Ga0105249_1000037519	357
431	3300013306	Ga0163162_10000162	Ga0163162_1000016225	357
432	3300013306	Ga0163162_10321683	Ga0163162_103216832	357
433	3300014326	Ga0157380_10215200	Ga0157380_102152001	357
434	3300017792	Ga0163161_10011938	Ga0163161_100119386	357
435	3300025905	Ga0207685_10000045	Ga0207685_1000004521	357
436	3300025910	Ga0207684_10003181	Ga0207684_1000318115	357
437	3300025918	Ga0207662_10044857	Ga0207662_100448573	357
438	3300025922	Ga0207646_10001617	Ga0207646_1000161716	357
439	3300025922	Ga0207646_10009172	Ga0207646_100091728	357
440	3300025922	Ga0207646_10047165	Ga0207646_100471653	357
441	3300025922	Ga0207646_10199099	Ga0207646_101990992	357
442	3300025923	Ga0207681_10000428	Ga0207681_1000042815	357
443	3300025934	Ga0207686_10000003	Ga0207686_10000003344	357
444	3300025935	Ga0207709_10000017	Ga0207709_10000017401	357
445	3300025939	Ga0207665_10000007	Ga0207665_10000007174	357
446	3300025939	Ga0207665_10224008	Ga0207665_102240081	357
447	3300025961	Ga0207712_10000313	Ga0207712_1000031326	357
448	3300026075	Ga0207708_10013566	Ga0207708_100135666	357
449	3300026075	Ga0207708_10054701	Ga0207708_100547013	357
450	3300026088	Ga0207641_10207900	Ga0207641_102079001	357
451	3300026118	Ga0207675_100014671	Ga0207675_1000146713	357
452	3300027907	Ga0207428_10026938	Ga0207428_100269385	357
453	3300027907	Ga0207428_10052940	Ga0207428_100529404	357
454	3300028381	Ga0268264_10047834	Ga0268264_100478343	357
455	3300046537	Ga0495598_0000081	Ga0495598_0000081_11500_12651	357
456	3300046539	Ga0495621_0001399	Ga0495621_0001399_4417_5568	357
457	3300046539	Ga0495621_0044770	Ga0495621_0044770_68_1147	357
458	3300050507	nmdc:mga05p37_33973_c1	nmdc:mga05p37_33973_c1_4497_5570	357
459	3300050508	nmdc:mga09592_50430_c1	nmdc:mga09592_50430_c1_1754_2842	357
460	3300050511	nmdc:mga08y16_151743_c1	nmdc:mga08y16_151743_c1_1233_2324	357
461	3300050511	nmdc:mga08y16_72243_c1	nmdc:mga08y16_72243_c1_203_1291	357
462	3300050515	nmdc:mga0a205_220628_c1	nmdc:mga0a205_220628_c1_37_1110	357
463	3300050515	nmdc:mga0a205_53986_c1	nmdc:mga0a205_53986_c1_942_2015	357
464	3300001432	JGI24034J14986_100440	JGI24034J14986_1004402	359
465	3300002074	JGI24748J21848_1000001	JGI24748J21848_100000186	359
466	3300002239	JGI24034J26672_10000001	JGI24034J26672_10000001329	359
467	3300005355	Ga0070671_100015002	Ga0070671_1000150022	359
468	3300005615	Ga0070702_100012541	Ga0070702_1000125414	359
469	3300005842	Ga0068858_100000127	Ga0068858_10000012734	359
470	3300009101	Ga0105247_10000004	Ga0105247_10000004361	359
471	3300014968	Ga0157379_10192085	Ga0157379_101920851	359
472	3300025900	Ga0207710_10000002	Ga0207710_10000002650	359
473	3300025931	Ga0207644_10000500	Ga0207644_1000050029	359
474	3300026035	Ga0207703_10000092	Ga0207703_1000009214	359

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03088

Str_synth

Strictosidine synthase

170

257

0.97 PF20067

SSL_N

Strictosidine synthase-like, N-terminal

56

108

0.9 PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

100

307

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6s5u-assembly5.cif.gz_E	strictosidine synthase from ophiorrhiza pumila in complex with n-[2-(1h-indol-3-yl)ethyl]-3-methyl-1-butanamine	0.8676	53	352
6s5u-assembly3.cif.gz_B	strictosidine synthase from ophiorrhiza pumila in complex with n-[2-(1h-indol-3-yl)ethyl]-3-methyl-1-butanamine	0.8671	53	352
6n5v-assembly1.cif.gz_A	crystal structure of strictosidine in complex with 1h-indole-4-ethanamine	0.8604	52	352
2fpb-assembly2.cif.gz_B	structure of strictosidine synthase, the biosynthetic entry to the monoterpenoid indole alkaloid family	0.8568	53	355
6s5u-assembly5.cif.gz_E	strictosidine synthase from ophiorrhiza pumila in complex with n-[2-(1h-indol-3-yl)ethyl]-3-methyl-1-butanamine	0.8453	53	352

ID	Description	Score	Start	End	Superfamily
af_A0A0P0V705_54_290_2.120.10.30	Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain	0.9487	54	253	2.120.10.30
af_B3DIS2_97_431_2.120.10.30	Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain	0.9371	47	353	2.120.10.30
af_Q0IW03_1_250_2.120.10.30	Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain	0.934	108	354	2.120.10.30
af_A0A1D6L4P1_59_223_2.120.10.30	Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain	0.9321	63	169	2.120.10.30
af_Q8H3A4_46_364_2.120.10.30	Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain	0.9301	50	352	2.120.10.30

ID	Description	Score	Start	End	GO Terms
AF-A0A7W1BY63-F1-model_v4	SMP-30/gluconolactonase/LRE family protein	0.9918	1	354	GO:0009058 GO:0012505 GO:0016844
AF-A0A7W1BY63-F1-model_v4	SMP-30/gluconolactonase/LRE family protein	0.9835	1	354	GO:0009058 GO:0012505 GO:0016844
AF-A0A356IP10-F1-model_v4	Gluconolactonase	0.9822	155	357	GO:0009058 GO:0016844
AF-A0A1I7XZ23-F1-model_v4	Str_synth domain-containing protein	0.9818	157	250	GO:0009058 GO:0012505 GO:0016844
AF-A0A072VLP5-F1-model_v4	SMP-30/gluconolaconase/LRE-like region protein	0.9801	150	254	GO:0005773 GO:0009058 GO:0016787 GO:0016844

Feature Viewer

pLDDT	pTM	Quality
95.64	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F451134

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03088

Str_synth

Strictosidine synthase

170

257

0.97

PF20067

SSL_N

Strictosidine synthase-like, N-terminal

56

108

0.9

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

100

307

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map