F451099

General Info

Members Datasets Scaffolds Average Seq Length
473 230 946 275

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0204069|Ga0501037_0204069_156_1070
Length 304
Sequence MAHSGEATRFCAVNTLSPHEWSCASEERNTMTQLIETTPDLEAVKQRQQQAWSSGDYSAIAAQIVLVAERLADTADLRAGWHVLDVATGTGNAALAAARLGCTVVGVDYVPSLLERGRARASAEGLDVSLLEGDAESLPFPDRSFDAVTSVFGSMFAPDHGRTASEILRVTRPGGRIALASWTPDGFIGQLFRTVGAHVPPPAGVRSPMLWGTESHLRELFGDGIDTLEVRERTFTFRYPSAEHFVAFFRRWYGPTLKAFAALEGKARHALEKDLVALARRFDRLGADAVAIPSTYTEAIAVAR

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
131 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2508501039 Frankia saprophytica CN3 Isolate Nodule
224 2671180195 Frankia sp. CcI49 Isolate Nodule
225 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
226 2687453737 Frankia sp. BMG5.36 Isolate Nodule
227 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
228 2773857922 Frankia sp. CcI49 Isolate Nodule
229 8002784119 Frankia sp. AgB1.9 Isolate Nodule
230 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 1.69
Rhizoplane 8.46
Rhizosphere 86.68
Stem 0
Stem Tuber 0
Unclassified 4.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0204069 3300049573 Bacteria 1396
2 Ga0055536_1017389 3300003781 Bacteria 2356
3 Ga0055534_1002143 3300003784 Bacteria 7073
4 Ga0055540_1027428 3300003792 Bacteria 1363
5 Ga0070658_10007739 3300005327 Bacteria 8658
6 Ga0070658_10103399 3300005327 Bacteria 2356
7 Ga0070676_10025607 3300005328 Bacteria 3336
8 Ga0070676_10300635 3300005328 Bacteria 1088
9 Ga0070683_100019052 3300005329 Bacteria 6089
10 Ga0070670_100268226 3300005331 Bacteria 1489
11 Ga0070680_100048369 3300005336 Bacteria 3466
12 Ga0070660_100028720 3300005339 Bacteria 4164
13 Ga0070660_100084587 3300005339 Bacteria 2493
14 Ga0070668_100017698 3300005347 Bacteria 5344
15 Ga0070675_100036753 3300005354 Bacteria 3987
16 Ga0070675_100663111 3300005354 Unclassified 949
17 Ga0070659_100019544 3300005366 Bacteria 5135
18 Ga0070667_100112988 3300005367 Bacteria 2357
19 Ga0070709_10052370 3300005434 Bacteria 2565
20 Ga0070714_100005584 3300005435 Bacteria 9609
21 Ga0070714_100140175 3300005435 Bacteria 2169
22 Ga0070714_100277117 3300005435 Bacteria 1557
23 Ga0070714_100460935 3300005435 Unclassified 1208
24 Ga0070713_100183394 3300005436 Bacteria 1882
25 Ga0070710_10194557 3300005437 Bacteria 1277
26 Ga0070710_10201751 3300005437 Bacteria 1256
27 Ga0070710_10225957 3300005437 Bacteria 1193
28 Ga0070711_100194249 3300005439 Bacteria 1562
29 Ga0070678_100207398 3300005456 Bacteria 1622
30 Ga0070678_100355307 3300005456 Bacteria 1261
31 Ga0070679_100019224 3300005530 Bacteria 6638
32 Ga0070684_100023760 3300005535 Bacteria 5133
33 Ga0070684_100088337 3300005535 Bacteria 2754
34 Ga0070684_100141436 3300005535 Bacteria 2176
35 Ga0070684_100444512 3300005535 Bacteria 1198
36 Ga0070672_100166428 3300005543 Bacteria 1831
37 Ga0070696_100628165 3300005546 Bacteria 869
38 Ga0070665_100131689 3300005548 Bacteria 2503
39 Ga0068855_100225729 3300005563 Unclassified 2099
40 Ga0068855_100315860 3300005563 Viruses 1728
41 Ga0070664_100020591 3300005564 Bacteria 5432
42 Ga0068856_100367971 3300005614 Bacteria 1456
43 Ga0068852_100556578 3300005616 Bacteria 1148
44 Ga0068852_100570117 3300005616 Bacteria 1134
45 Ga0068864_100052590 3300005618 Bacteria 3511
46 Ga0068861_100180191 3300005719 Bacteria 1758
47 Ga0068851_10082288 3300005834 Bacteria 1683
48 Ga0068858_100000001 3300005842 Bacteria 417735
49 Ga0068862_100501711 3300005844 Bacteria 1152
50 Ga0068862_100545824 3300005844 Bacteria 1106
51 Ga0081455_10270795 3300005937 Unclassified 1232
52 Ga0081538_10010817 3300005981 Bacteria 7450
53 Ga0081539_10002480 3300005985 Bacteria 25953
54 Ga0070717_10250822 3300006028 Unclassified 1564
55 Ga0075365_10259686 3300006038 Bacteria 1221
56 Ga0070715_10102908 3300006163 Bacteria 1335
57 Ga0070712_100048882 3300006175 Bacteria 2934
58 Ga0070712_100067469 3300006175 Bacteria 2545
59 Ga0075428_100016981 3300006844 Bacteria 8040
60 Ga0075428_100018653 3300006844 Bacteria 7669
61 Ga0075430_100013658 3300006846 Bacteria 6925
62 Ga0075430_100148637 3300006846 Bacteria 1951
63 Ga0075431_100001828 3300006847 Bacteria 20111
64 Ga0075429_100016078 3300006880 Bacteria 6482
65 Ga0075429_100233528 3300006880 Bacteria 1611
66 Ga0068865_100029999 3300006881 Unclassified 3613
67 Ga0075435_100238303 3300007076 Bacteria 1547
68 Ga0111539_10227978 3300009094 Bacteria 2170
69 Ga0111539_10321476 3300009094 Bacteria 1801
70 Ga0111539_10372126 3300009094 Bacteria 1663
71 Ga0105245_10011720 3300009098 Bacteria 7628
72 Ga0105245_10047814 3300009098 Bacteria 3825
73 Ga0105245_10097241 3300009098 Bacteria 2718
74 Ga0105245_10189206 3300009098 Bacteria 1971
75 Ga0105245_10517627 3300009098 Bacteria 1211
76 Ga0114129_10176783 3300009147 Bacteria 2907
77 Ga0114129_10180259 3300009147 Bacteria 2875
78 Ga0114129_10193391 3300009147 Bacteria 2761
79 Ga0114129_10283119 3300009147 Bacteria 2215
80 Ga0105243_10106604 3300009148 Unclassified 2336
81 Ga0105243_10173553 3300009148 Bacteria 1869
82 Ga0105242_10031121 3300009176 Bacteria 4260
83 Ga0105242_10068674 3300009176 Bacteria 2933
84 Ga0105242_10248900 3300009176 Bacteria 1601
85 Ga0105248_10000529 3300009177 Bacteria 43587
86 Ga0105248_10001531 3300009177 Bacteria 25745
87 Ga0105237_10087035 3300009545 Bacteria 3114
88 Ga0105249_10424999 3300009553 Bacteria 1363
89 Ga0105249_10669724 3300009553 Bacteria 1096
90 Ga0105239_10080403 3300010375 Bacteria 3586
91 Ga0105239_10107750 3300010375 Bacteria 3087
92 Ga0105239_10131824 3300010375 Bacteria 2781
93 Ga0105239_10566966 3300010375 Bacteria 1294
94 Ga0157370_10071626 3300013104 Bacteria 3270
95 Ga0157369_10024480 3300013105 Bacteria 6715
96 Ga0157369_10163761 3300013105 Bacteria 2346
97 Ga0157374_10054733 3300013296 Bacteria 3722
98 Ga0163162_10577078 3300013306 Bacteria 1252
99 Ga0157372_10024511 3300013307 Bacteria 6555
100 Ga0157372_10271515 3300013307 Bacteria 1971
101 Ga0157375_10388911 3300013308 Bacteria 1561
102 Ga0157375_10718271 3300013308 Bacteria 1152
103 Ga0157380_10196909 3300014326 Bacteria 1784
104 Ga0182008_10094900 3300014497 Bacteria 1472
105 Ga0157379_10000059 3300014968 Bacteria 69772
106 Ga0209673_1017724 3300025273 Bacteria 2617
107 Ga0209675_1006151 3300025291 Bacteria 4881
108 Ga0209676_1008066 3300025292 Bacteria 4786
109 Ga0209025_1020381 3300025294 Bacteria 3631
110 Ga0209050_1022453 3300025298 Bacteria 2260
111 Ga0207692_10142952 3300025898 Bacteria 1363
112 Ga0207692_10162580 3300025898 Bacteria 1288
113 Ga0207685_10004092 3300025905 Bacteria 3652
114 Ga0207699_10066483 3300025906 Bacteria 2189
115 Ga0207645_10099918 3300025907 Bacteria 1871
116 Ga0207705_10028486 3300025909 Bacteria 3982
117 Ga0207705_10203715 3300025909 Bacteria 1499
118 Ga0207671_10322629 3300025914 Bacteria 1222
119 Ga0207693_10005748 3300025915 Bacteria 10293
120 Ga0207693_10076504 3300025915 Bacteria 2621
121 Ga0207663_10146640 3300025916 Bacteria 1651
122 Ga0207660_10036020 3300025917 Bacteria 3438
123 Ga0207657_10046994 3300025919 Bacteria 3777
124 Ga0207657_10051734 3300025919 Bacteria 3569
125 Ga0207649_10152295 3300025920 Bacteria 1594
126 Ga0207652_10022796 3300025921 Bacteria 5185
127 Ga0207659_10019285 3300025926 Bacteria 4486
128 Ga0207659_10557285 3300025926 Unclassified 975
129 Ga0207687_10055359 3300025927 Bacteria 2779
130 Ga0207687_10169536 3300025927 Bacteria 1682
131 Ga0207700_10136803 3300025928 Bacteria 2008
132 Ga0207690_10066206 3300025932 Bacteria 2474
133 Ga0207706_10110298 3300025933 Bacteria 2421
134 Ga0207709_10219655 3300025935 Unclassified 1370
135 Ga0207709_10240345 3300025935 Bacteria 1317
136 Ga0207669_10154991 3300025937 Unclassified 1610
137 Ga0207704_10041854 3300025938 Unclassified 2691
138 Ga0207704_10113694 3300025938 Bacteria 1836
139 Ga0207665_10262427 3300025939 Bacteria 1280
140 Ga0207691_10062990 3300025940 Bacteria 3364
141 Ga0207711_10000324 3300025941 Bacteria 50953
142 Ga0207711_10000537 3300025941 Bacteria 38776
143 Ga0207661_10054035 3300025944 Bacteria 3216
144 Ga0207661_10123907 3300025944 Bacteria 2205
145 Ga0207679_10156199 3300025945 Bacteria 1863
146 Ga0207667_10242877 3300025949 Viruses 1843
147 Ga0207668_10120055 3300025972 Bacteria 1989
148 Ga0207677_10124727 3300026023 Bacteria 1944
149 Ga0207703_10000007 3300026035 Bacteria 418220
150 Ga0207708_10096837 3300026075 Unclassified 2280
151 Ga0207708_10130691 3300026075 Bacteria 1963
152 Ga0207702_10138028 3300026078 Bacteria 2202
153 Ga0207676_10068975 3300026095 Bacteria 2830
154 Ga0207675_100056307 3300026118 Bacteria 3667
155 Ga0207675_100145732 3300026118 Bacteria 2251
156 Ga0207675_100652311 3300026118 Bacteria 1059
157 Ga0207683_10190236 3300026121 Bacteria 1863
158 Ga0207428_10003848 3300027907 Bacteria 14396
159 Ga0268266_10286439 3300028379 Bacteria 1533
160 Ga0268265_10519231 3300028380 Bacteria 1126
161 Ga0268265_10520744 3300028380 Bacteria 1124
162 Ga0307408_100721530 3300031548 Bacteria 898
163 Ga0307405_10020003 3300031731 Bacteria 3731
164 Ga0307405_10370387 3300031731 Bacteria 1112
165 Ga0307413_10005472 3300031824 Bacteria 5675
166 Ga0307410_10475221 3300031852 Bacteria 1024
167 Ga0307407_10006600 3300031903 Bacteria 5178
168 Ga0307407_10052891 3300031903 Bacteria 2334
169 Ga0307412_10089472 3300031911 Bacteria 2150
170 Ga0307412_10092363 3300031911 Bacteria 2121
171 Ga0307412_10176851 3300031911 Bacteria 1601
172 Ga0307409_100443663 3300031995 Bacteria 1251
173 Ga0307416_100065691 3300032002 Bacteria 2983
174 Ga0307416_100113261 3300032002 Bacteria 2397
175 Ga0307416_100527272 3300032002 Bacteria 1250
176 Ga0307414_10063355 3300032004 Bacteria 2627
177 Ga0307411_10066592 3300032005 Bacteria 2420
178 Ga0307415_100318902 3300032126 Bacteria 1295
179 Ga0373943_0006879 3300035170 Bacteria 5100
180 Ga0373955_0091841 3300035172 Bacteria 1731
181 Ga0373935_0291811 3300035692 Bacteria 1151
182 Ga0373927_0022750 3300035695 Bacteria 4105
183 Ga0373947_0001154 3300035725 Bacteria 16203
184 Ga0373947_0039837 3300035725 Bacteria 2797
185 Ga0373937_0099388 3300036401 Bacteria 2699
186 Ga0373937_0263070 3300036401 Bacteria 1627
187 Ga0373925_0023855 3300037068 Bacteria 4462
188 Ga0373925_0484934 3300037068 Bacteria 1014
189 Ga0395900_0128716 3300037418 Bacteria 2595
190 Ga0395898_0174828 3300037466 Bacteria 2052
191 Ga0395898_0732005 3300037466 Bacteria 931
192 Ga0395905_0014233 3300037471 Bacteria 7600
193 Ga0395905_0126601 3300037471 Bacteria 2402
194 Ga0395905_0203534 3300037471 Bacteria 1855
195 Ga0395901_0033396 3300038443 Bacteria 5312
196 Ga0395901_0126760 3300038443 Bacteria 2682
197 Ga0439453_0007814 3300041408 Bacteria 1706
198 Ga0439451_002635 3300042009 Bacteria 3649
199 Ga0439434_0007230 3300042435 Bacteria 3254
200 Ga0451576_0267299 3300045051 Bacteria 1788
201 Ga0451576_1002526 3300045051 Bacteria 875
202 Ga0466967_0044962 3300045976 Bacteria 3835
203 Ga0466967_0332303 3300045976 Bacteria 1468
204 Ga0495603_0021704 3300046455 Bacteria 3889
205 Ga0495629_0087602 3300046459 Bacteria 2173
206 Ga0495651_0036949 3300046462 Bacteria 3803
207 Ga0495653_0008931 3300046463 Bacteria 8195
208 Ga0495639_0043268 3300046475 Unclassified 2034
209 Ga0495664_0006017 3300046477 Bacteria 6688
210 Ga0495618_0105308 3300046514 Bacteria 1806
211 Ga0495620_0041008 3300046515 Bacteria 2033
212 Ga0495644_0094070 3300046523 Bacteria 1132
213 Ga0495666_0128501 3300046526 Bacteria 1185
214 Ga0495652_0087068 3300046529 Bacteria 2563
215 Ga0495667_0121106 3300046559 Bacteria 1689
216 Ga0495667_0218581 3300046559 Bacteria 1216
217 Ga0495635_0119774 3300046663 Bacteria 1796
218 Ga0495657_0049366 3300046675 Bacteria 2835
219 Ga0495669_0159170 3300046684 Bacteria 1071
220 Ga0495624_0323639 3300046690 Bacteria 928
221 Ga0495670_0163255 3300046691 Unclassified 1171
222 Ga0495581_0066650 3300047315 Bacteria 2082
223 Ga0495604_0128751 3300047317 Bacteria 1822
224 Ga0495676_0220258 3300047321 Bacteria 1308
225 Ga0495680_0078715 3300047322 Bacteria 2494
226 Ga0495675_0093162 3300047444 Bacteria 1890
227 Ga0495675_0190362 3300047444 Bacteria 1253
228 Ga0495684_0044997 3300047471 Bacteria 3378
229 Ga0495602_0222961 3300048088 Bacteria 1422
230 Ga0496100_0005179 3300048903 Bacteria 6993
231 Ga0496101_0011711 3300048904 Bacteria 5829
232 Ga0496101_0083525 3300048904 Bacteria 2364
233 Ga0496102_0418665 3300048905 Bacteria 1258
234 Ga0496103_0049496 3300048906 Bacteria 2598
235 Ga0496103_0071307 3300048906 Bacteria 2174
236 Ga0496104_0101224 3300048907 Bacteria 2758
237 Ga0496104_0133110 3300048907 Bacteria 2388
238 Ga0496104_0177282 3300048907 Bacteria 2042
239 Ga0496105_0075010 3300048908 Bacteria 2794
240 Ga0496105_0139689 3300048908 Bacteria 1994
241 Ga0496105_0158368 3300048908 Unclassified 1859
242 Ga0496106_0084731 3300048909 Bacteria 2439
243 Ga0496106_0514741 3300048909 Bacteria 961
244 Ga0496107_0048128 3300048910 Bacteria 3071
245 Ga0496107_0122586 3300048910 Bacteria 1915
246 Ga0496107_0239834 3300048910 Bacteria 1349
247 Ga0496108_0006087 3300048911 Bacteria 9757
248 Ga0496108_0268633 3300048911 Bacteria 1484
249 Ga0496109_0006857 3300048912 Bacteria 9608
250 Ga0496109_0019877 3300048912 Bacteria 5928
251 Ga0496109_0196225 3300048912 Bacteria 1897
252 Ga0496109_0204438 3300048912 Bacteria 1857
253 Ga0496109_0562016 3300048912 Bacteria 1076
254 Ga0496110_0012474 3300048913 Bacteria 6989
255 Ga0496110_0194726 3300048913 Bacteria 1840
256 Ga0496111_0011155 3300048914 Bacteria 6049
257 Ga0496111_0215891 3300048914 Bacteria 1425
258 Ga0496111_0347479 3300048914 Bacteria 1098
259 Ga0496112_0013230 3300048915 Bacteria 7614
260 Ga0496112_0018477 3300048915 Bacteria 6565
261 Ga0496112_0038812 3300048915 Bacteria 4652
262 Ga0496112_0281036 3300048915 Bacteria 1612
263 Ga0496113_0025349 3300048916 Bacteria 4225
264 Ga0496114_0013411 3300048917 Bacteria 6571
265 Ga0496114_0031572 3300048917 Bacteria 4358
266 Ga0496114_0197996 3300048917 Bacteria 1759
267 Ga0496114_0342597 3300048917 Bacteria 1322
268 Ga0496115_0074008 3300048918 Bacteria 2765
269 Ga0496115_0190798 3300048918 Bacteria 1693
270 Ga0496116_0000165 3300048919 Bacteria 133688
271 Ga0496117_0005355 3300048920 Bacteria 13522
272 Ga0496118_0002347 3300048921 Bacteria 25661
273 Ga0496118_0006824 3300048921 Bacteria 12385
274 Ga0496119_0003213 3300048922 Bacteria 17095
275 Ga0496121_0025128 3300048924 Bacteria 5667
276 Ga0501031_0002949 3300049568 Bacteria 10889
277 Ga0501031_0006734 3300049568 Bacteria 7496
278 Ga0501031_0018541 3300049568 Unclassified 4530
279 Ga0501031_0021577 3300049568 Bacteria 4198
280 Ga0501031_0055051 3300049568 Bacteria 2592
281 Ga0501031_0150831 3300049568 Bacteria 1519
282 Ga0501032_0008451 3300049569 Bacteria 7504
283 Ga0501032_0011883 3300049569 Bacteria 6236
284 Ga0501033_0005974 3300049570 Bacteria 9556
285 Ga0501033_0025410 3300049570 Bacteria 4462
286 Ga0501033_0112770 3300049570 Bacteria 1978
287 Ga0501033_0165836 3300049570 Bacteria 1588
288 Ga0501036_0001000 3300049572 Bacteria 21363
289 Ga0501036_0054401 3300049572 Bacteria 3390
290 Ga0501036_0095593 3300049572 Bacteria 2512
291 Ga0501036_0139860 3300049572 Bacteria 2043
292 Ga0501036_0273625 3300049572 Bacteria 1413
293 Ga0501036_0288387 3300049572 Bacteria 1373
294 Ga0501036_0326279 3300049572 Bacteria 1282
295 Ga0501037_0004521 3300049573 Bacteria 10110
296 Ga0501037_0018277 3300049573 Bacteria 5166
297 Ga0501037_0116275 3300049573 Bacteria 1925
298 Ga0501037_0145470 3300049573 Bacteria 1695
299 Ga0501038_0002653 3300049574 Bacteria 16720
300 Ga0501038_0022962 3300049574 Bacteria 5584
301 Ga0501038_0023328 3300049574 Bacteria 5533
302 Ga0501038_0067216 3300049574 Bacteria 3050
303 Ga0501038_0119851 3300049574 Bacteria 2171
304 Ga0501039_0018009 3300049575 Bacteria 5418
305 Ga0501039_0023859 3300049575 Bacteria 4696
306 Ga0501039_0026609 3300049575 Bacteria 4445
307 Ga0501039_0031371 3300049575 Bacteria 4097
308 Ga0501039_0039057 3300049575 Bacteria 3666
309 Ga0501039_0060380 3300049575 Bacteria 2936
310 Ga0501039_0354330 3300049575 Bacteria 1153
311 Ga0501040_0001923 3300049576 Bacteria 13352
312 Ga0501040_0003668 3300049576 Bacteria 9943
313 Ga0501040_0017183 3300049576 Bacteria 4802
314 Ga0501040_0048679 3300049576 Bacteria 2896
315 Ga0501040_0330897 3300049576 Bacteria 1090
316 Ga0501040_0344852 3300049576 Bacteria 1066
317 Ga0501040_0368166 3300049576 Bacteria 1030
318 Ga0501041_0000234 3300049577 Bacteria 25828
319 Ga0501041_0006321 3300049577 Bacteria 6931
320 Ga0501041_0009853 3300049577 Bacteria 5626
321 Ga0501041_0229389 3300049577 Bacteria 1166
322 Ga0501042_0007585 3300049578 Bacteria 7118
323 Ga0501042_0028557 3300049578 Bacteria 3931
324 Ga0501042_0044299 3300049578 Bacteria 3169
325 Ga0501042_0063071 3300049578 Bacteria 2648
326 Ga0501042_0080205 3300049578 Bacteria 2338
327 Ga0501042_0109816 3300049578 Bacteria 1986
328 Ga0501042_0110404 3300049578 Bacteria 1980
329 Ga0501042_0233788 3300049578 Bacteria 1326
330 Ga0501042_0331207 3300049578 Bacteria 1100
331 Ga0501043_0005177 3300049579 Bacteria 10554
332 Ga0501043_0009045 3300049579 Bacteria 7837
333 Ga0501046_0007204 3300049580 Bacteria 9777
334 Ga0501046_0017581 3300049580 Bacteria 5963
335 Ga0501046_0023905 3300049580 Bacteria 5019
336 Ga0501046_0125098 3300049580 Bacteria 1954
337 Ga0501046_0148066 3300049580 Bacteria 1772
338 Ga0501048_0003913 3300049582 Bacteria 11315
339 Ga0501048_0020327 3300049582 Bacteria 4866
340 Ga0501048_0085502 3300049582 Bacteria 2224
341 Ga0501048_0096126 3300049582 Bacteria 2089
342 Ga0501048_0098164 3300049582 Bacteria 2066
343 Ga0501048_0113562 3300049582 Bacteria 1913
344 Ga0501067_0013315 3300049583 Bacteria 4555
345 Ga0501067_0194888 3300049583 Bacteria 1129
346 Ga0501068_0008625 3300049584 Bacteria 5680
347 Ga0501068_0013584 3300049584 Bacteria 4636
348 Ga0501068_0059077 3300049584 Bacteria 2328
349 Ga0501069_0011207 3300049585 Bacteria 4756
350 Ga0501070_0006486 3300049586 Bacteria 9959
351 Ga0501070_0015303 3300049586 Bacteria 6454
352 Ga0501071_0000453 3300049587 Bacteria 20652
353 Ga0501071_0003651 3300049587 Bacteria 9653
354 Ga0501071_0043464 3300049587 Bacteria 3221
355 Ga0501071_0069749 3300049587 Bacteria 2560
356 Ga0501071_0114433 3300049587 Bacteria 1995
357 Ga0501071_0287008 3300049587 Bacteria 1246
358 Ga0501071_0367647 3300049587 Bacteria 1096
359 Ga0501071_0376913 3300049587 Bacteria 1081
360 Ga0501072_0000398 3300049588 Bacteria 31066
361 Ga0501072_0006712 3300049588 Bacteria 8749
362 Ga0501072_0023633 3300049588 Bacteria 4774
363 Ga0501072_0130298 3300049588 Bacteria 2004
364 Ga0501072_0152621 3300049588 Bacteria 1841
365 Ga0501072_0218929 3300049588 Bacteria 1517
366 Ga0501072_0319079 3300049588 Bacteria 1235
367 Ga0501072_0355457 3300049588 Bacteria 1163
368 Ga0501072_0462480 3300049588 Bacteria 1004
369 Ga0501072_0479419 3300049588 Bacteria 984
370 Ga0501073_0009452 3300049589 Bacteria 7197
371 Ga0501073_0095169 3300049589 Bacteria 2069
372 Ga0501073_0171779 3300049589 Bacteria 1500
373 Ga0501073_0373270 3300049589 Bacteria 985
374 Ga0501074_0000617 3300049590 Bacteria 22153
375 Ga0501074_0006305 3300049590 Bacteria 8564
376 Ga0501074_0033878 3300049590 Bacteria 3703
377 Ga0501074_0123149 3300049590 Bacteria 1854
378 Ga0501075_0004804 3300049591 Bacteria 9191
379 Ga0501075_0057039 3300049591 Bacteria 2940
380 Ga0501075_0224285 3300049591 Bacteria 1433
381 Ga0501075_0224583 3300049591 Bacteria 1432
382 Ga0501075_0236199 3300049591 Unclassified 1394
383 Ga0501076_0001076 3300049592 Bacteria 17956
384 Ga0501076_0013251 3300049592 Bacteria 6182
385 Ga0501076_0023717 3300049592 Bacteria 4732
386 Ga0501076_0149052 3300049592 Bacteria 1902
387 Ga0501076_0198791 3300049592 Bacteria 1636
388 Ga0501076_0204896 3300049592 Bacteria 1611
389 Ga0501076_0234440 3300049592 Bacteria 1500
390 Ga0501077_0115870 3300049593 Bacteria 1698
391 Ga0501077_0159537 3300049593 Bacteria 1432
392 Ga0501077_0197891 3300049593 Bacteria 1276
393 Ga0501079_0000407 3300049741 Bacteria 27838
394 Ga0501079_0005931 3300049741 Bacteria 9153
395 Ga0501079_0016618 3300049741 Bacteria 5621
396 Ga0501079_0059541 3300049741 Bacteria 2945
397 Ga0501079_0061834 3300049741 Bacteria 2888
398 Ga0501079_0095951 3300049741 Bacteria 2298
399 Ga0501079_0217147 3300049741 Bacteria 1494
400 Ga0501079_0310621 3300049741 Bacteria 1234
401 Ga0501080_0022159 3300049742 Bacteria 5884
402 Ga0501080_0028295 3300049742 Bacteria 5213
403 Ga0501080_0158379 3300049742 Bacteria 2091
404 Ga0501080_0361378 3300049742 Bacteria 1310
405 Ga0501080_0503317 3300049742 Bacteria 1082
406 Ga0501081_0003224 3300049743 Bacteria 10371
407 Ga0501081_0084015 3300049743 Bacteria 2233
408 Ga0501081_0089505 3300049743 Bacteria 2163
409 Ga0501081_0270592 3300049743 Bacteria 1242
410 Ga0501081_0482876 3300049743 Bacteria 922
411 Ga0501083_0008216 3300049744 Bacteria 7379
412 Ga0501083_0062626 3300049744 Bacteria 2481
413 Ga0501035_0016236 3300049822 Bacteria 6871
414 Ga0501035_0028979 3300049822 Bacteria 5050
415 Ga0501035_0125301 3300049822 Bacteria 2243
416 Ga0501035_0331934 3300049822 Bacteria 1276
417 Ga0501044_0055999 3300049823 Bacteria 4048
418 Ga0501044_0119219 3300049823 Bacteria 2641
419 Ga0501044_0322177 3300049823 Bacteria 1470
420 Ga0501045_0005260 3300049824 Bacteria 8955
421 Ga0501045_0061795 3300049824 Bacteria 2748
422 Ga0501045_0122826 3300049824 Bacteria 1928
423 Ga0501045_0218729 3300049824 Bacteria 1418
424 Ga0501045_0238558 3300049824 Bacteria 1353
425 Ga0501045_0298976 3300049824 Bacteria 1198
426 nmdc:mga05p37_107800_c1 3300050507 Bacteria 3427
427 nmdc:mga05p37_126487_c1 3300050507 Bacteria 3139
428 nmdc:mga05p37_263658_c1 3300050507 Bacteria 2061
429 nmdc:mga09592_12562_c1 3300050508 Bacteria 6900
430 nmdc:mga09592_336885_c1 3300050508 Bacteria 1306
431 nmdc:mga09592_84797_c1 3300050508 Bacteria 2702
432 nmdc:mga0qj67_107716_c1 3300050509 Bacteria 2248
433 nmdc:mga0qj67_8890_c1 3300050509 Bacteria 7452
434 nmdc:mga06r32_17560_c1 3300050510 Bacteria 6533
435 nmdc:mga06r32_183738_c1 3300050510 Unclassified 2077
436 nmdc:mga08y16_506346_c1 3300050511 Bacteria 1226
437 nmdc:mga08y16_71787_c1 3300050511 Bacteria 3608
438 nmdc:mga0n895_123771_c1 3300050512 Bacteria 2608
439 nmdc:mga0a205_189673_c1 3300050515 Bacteria 1948
440 Ga0495595_0077430 3300053084 Bacteria 1580
441 Ga0495619_0020828 3300053085 Bacteria 4183
442 Ga0501084_0000526 3300054114 Bacteria 29269
443 Ga0501084_0007130 3300054114 Bacteria 9206
444 Ga0501084_0015078 3300054114 Bacteria 6409
445 Ga0501084_0018159 3300054114 Bacteria 5856
446 Ga0501084_0070005 3300054114 Bacteria 2937
447 Ga0501084_0179202 3300054114 Bacteria 1789
448 Ga0501084_0216756 3300054114 Bacteria 1615
449 Ga0501084_0326531 3300054114 Unclassified 1296
450 Ga0501084_0330003 3300054114 Bacteria 1288
451 Ga0590077_033737 3300059426 Bacteria 1124
452 Ga0501082_0001275 3300060353 Bacteria 22113
453 Ga0501082_0028770 3300060353 Bacteria 4786
454 Ga0501082_0056075 3300060353 Bacteria 3393
455 Ga0501082_0056966 3300060353 Bacteria 3367
456 Ga0501082_0216099 3300060353 Bacteria 1668
457 Ga0501082_0310878 3300060353 Bacteria 1372
458 Ga0501082_0418175 3300060353 Unclassified 1171
459 Ga0501082_0430360 3300060353 Bacteria 1152
460 Ga0530510_0000532 3300061734 Bacteria 24401
461 Ga0530510_0022684 3300061734 Bacteria 4472
462 Ga0530510_0056867 3300061734 Bacteria 2826
463 Ga0530510_0103003 3300061734 Bacteria 2087
464 Ga0530510_0132987 3300061734 Bacteria 1830
465 Ga0530510_0249767 3300061734 Bacteria 1322
466 2508671038 2508501039 Bacteria 9978592
467 2671836235 2671180195 Bacteria 9757215
468 2676203591 2675902999 Bacteria 9438463
469 2689963958 2687453737 Bacteria 11203906
470 2774848167 2773857921 Bacteria 9435764
471 2774854391 2773857922 Bacteria 9757215
472 8002788713 8002784119 Bacteria 9788632
473 8055161957 8055157932 Bacteria 6429399
474 Ga0501037_0204069
475 Ga0055536_1017389
476 Ga0055534_1002143
477 Ga0055540_1027428
478 Ga0070658_10007739
479 Ga0070658_10103399
480 Ga0070676_10025607
481 Ga0070676_10300635
482 Ga0070683_100019052
483 Ga0070670_100268226
484 Ga0070680_100048369
485 Ga0070660_100028720
486 Ga0070660_100084587
487 Ga0070668_100017698
488 Ga0070675_100036753
489 Ga0070675_100663111
490 Ga0070659_100019544
491 Ga0070667_100112988
492 Ga0070709_10052370
493 Ga0070714_100005584
494 Ga0070714_100140175
495 Ga0070714_100277117
496 Ga0070714_100460935
497 Ga0070713_100183394
498 Ga0070710_10194557
499 Ga0070710_10201751
500 Ga0070710_10225957
501 Ga0070711_100194249
502 Ga0070678_100207398
503 Ga0070678_100355307
504 Ga0070679_100019224
505 Ga0070684_100023760
506 Ga0070684_100088337
507 Ga0070684_100141436
508 Ga0070684_100444512
509 Ga0070672_100166428
510 Ga0070696_100628165
511 Ga0070665_100131689
512 Ga0068855_100225729
513 Ga0068855_100315860
514 Ga0070664_100020591
515 Ga0068856_100367971
516 Ga0068852_100556578
517 Ga0068852_100570117
518 Ga0068864_100052590
519 Ga0068861_100180191
520 Ga0068851_10082288
521 Ga0068858_100000001
522 Ga0068862_100501711
523 Ga0068862_100545824
524 Ga0081455_10270795
525 Ga0081538_10010817
526 Ga0081539_10002480
527 Ga0070717_10250822
528 Ga0075365_10259686
529 Ga0070715_10102908
530 Ga0070712_100048882
531 Ga0070712_100067469
532 Ga0075428_100016981
533 Ga0075428_100018653
534 Ga0075430_100013658
535 Ga0075430_100148637
536 Ga0075431_100001828
537 Ga0075429_100016078
538 Ga0075429_100233528
539 Ga0068865_100029999
540 Ga0075435_100238303
541 Ga0111539_10227978
542 Ga0111539_10321476
543 Ga0111539_10372126
544 Ga0105245_10011720
545 Ga0105245_10047814
546 Ga0105245_10097241
547 Ga0105245_10189206
548 Ga0105245_10517627
549 Ga0114129_10176783
550 Ga0114129_10180259
551 Ga0114129_10193391
552 Ga0114129_10283119
553 Ga0105243_10106604
554 Ga0105243_10173553
555 Ga0105242_10031121
556 Ga0105242_10068674
557 Ga0105242_10248900
558 Ga0105248_10000529
559 Ga0105248_10001531
560 Ga0105237_10087035
561 Ga0105249_10424999
562 Ga0105249_10669724
563 Ga0105239_10080403
564 Ga0105239_10107750
565 Ga0105239_10131824
566 Ga0105239_10566966
567 Ga0157370_10071626
568 Ga0157369_10024480
569 Ga0157369_10163761
570 Ga0157374_10054733
571 Ga0163162_10577078
572 Ga0157372_10024511
573 Ga0157372_10271515
574 Ga0157375_10388911
575 Ga0157375_10718271
576 Ga0157380_10196909
577 Ga0182008_10094900
578 Ga0157379_10000059
579 Ga0209673_1017724
580 Ga0209675_1006151
581 Ga0209676_1008066
582 Ga0209025_1020381
583 Ga0209050_1022453
584 Ga0207692_10142952
585 Ga0207692_10162580
586 Ga0207685_10004092
587 Ga0207699_10066483
588 Ga0207645_10099918
589 Ga0207705_10028486
590 Ga0207705_10203715
591 Ga0207671_10322629
592 Ga0207693_10005748
593 Ga0207693_10076504
594 Ga0207663_10146640
595 Ga0207660_10036020
596 Ga0207657_10046994
597 Ga0207657_10051734
598 Ga0207649_10152295
599 Ga0207652_10022796
600 Ga0207659_10019285
601 Ga0207659_10557285
602 Ga0207687_10055359
603 Ga0207687_10169536
604 Ga0207700_10136803
605 Ga0207690_10066206
606 Ga0207706_10110298
607 Ga0207709_10219655
608 Ga0207709_10240345
609 Ga0207669_10154991
610 Ga0207704_10041854
611 Ga0207704_10113694
612 Ga0207665_10262427
613 Ga0207691_10062990
614 Ga0207711_10000324
615 Ga0207711_10000537
616 Ga0207661_10054035
617 Ga0207661_10123907
618 Ga0207679_10156199
619 Ga0207667_10242877
620 Ga0207668_10120055
621 Ga0207677_10124727
622 Ga0207703_10000007
623 Ga0207708_10096837
624 Ga0207708_10130691
625 Ga0207702_10138028
626 Ga0207676_10068975
627 Ga0207675_100056307
628 Ga0207675_100145732
629 Ga0207675_100652311
630 Ga0207683_10190236
631 Ga0207428_10003848
632 Ga0268266_10286439
633 Ga0268265_10519231
634 Ga0268265_10520744
635 Ga0307408_100721530
636 Ga0307405_10020003
637 Ga0307405_10370387
638 Ga0307413_10005472
639 Ga0307410_10475221
640 Ga0307407_10006600
641 Ga0307407_10052891
642 Ga0307412_10089472
643 Ga0307412_10092363
644 Ga0307412_10176851
645 Ga0307409_100443663
646 Ga0307416_100065691
647 Ga0307416_100113261
648 Ga0307416_100527272
649 Ga0307414_10063355
650 Ga0307411_10066592
651 Ga0307415_100318902
652 Ga0373943_0006879
653 Ga0373955_0091841
654 Ga0373935_0291811
655 Ga0373927_0022750
656 Ga0373947_0001154
657 Ga0373947_0039837
658 Ga0373937_0099388
659 Ga0373937_0263070
660 Ga0373925_0023855
661 Ga0373925_0484934
662 Ga0395900_0128716
663 Ga0395898_0174828
664 Ga0395898_0732005
665 Ga0395905_0014233
666 Ga0395905_0126601
667 Ga0395905_0203534
668 Ga0395901_0033396
669 Ga0395901_0126760
670 Ga0439453_0007814
671 Ga0439451_002635
672 Ga0439434_0007230
673 Ga0451576_0267299
674 Ga0451576_1002526
675 Ga0466967_0044962
676 Ga0466967_0332303
677 Ga0495603_0021704
678 Ga0495629_0087602
679 Ga0495651_0036949
680 Ga0495653_0008931
681 Ga0495639_0043268
682 Ga0495664_0006017
683 Ga0495618_0105308
684 Ga0495620_0041008
685 Ga0495644_0094070
686 Ga0495666_0128501
687 Ga0495652_0087068
688 Ga0495667_0121106
689 Ga0495667_0218581
690 Ga0495635_0119774
691 Ga0495657_0049366
692 Ga0495669_0159170
693 Ga0495624_0323639
694 Ga0495670_0163255
695 Ga0495581_0066650
696 Ga0495604_0128751
697 Ga0495676_0220258
698 Ga0495680_0078715
699 Ga0495675_0093162
700 Ga0495675_0190362
701 Ga0495684_0044997
702 Ga0495602_0222961
703 Ga0496100_0005179
704 Ga0496101_0011711
705 Ga0496101_0083525
706 Ga0496102_0418665
707 Ga0496103_0049496
708 Ga0496103_0071307
709 Ga0496104_0101224
710 Ga0496104_0133110
711 Ga0496104_0177282
712 Ga0496105_0075010
713 Ga0496105_0139689
714 Ga0496105_0158368
715 Ga0496106_0084731
716 Ga0496106_0514741
717 Ga0496107_0048128
718 Ga0496107_0122586
719 Ga0496107_0239834
720 Ga0496108_0006087
721 Ga0496108_0268633
722 Ga0496109_0006857
723 Ga0496109_0019877
724 Ga0496109_0196225
725 Ga0496109_0204438
726 Ga0496109_0562016
727 Ga0496110_0012474
728 Ga0496110_0194726
729 Ga0496111_0011155
730 Ga0496111_0215891
731 Ga0496111_0347479
732 Ga0496112_0013230
733 Ga0496112_0018477
734 Ga0496112_0038812
735 Ga0496112_0281036
736 Ga0496113_0025349
737 Ga0496114_0013411
738 Ga0496114_0031572
739 Ga0496114_0197996
740 Ga0496114_0342597
741 Ga0496115_0074008
742 Ga0496115_0190798
743 Ga0496116_0000165
744 Ga0496117_0005355
745 Ga0496118_0002347
746 Ga0496118_0006824
747 Ga0496119_0003213
748 Ga0496121_0025128
749 Ga0501031_0002949
750 Ga0501031_0006734
751 Ga0501031_0018541
752 Ga0501031_0021577
753 Ga0501031_0055051
754 Ga0501031_0150831
755 Ga0501032_0008451
756 Ga0501032_0011883
757 Ga0501033_0005974
758 Ga0501033_0025410
759 Ga0501033_0112770
760 Ga0501033_0165836
761 Ga0501036_0001000
762 Ga0501036_0054401
763 Ga0501036_0095593
764 Ga0501036_0139860
765 Ga0501036_0273625
766 Ga0501036_0288387
767 Ga0501036_0326279
768 Ga0501037_0004521
769 Ga0501037_0018277
770 Ga0501037_0116275
771 Ga0501037_0145470
772 Ga0501038_0002653
773 Ga0501038_0022962
774 Ga0501038_0023328
775 Ga0501038_0067216
776 Ga0501038_0119851
777 Ga0501039_0018009
778 Ga0501039_0023859
779 Ga0501039_0026609
780 Ga0501039_0031371
781 Ga0501039_0039057
782 Ga0501039_0060380
783 Ga0501039_0354330
784 Ga0501040_0001923
785 Ga0501040_0003668
786 Ga0501040_0017183
787 Ga0501040_0048679
788 Ga0501040_0330897
789 Ga0501040_0344852
790 Ga0501040_0368166
791 Ga0501041_0000234
792 Ga0501041_0006321
793 Ga0501041_0009853
794 Ga0501041_0229389
795 Ga0501042_0007585
796 Ga0501042_0028557
797 Ga0501042_0044299
798 Ga0501042_0063071
799 Ga0501042_0080205
800 Ga0501042_0109816
801 Ga0501042_0110404
802 Ga0501042_0233788
803 Ga0501042_0331207
804 Ga0501043_0005177
805 Ga0501043_0009045
806 Ga0501046_0007204
807 Ga0501046_0017581
808 Ga0501046_0023905
809 Ga0501046_0125098
810 Ga0501046_0148066
811 Ga0501048_0003913
812 Ga0501048_0020327
813 Ga0501048_0085502
814 Ga0501048_0096126
815 Ga0501048_0098164
816 Ga0501048_0113562
817 Ga0501067_0013315
818 Ga0501067_0194888
819 Ga0501068_0008625
820 Ga0501068_0013584
821 Ga0501068_0059077
822 Ga0501069_0011207
823 Ga0501070_0006486
824 Ga0501070_0015303
825 Ga0501071_0000453
826 Ga0501071_0003651
827 Ga0501071_0043464
828 Ga0501071_0069749
829 Ga0501071_0114433
830 Ga0501071_0287008
831 Ga0501071_0367647
832 Ga0501071_0376913
833 Ga0501072_0000398
834 Ga0501072_0006712
835 Ga0501072_0023633
836 Ga0501072_0130298
837 Ga0501072_0152621
838 Ga0501072_0218929
839 Ga0501072_0319079
840 Ga0501072_0355457
841 Ga0501072_0462480
842 Ga0501072_0479419
843 Ga0501073_0009452
844 Ga0501073_0095169
845 Ga0501073_0171779
846 Ga0501073_0373270
847 Ga0501074_0000617
848 Ga0501074_0006305
849 Ga0501074_0033878
850 Ga0501074_0123149
851 Ga0501075_0004804
852 Ga0501075_0057039
853 Ga0501075_0224285
854 Ga0501075_0224583
855 Ga0501075_0236199
856 Ga0501076_0001076
857 Ga0501076_0013251
858 Ga0501076_0023717
859 Ga0501076_0149052
860 Ga0501076_0198791
861 Ga0501076_0204896
862 Ga0501076_0234440
863 Ga0501077_0115870
864 Ga0501077_0159537
865 Ga0501077_0197891
866 Ga0501079_0000407
867 Ga0501079_0005931
868 Ga0501079_0016618
869 Ga0501079_0059541
870 Ga0501079_0061834
871 Ga0501079_0095951
872 Ga0501079_0217147
873 Ga0501079_0310621
874 Ga0501080_0022159
875 Ga0501080_0028295
876 Ga0501080_0158379
877 Ga0501080_0361378
878 Ga0501080_0503317
879 Ga0501081_0003224
880 Ga0501081_0084015
881 Ga0501081_0089505
882 Ga0501081_0270592
883 Ga0501081_0482876
884 Ga0501083_0008216
885 Ga0501083_0062626
886 Ga0501035_0016236
887 Ga0501035_0028979
888 Ga0501035_0125301
889 Ga0501035_0331934
890 Ga0501044_0055999
891 Ga0501044_0119219
892 Ga0501044_0322177
893 Ga0501045_0005260
894 Ga0501045_0061795
895 Ga0501045_0122826
896 Ga0501045_0218729
897 Ga0501045_0238558
898 Ga0501045_0298976
899 nmdc:mga05p37_107800_c1
900 nmdc:mga05p37_126487_c1
901 nmdc:mga05p37_263658_c1
902 nmdc:mga09592_12562_c1
903 nmdc:mga09592_336885_c1
904 nmdc:mga09592_84797_c1
905 nmdc:mga0qj67_107716_c1
906 nmdc:mga0qj67_8890_c1
907 nmdc:mga06r32_17560_c1
908 nmdc:mga06r32_183738_c1
909 nmdc:mga08y16_506346_c1
910 nmdc:mga08y16_71787_c1
911 nmdc:mga0n895_123771_c1
912 nmdc:mga0a205_189673_c1
913 Ga0495595_0077430
914 Ga0495619_0020828
915 Ga0501084_0000526
916 Ga0501084_0007130
917 Ga0501084_0015078
918 Ga0501084_0018159
919 Ga0501084_0070005
920 Ga0501084_0179202
921 Ga0501084_0216756
922 Ga0501084_0326531
923 Ga0501084_0330003
924 Ga0590077_033737
925 Ga0501082_0001275
926 Ga0501082_0028770
927 Ga0501082_0056075
928 Ga0501082_0056966
929 Ga0501082_0216099
930 Ga0501082_0310878
931 Ga0501082_0418175
932 Ga0501082_0430360
933 Ga0530510_0000532
934 Ga0530510_0022684
935 Ga0530510_0056867
936 Ga0530510_0103003
937 Ga0530510_0132987
938 Ga0530510_0249767
939 2508671038
940 2671836235
941 2676203591
942 2689963958
943 2774848167
944 2774854391
945 8002788713
946 8055161957

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

84

179

0.98

PF13649

Methyltransf_25

Methyltransferase domain

83

175

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

32

183

0.92

PF13847

Methyltransf_31

Methyltransferase domain

77

199

0.92

PF08242

Methyltransf_12

Methyltransferase domain

84

177

0.9

PF13489

Methyltransf_23

Methyltransferase domain

57

223

0.83

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

39

158

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ff9-assembly1.cif.gz_B noroxomaritidine/norcraugsodine reductase in complex with nadp+ and tyramine 0.9259 55 91
2ae1-assembly1.cif.gz_A tropinone reductase-ii 0.9085 55 91
3o03-assembly1.cif.gz_A quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 0.8918 55 91
3cxr-assembly1.cif.gz_A crystal structure of gluconate 5-dehydrogase from streptococcus suis type 2 0.8897 55 91
7cpx-assembly1.cif.gz_A lovastatin nonaketide synthase 0.8703 57 137
ID Description Score Start End Superfamily
af_Q4CM63_15_263_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9457 55 137 3.40.50.150
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.93 55 87 3.40.50.720
af_P9WLY7_8_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9256 8 258 3.40.50.150
3mggA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9105 56 133 3.40.50.150
af_O74198_45_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9094 38 137 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W0GKN9-F1-model_v4 Methyltransferase domain-containing protein 0.9896 70 256 GO:0008757
GO:0032259
AF-A0A7W0GKN9-F1-model_v4 Methyltransferase domain-containing protein 0.9741 70 256 GO:0008757
GO:0032259
AF-A0A4R2CR44-F1-model_v4 Methyltransferase family protein 0.9727 4 258 GO:0008757
GO:0032259
AF-A0A401ZLI0-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9709 1 258 GO:0008757
AF-A0A2D6G6L0-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9687 56 139 GO:0008757

Map