F451096

General Info

Members Datasets Scaffolds Average Seq Length
473 270 375 248

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0004107|Ga0496122_0004107_238_1122
Length 294
Sequence MITEGKRIKVPSFHTFAKIGIFVWIGVIFSKTFQQIFHEIKVFLLSYYTTLRYFIEFSYNGKNYFGYQIQPDAISVQEELEKALSTILREEIKTTGAGRTDTGVHAKKIFAHFDTEQAVDKMNLPYKLNSFLPPDIAVKRVFQVKDDFHARFDATYRTYEYYISLAKNPFTQESAWQHWKRPLDIHRMNEACKILFEYEDFTSFAKLKTDNKTNICKIYKAEWEQEGTELKFTVSANRFLRNMVRAIVGTMVEIGSGKIKPEDLRKIIEDKNRNAAGTSAPGHGLFLVDVGYEF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
6 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
7 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
8 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
9 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
10 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
11 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
12 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
13 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
14 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
15 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
16 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
17 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
18 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
19 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
20 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
21 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
22 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
23 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
24 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
25 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
26 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
27 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
28 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
29 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
30 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
31 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
32 2738541283 Pedobacter sp. OK701 Isolate Unclassified
33 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
34 2738541302 Pedobacter sp. CF074 Isolate Unclassified
35 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
36 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
37 2739367651 Pedobacter sp. OK291 Isolate Unclassified
38 2739367663 Pedobacter sp. YR510 Isolate Unclassified
39 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
40 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
41 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
42 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
43 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
44 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
45 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
46 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
47 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
48 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
49 2818991437 Pedobacter terrae 518 Isolate Unclassified
50 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
51 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
52 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
53 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
54 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
55 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
56 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
57 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
58 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
59 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
60 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
61 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
62 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
63 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
64 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
65 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
66 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
67 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
68 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
69 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
70 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
71 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
72 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
73 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
74 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
75 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
76 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
77 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
78 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
79 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
80 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
81 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
82 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
83 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
84 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
85 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
86 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
87 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
88 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
89 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
90 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
91 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
92 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
93 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
94 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
95 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
96 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
97 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
98 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
99 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
100 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
101 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
102 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
103 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
104 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
105 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
106 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
107 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
108 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
109 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
110 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
111 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
112 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
113 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
114 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
115 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
116 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
142 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
143 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
150 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
170 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
171 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
181 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
198 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
199 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
200 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
206 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
213 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
246 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
247 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
250 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
251 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
252 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
264 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
265 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
266 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
267 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
268 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
269 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
270 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.07
Metatranscriptomes 0.21
Isolates 20.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.42
Bulb 0
Endosphere 8.03
Nodule 1.48
Rhizoplane 1.69
Rhizosphere 69.77
Stem 0
Stem Tuber 0
Unclassified 18.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1813815 2162886007 Bacteria 1459
2 JGI24741J21665_1007052 3300001915 Bacteria 2206
3 JGI25162J39368_1001096 3300002737 Bacteria 16465
4 JGI25164J39214_1002462 3300002772 Bacteria 2823
5 JGI25152J39213_1000469 3300002773 Bacteria 23547
6 JGI25150J39212_1000001 3300002774 Bacteria 1318726
7 JGI25151J46595_10000001 3300003187 Bacteria 887211
8 JGI25165J46597_1000621 3300003214 Bacteria 29774
9 JGI25153J46596_10000001 3300003215 Bacteria 748985
10 rootH1_10195063 3300003316 Bacteria 1257
11 rootH2_10047243 3300003320 Bacteria 9430
12 rootH2_10143116 3300003320 Bacteria 2651
13 rootH2_10167632 3300003320 Bacteria 4732
14 rootL2_10098176 3300003322 Bacteria 3301
15 rootL2_10381536 3300003322 Unclassified 1157
16 rootH1_10338304 3300003323 Bacteria 1209
17 Ga0065714_10002216 3300005288 Bacteria 50392
18 Ga0065714_10002520 3300005288 Bacteria 15221
19 Ga0065714_10003551 3300005288 Bacteria 6917
20 Ga0065714_10011678 3300005288 Bacteria 1913
21 Ga0065714_10148095 3300005288 Bacteria 1124
22 Ga0065704_10070975 3300005289 Bacteria 14132
23 Ga0065704_10074225 3300005289 Bacteria 6442
24 Ga0065704_10078830 3300005289 Bacteria 4323
25 Ga0070658_10352306 3300005327 Bacteria 1260
26 Ga0070658_10409439 3300005327 Bacteria 1165
27 Ga0070682_100000087 3300005337 Bacteria 83686
28 Ga0070668_100009837 3300005347 Bacteria 7085
29 Ga0070685_10053821 3300005466 Bacteria 2333
30 Ga0070684_100004059 3300005535 Bacteria 11084
31 Ga0070686_100202934 3300005544 Bacteria 1422
32 Ga0068855_100150880 3300005563 Unclassified 2643
33 Ga0068855_100157676 3300005563 Bacteria 2578
34 Ga0068857_100195955 3300005577 Unclassified 1841
35 Ga0068856_100016605 3300005614 Bacteria 7127
36 Ga0068856_100036133 3300005614 Bacteria 4844
37 Ga0068852_100230213 3300005616 Bacteria 1766
38 Ga0075363_100124956 3300006048 Bacteria 1439
39 Ga0070712_100190892 3300006175 Bacteria 1603
40 Ga0075362_10005379 3300006177 Bacteria 4680
41 Ga0075362_10144062 3300006177 Bacteria 1140
42 Ga0075366_10053415 3300006195 Bacteria 2400
43 Ga0075366_10113427 3300006195 Bacteria 1632
44 Ga0099824_1000985 3300006942 Bacteria 38209
45 Ga0079104_1000057 3300006946 Bacteria 165780
46 Ga0099826_10001279 3300006948 Bacteria 14796
47 Ga0105251_10029901 3300009011 Bacteria 2740
48 Ga0105244_10000001 3300009036 Bacteria 1034899
49 Ga0105244_10000002 3300009036 Bacteria 495554
50 Ga0105244_10119333 3300009036 Bacteria 1278
51 Ga0105240_10001259 3300009093 Bacteria 43960
52 Ga0105240_10028304 3300009093 Bacteria 7321
53 Ga0105243_10000003 3300009148 Bacteria 712931
54 Ga0105243_10000234 3300009148 Bacteria 63417
55 Ga0105241_10004818 3300009174 Bacteria 9942
56 Ga0105237_10001903 3300009545 Bacteria 26623
57 Ga0105237_10020618 3300009545 Bacteria 6791
58 Ga0105237_10044571 3300009545 Bacteria 4467
59 Ga0105249_10027265 3300009553 Bacteria 5154
60 Ga0105239_10000955 3300010375 Bacteria 40720
61 Ga0105239_10032897 3300010375 Bacteria 5697
62 Ga0157373_10000001 3300013100 Bacteria 864756
63 Ga0157373_10000080 3300013100 Bacteria 82365
64 Ga0157373_10012947 3300013100 Bacteria 6125
65 Ga0157373_10206693 3300013100 Bacteria 1384
66 Ga0157371_10000036 3300013102 Bacteria 215191
67 Ga0157371_10000074 3300013102 Bacteria 162988
68 Ga0157371_10021922 3300013102 Bacteria 4689
69 Ga0157371_10043596 3300013102 Bacteria 3195
70 Ga0157371_10047689 3300013102 Bacteria 3046
71 Ga0157371_10056159 3300013102 Bacteria 2793
72 Ga0157370_10000186 3300013104 Bacteria 78124
73 Ga0157370_10000529 3300013104 Bacteria 47798
74 Ga0157370_10002014 3300013104 Bacteria 24962
75 Ga0157370_10003405 3300013104 Bacteria 18686
76 Ga0157370_10003715 3300013104 Bacteria 17832
77 Ga0157370_10006700 3300013104 Bacteria 12642
78 Ga0157370_10032744 3300013104 Bacteria 5074
79 Ga0157370_10190103 3300013104 Bacteria 1906
80 Ga0157370_10257385 3300013104 Bacteria 1613
81 Ga0157369_10000031 3300013105 Bacteria 203214
82 Ga0157369_10001311 3300013105 Bacteria 30914
83 Ga0157378_10385573 3300013297 Bacteria 1377
84 Ga0163162_10001114 3300013306 Bacteria 24954
85 Ga0163162_10263258 3300013306 Bacteria 1856
86 Ga0163162_11255911 3300013306 Bacteria 841
87 Ga0157375_10014658 3300013308 Bacteria 7002
88 Ga0157375_10032435 3300013308 Bacteria 4954
89 Ga0157375_10061516 3300013308 Bacteria 3728
90 Ga0157375_10264787 3300013308 Bacteria 1880
91 Ga0157375_11025598 3300013308 Bacteria 964
92 Ga0182008_10000048 3300014497 Bacteria 105176
93 Ga0182008_10000232 3300014497 Bacteria 43445
94 Ga0182008_10000491 3300014497 Bacteria 29764
95 Ga0182008_10027508 3300014497 Bacteria 2880
96 Ga0182006_1000003 3300015261 Bacteria 826681
97 Ga0182006_1000103 3300015261 Bacteria 93638
98 Ga0182006_1000159 3300015261 Bacteria 72265
99 Ga0182006_1006914 3300015261 Bacteria 5227
100 Ga0182007_10000002 3300015262 Bacteria 564661
101 Ga0182007_10012183 3300015262 Bacteria 3319
102 Ga0182007_10013798 3300015262 Bacteria 3069
103 Ga0183373_1004 3300015682 Bacteria 537398
104 Ga0163161_10000043 3300017792 Bacteria 135014
105 Ga0163161_10000207 3300017792 Bacteria 53913
106 Ga0163161_10002199 3300017792 Bacteria 14070
107 Ga0163161_10003343 3300017792 Bacteria 11247
108 Ga0163161_10010683 3300017792 Bacteria 6357
109 Ga0163161_10038302 3300017792 Bacteria 3439
110 Ga0163161_10075641 3300017792 Bacteria 2471
111 Ga0163161_10078807 3300017792 Bacteria 2422
112 Ga0163161_10308434 3300017792 Bacteria 1248
113 Ga0163161_10449719 3300017792 Bacteria 1041
114 Ga0207427_100652 3300025231 Bacteria 16828
115 Ga0209437_100048 3300025233 Bacteria 405107
116 Ga0207425_1000002 3300025245 Bacteria 1362590
117 Ga0209129_1000002 3300025258 Bacteria 1359086
118 Ga0209233_1000029 3300025261 Bacteria 641642
119 Ga0209455_1001061 3300025272 Bacteria 13611
120 Ga0209675_1000059 3300025291 Bacteria 184781
121 Ga0209676_1000009 3300025292 Bacteria 981719
122 Ga0209025_1000004 3300025294 Bacteria 1361782
123 Ga0209758_1000006 3300025297 Bacteria 1359562
124 Ga0209050_1000094 3300025298 Bacteria 242893
125 Ga0207655_1000012 3300025728 Bacteria 640488
126 Ga0207655_1000018 3300025728 Bacteria 537129
127 Ga0207705_10317609 3300025909 Bacteria 1197
128 Ga0207654_10033881 3300025911 Bacteria 2834
129 Ga0207695_10000183 3300025913 Bacteria 181350
130 Ga0207695_10002903 3300025913 Bacteria 24802
131 Ga0207671_10010150 3300025914 Bacteria 7802
132 Ga0207671_10032517 3300025914 Bacteria 3883
133 Ga0207709_10000008 3300025935 Bacteria 713099
134 Ga0207709_10001052 3300025935 Bacteria 20376
135 Ga0207661_10003784 3300025944 Bacteria 10551
136 Ga0207667_10117514 3300025949 Bacteria 2740
137 Ga0207667_10297626 3300025949 Bacteria 1648
138 Ga0207668_10062783 3300025972 Bacteria 2617
139 Ga0207677_10409640 3300026023 Bacteria 1152
140 Ga0207702_10032709 3300026078 Bacteria 4339
141 Ga0207702_10099811 3300026078 Unclassified 2560
142 Ga0207702_10177269 3300026078 Bacteria 1959
143 Ga0207674_10122802 3300026116 Unclassified 2563
144 Ga0207698_10196418 3300026142 Bacteria 1803
145 Ga0209281_1000372 3300027111 Bacteria 72453
146 Ga0209489_117543 3300027361 Bacteria 3208
147 Ga0210002_1006483 3300027617 Bacteria 1767
148 Ga0209282_1028647 3300027666 Bacteria 3448
149 Ga0307515_10021616 3300028794 Bacteria 11394
150 Ga0265338_10001687 3300028800 Bacteria 35089
151 Ga0265338_10003394 3300028800 Bacteria 22479
152 Ga0265338_10118654 3300028800 Bacteria 2114
153 Ga0316179_1030548 3300030734 Bacteria 3041
154 Ga0265330_10090376 3300031235 Bacteria 1315
155 Ga0265327_10001564 3300031251 Bacteria 28086
156 Ga0265327_10016068 3300031251 Bacteria 4782
157 Ga0265327_10082193 3300031251 Bacteria 1588
158 Ga0265316_10000850 3300031344 Bacteria 33664
159 Ga0307408_100000988 3300031548 Bacteria 21944
160 Ga0307408_100005259 3300031548 Bacteria 8673
161 Ga0316576_10008324 3300031727 Bacteria 6606
162 Ga0316576_10012283 3300031727 Archaea 5652
163 Ga0316576_10103257 3300031727 Bacteria 2133
164 Ga0316576_10137063 3300031727 Bacteria 1842
165 Ga0316578_10002532 3300031728 Bacteria 8066
166 Ga0316578_10025760 3300031728 Unclassified 3310
167 Ga0307405_10000015 3300031731 Bacteria 206299
168 Ga0307413_10017337 3300031824 Bacteria 3748
169 Ga0307413_10170691 3300031824 Bacteria 1539
170 Ga0307410_10000018 3300031852 Bacteria 69156
171 Ga0307406_10000408 3300031901 Bacteria 24927
172 Ga0307407_10000031 3300031903 Bacteria 87995
173 Ga0307407_10235703 3300031903 Bacteria 1245
174 Ga0307412_10000072 3300031911 Bacteria 105576
175 Ga0307412_10003796 3300031911 Bacteria 8399
176 Ga0307412_10008688 3300031911 Bacteria 5809
177 Ga0307416_100000002 3300032002 Bacteria 509907
178 Ga0307416_100000013 3300032002 Bacteria 283585
179 Ga0307416_100037161 3300032002 Bacteria 3744
180 Ga0307414_10000008 3300032004 Bacteria 375832
181 Ga0307414_10000049 3300032004 Bacteria 130090
182 Ga0307414_10001903 3300032004 Bacteria 10798
183 Ga0307414_10002926 3300032004 Bacteria 9031
184 Ga0307414_10005840 3300032004 Bacteria 6805
185 Ga0307414_10021942 3300032004 Bacteria 4019
186 Ga0307414_10033168 3300032004 Bacteria 3410
187 Ga0307414_10033994 3300032004 Bacteria 3375
188 Ga0307414_10111503 3300032004 Bacteria 2083
189 Ga0307414_10241137 3300032004 Bacteria 1496
190 Ga0307414_10277790 3300032004 Bacteria 1406
191 Ga0307414_10483969 3300032004 Bacteria 1092
192 Ga0307411_10000008 3300032005 Bacteria 321575
193 Ga0307411_10097085 3300032005 Bacteria 2073
194 Ga0307510_10020709 3300033180 Bacteria 7680
195 Ga0316574_0089142 3300035398 Bacteria 1965
196 Ga0316574_0167850 3300035398 Bacteria 1413
197 Ga0316574_0349964 3300035398 Bacteria 935
198 Ga0316582_0005600 3300036647 Bacteria 6493
199 Ga0316582_0013780 3300036647 Bacteria 4563
200 Ga0316584_0009693 3300036712 Bacteria 6697
201 Ga0316584_0096107 3300036712 Unclassified 2218
202 Ga0395900_0000139 3300037418 Bacteria 122708
203 Ga0395900_0072385 3300037418 Bacteria 3544
204 Ga0395905_0000340 3300037471 Bacteria 66412
205 Ga0400488_41148 3300038741 Unclassified 1493
206 Ga0400483_228548 3300039062 Bacteria 24426
207 Ga0400489_63785 3300039093 Unclassified 2245
208 Ga0439447_008176 3300041407 Bacteria 3259
209 Ga0439466_0003262 3300041411 Bacteria 6318
210 Ga0439465_0004522 3300041413 Bacteria 4496
211 Ga0451795_0156879 3300041456 Bacteria 1050
212 Ga0451795_1058609 3300041456 Bacteria 1310
213 Ga0451795_1614751 3300041456 Unclassified 2909
214 Ga0451807_1657289 3300041486 Bacteria 843
215 Ga0451807_1730649 3300041486 Bacteria 1500
216 Ga0451807_2511280 3300041486 Bacteria 1239
217 Ga0451855_0189049 3300041511 Bacteria 1117
218 Ga0451855_0532222 3300041511 Bacteria 1242
219 Ga0451855_1244572 3300041511 Bacteria 5176
220 Ga0451855_1579243 3300041511 Bacteria 1346
221 Ga0451855_1695269 3300041511 Bacteria 1272
222 Ga0439445_0008503 3300042004 Bacteria 2402
223 Ga0439435_0107147 3300042436 Bacteria 864
224 Ga0451577_0000097 3300042876 Bacteria 193351
225 Ga0451577_0000140 3300042876 Bacteria 161646
226 Ga0451577_0032927 3300042876 Bacteria 4672
227 Ga0451577_0104915 3300042876 Unclassified 2526
228 Ga0451577_0133524 3300042876 Bacteria 2228
229 Ga0451577_0157952 3300042876 Bacteria 2041
230 Ga0451577_0288452 3300042876 Bacteria 1487
231 Ga0451577_0290909 3300042876 Bacteria 1480
232 Ga0453683_0000463 3300044673 Bacteria 46589
233 Ga0453683_0005411 3300044673 Bacteria 8909
234 Ga0453683_0021937 3300044673 Bacteria 4074
235 Ga0453683_0023941 3300044673 Bacteria 3889
236 Ga0453683_0048550 3300044673 Unclassified 2662
237 Ga0453683_0090277 3300044673 Unclassified 1920
238 Ga0453683_0150322 3300044673 Unclassified 1471
239 Ga0453683_0431788 3300044673 Bacteria 851
240 Ga0453684_0000084 3300044712 Bacteria 398306
241 Ga0453684_0000091 3300044712 Bacteria 387720
242 Ga0453684_0001860 3300044712 Bacteria 55060
243 Ga0453684_0005040 3300044712 Bacteria 26781
244 Ga0453684_0015588 3300044712 Bacteria 11996
245 Ga0453684_0015694 3300044712 Bacteria 11937
246 Ga0453684_0016857 3300044712 Bacteria 11373
247 Ga0453684_0022085 3300044712 Bacteria 9465
248 Ga0453684_0025595 3300044712 Bacteria 8562
249 Ga0453684_0037456 3300044712 Bacteria 6657
250 Ga0453684_0056512 3300044712 Bacteria 5090
251 Ga0453684_0066629 3300044712 Unclassified 4584
252 Ga0453684_0077947 3300044712 Bacteria 4149
253 Ga0453684_0103818 3300044712 Bacteria 3472
254 Ga0453684_0116993 3300044712 Bacteria 3226
255 Ga0453684_0142666 3300044712 Bacteria 2857
256 Ga0453684_0415804 3300044712 Bacteria 1503
257 Ga0453684_0517921 3300044712 Bacteria 1318
258 Ga0453684_0609090 3300044712 Bacteria 1196
259 Ga0453684_0655090 3300044712 Bacteria 1145
260 Ga0453684_0752755 3300044712 Unclassified 1054
261 Ga0451576_0000012 3300045051 Bacteria 674684
262 Ga0451576_0000176 3300045051 Bacteria 161951
263 Ga0451576_0001027 3300045051 Bacteria 51553
264 Ga0451576_0002009 3300045051 Bacteria 32207
265 Ga0451576_0004931 3300045051 Bacteria 17002
266 Ga0451576_0013544 3300045051 Bacteria 9121
267 Ga0451576_0014770 3300045051 Bacteria 8680
268 Ga0451576_0019269 3300045051 Bacteria 7449
269 Ga0451576_0052217 3300045051 Unclassified 4284
270 Ga0451576_0107687 3300045051 Bacteria 2900
271 Ga0451576_0183792 3300045051 Unclassified 2183
272 Ga0451576_0269978 3300045051 Unclassified 1778
273 Ga0451576_0308355 3300045051 Bacteria 1656
274 Ga0451576_0347626 3300045051 Bacteria 1553
275 Ga0451576_0571814 3300045051 Unclassified 1187
276 Ga0495627_000067 3300046453 Bacteria 130165
277 Ga0495627_002560 3300046453 Bacteria 8640
278 Ga0495627_006933 3300046453 Bacteria 4399
279 Ga0495590_0003419 3300046457 Bacteria 6484
280 Ga0495596_0028911 3300046500 Bacteria 2224
281 Ga0495607_0042284 3300046501 Bacteria 2702
282 Ga0495606_0006112 3300046507 Bacteria 11241
283 Ga0495606_0021032 3300046507 Bacteria 4789
284 Ga0495606_0022325 3300046507 Bacteria 4613
285 Ga0495606_0162837 3300046507 Bacteria 1300
286 Ga0495610_0000006 3300046512 Bacteria 856822
287 Ga0495610_0001630 3300046512 Bacteria 19740
288 Ga0495610_0002222 3300046512 Bacteria 16427
289 Ga0495610_0164782 3300046512 Bacteria 934
290 Ga0495632_0005199 3300046519 Bacteria 8681
291 Ga0495637_0035181 3300046520 Bacteria 2189
292 Ga0495643_0000597 3300046522 Bacteria 43811
293 Ga0495644_0009631 3300046523 Bacteria 3721
294 Ga0495663_0000026 3300046525 Bacteria 90652
295 Ga0495663_0001302 3300046525 Bacteria 7914
296 Ga0495654_0000017 3300046530 Bacteria 295999
297 Ga0495609_0000017 3300046538 Bacteria 306684
298 Ga0495633_0000407 3300046558 Bacteria 44840
299 Ga0495633_0003694 3300046558 Bacteria 10104
300 Ga0495633_0200162 3300046558 Bacteria 917
301 Ga0495625_0000685 3300046660 Bacteria 48249
302 Ga0495625_0020993 3300046660 Bacteria 5035
303 Ga0495625_0207323 3300046660 Bacteria 1290
304 Ga0495660_0053303 3300046810 Bacteria 2196
305 Ga0495677_0025707 3300047445 Unclassified 2136
306 Ga0495686_0000127 3300047472 Bacteria 156278
307 Ga0495686_0002659 3300047472 Bacteria 16476
308 Ga0495686_0052883 3300047472 Bacteria 2546
309 Ga0496102_0035791 3300048905 Bacteria 4471
310 Ga0496115_0060702 3300048918 Bacteria 3047
311 Ga0496116_0000004 3300048919 Bacteria 839841
312 Ga0496116_0000199 3300048919 Bacteria 116470
313 Ga0496116_0001157 3300048919 Bacteria 31125
314 Ga0496117_0000082 3300048920 Bacteria 220895
315 Ga0496117_0000980 3300048920 Bacteria 43732
316 Ga0496118_0001029 3300048921 Bacteria 43389
317 Ga0496118_0026352 3300048921 Bacteria 4955
318 Ga0496118_0033576 3300048921 Bacteria 4207
319 Ga0496118_0052864 3300048921 Bacteria 3093
320 Ga0496119_0000021 3300048922 Bacteria 277056
321 Ga0496121_0016210 3300048924 Bacteria 7712
322 Ga0496121_0120822 3300048924 Bacteria 1979
323 Ga0496121_0218849 3300048924 Bacteria 1343
324 Ga0496122_0000155 3300048925 Bacteria 160489
325 Ga0496122_0000168 3300048925 Bacteria 155447
326 Ga0496122_0001176 3300048925 Bacteria 44742
327 Ga0496122_0002730 3300048925 Bacteria 24410
328 Ga0496122_0004107 3300048925 Bacteria 18429
329 Ga0496122_0056894 3300048925 Bacteria 2910
330 Ga0496123_0003195 3300048926 Bacteria 18696
331 Ga0496123_0007111 3300048926 Bacteria 10630
332 Ga0496123_0011350 3300048926 Bacteria 7735
333 Ga0496123_0030030 3300048926 Bacteria 3987
334 Ga0496123_0034147 3300048926 Bacteria 3648
335 Ga0496124_0000966 3300048927 Bacteria 45795
336 Ga0496124_0128749 3300048927 Bacteria 2014
337 Ga0496124_0171437 3300048927 Bacteria 1680
338 Ga0496125_0000012 3300048928 Bacteria 651142
339 Ga0496125_0000310 3300048928 Bacteria 95700
340 Ga0496125_0001263 3300048928 Bacteria 37737
341 Ga0496125_0001457 3300048928 Bacteria 34247
342 Ga0496125_0034300 3300048928 Bacteria 4476
343 Ga0496125_0151780 3300048928 Bacteria 1589
344 Ga0496125_0201958 3300048928 Unclassified 1300
345 Ga0496126_0001324 3300048929 Bacteria 39392
346 Ga0496126_0024233 3300048929 Bacteria 5861
347 Ga0496126_0340280 3300048929 Bacteria 1229
348 Ga0501314_015169 3300049530 Bacteria 761
349 Ga0501034_0038653 3300049571 Bacteria 4832
350 Ga0501040_0029924 3300049576 Bacteria 3676
351 Ga0501223_001238 3300049663 Bacteria 5955
352 Ga0501238_000066 3300049671 Bacteria 16830
353 Ga0501240_000238 3300049673 Bacteria 4141
354 Ga0501249_000036 3300049679 Bacteria 64657
355 Ga0501249_024664 3300049679 Bacteria 1325
356 Ga0501241_000017 3300049758 Bacteria 96324
357 Ga0501266_000004 3300049763 Bacteria 356286
358 Ga0501269_000373 3300049766 Bacteria 10990
359 Ga0501280_000267 3300049776 Bacteria 13213
360 Ga0501280_001371 3300049776 Bacteria 4569
361 nmdc:mga03683_5308_c1 3300050489 Bacteria 4346
362 nmdc:mga03n38_49373_c1 3300050490 Bacteria 1871
363 nmdc:mga00v17_63774_c1 3300050491 Bacteria 2270
364 nmdc:mga0k408_5412_c1 3300050493 Bacteria 6793
365 Ga0500641_0000003 3300053096 Bacteria 284831
366 Ga0500641_0000053 3300053096 Bacteria 49769
367 Ga0500641_0000086 3300053096 Bacteria 37170
368 Ga0500594_0004417 3300053118 Bacteria 3098
369 Ga0500594_0069774 3300053118 Bacteria 1031
370 Ga0500658_0000009 3300053134 Bacteria 270303
371 Ga0500559_0074238 3300053136 Bacteria 1536
372 Ga0500622_0062417 3300053156 Bacteria 1898
373 Ga0500627_0290169 3300053158 Bacteria 716
374 Ga0500634_0119800 3300053161 Bacteria 1283
375 Ga0500584_064074 3300053726 Bacteria 1623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10011678 Ga0065714_100116782 198
2 3300006177 Ga0075362_10144062 Ga0075362_101440622 198
3 3300013306 Ga0163162_11255911 Ga0163162_112559111 198
4 3300027617 Ga0210002_1006483 Ga0210002_10064832 198
5 3300030734 Ga0316179_1030548 Ga0316179_10305482 198
6 3300031548 Ga0307408_100005259 Ga0307408_1000052592 198
7 3300031824 Ga0307413_10170691 Ga0307413_101706912 198
8 3300031852 Ga0307410_10000018 Ga0307410_1000001836 198
9 3300031901 Ga0307406_10000408 Ga0307406_1000040818 198
10 3300031903 Ga0307407_10235703 Ga0307407_102357032 198
11 3300032004 Ga0307414_10000008 Ga0307414_10000008222 198
12 3300046558 Ga0495633_0200162 Ga0495633_0200162_39_647 198
13 3300049530 Ga0501314_015169 Ga0501314_015169_39_647 198
14 3300053158 Ga0500627_0290169 Ga0500627_0290169_31_660 207
15 iso_pu_bacteria 2721755487 2722731044 210
16 3300026078 Ga0207702_10177269 Ga0207702_101772692 216
17 3300013308 Ga0157375_10014658 Ga0157375_100146587 218
18 3300013100 Ga0157373_10012947 Ga0157373_100129473 219
19 3300015261 Ga0182006_1000159 Ga0182006_100015932 222
20 3300042876 Ga0451577_0032927 Ga0451577_0032927_445_1215 227
21 3300044673 Ga0453683_0048550 Ga0453683_0048550_1855_2625 227
22 3300044712 Ga0453684_0000091 Ga0453684_0000091_297102_297872 227
23 3300017792 Ga0163161_10308434 Ga0163161_103084342 228
24 3300013308 Ga0157375_10061516 Ga0157375_100615163 229
25 3300017792 Ga0163161_10038302 Ga0163161_100383023 229
26 3300028800 Ga0265338_10001687 Ga0265338_1000168714 229
27 iso_pu_bacteria 2585427687 2586210303 230
28 iso_pu_bacteria 2818991437 2819546138 230
29 3300005327 Ga0070658_10352306 Ga0070658_103523062 233
30 3300025909 Ga0207705_10317609 Ga0207705_103176092 233
31 3300005288 Ga0065714_10002216 Ga0065714_1000221621 234
32 3300009036 Ga0105244_10119333 Ga0105244_101193332 234
33 3300013306 Ga0163162_10001114 Ga0163162_1000111415 234
34 3300017792 Ga0163161_10002199 Ga0163161_100021998 234
35 3300032002 Ga0307416_100000002 Ga0307416_100000002152 234
36 3300044712 Ga0453684_0016857 Ga0453684_0016857_6247_7101 234
37 3300046507 Ga0495606_0162837 Ga0495606_0162837_350_1096 234
38 3300046512 Ga0495610_0001630 Ga0495610_0001630_2461_3186 234
39 3300046520 Ga0495637_0035181 Ga0495637_0035181_85_810 234
40 iso_pu_bacteria 2898713307 2898714388 234
41 3300003320 rootH2_10047243 rootH2_100472433 235
42 3300047472 Ga0495686_0052883 Ga0495686_0052883_881_1621 235
43 3300006048 Ga0075363_100124956 Ga0075363_1001249562 236
44 3300006177 Ga0075362_10005379 Ga0075362_100053796 236
45 3300006195 Ga0075366_10053415 Ga0075366_100534152 236
46 3300006195 Ga0075366_10113427 Ga0075366_101134272 236
47 3300009093 Ga0105240_10001259 Ga0105240_100012598 236
48 3300009174 Ga0105241_10004818 Ga0105241_100048184 236
49 3300009545 Ga0105237_10020618 Ga0105237_100206188 236
50 3300010375 Ga0105239_10000955 Ga0105239_1000095526 236
51 3300013297 Ga0157378_10385573 Ga0157378_103855731 236
52 3300025911 Ga0207654_10033881 Ga0207654_100338812 236
53 3300025913 Ga0207695_10000183 Ga0207695_10000183131 236
54 3300050489 nmdc:mga03683_5308_c1 nmdc:mga03683_5308_c1_3364_4110 236
55 3300050490 nmdc:mga03n38_49373_c1 nmdc:mga03n38_49373_c1_976_1722 236
56 3300050491 nmdc:mga00v17_63774_c1 nmdc:mga00v17_63774_c1_291_1037 236
57 3300050493 nmdc:mga0k408_5412_c1 nmdc:mga0k408_5412_c1_2642_3388 236
58 3300041456 Ga0451795_0156879 Ga0451795_0156879_248_1024 237
59 iso_pu_bacteria 2833640130 2833640421 237
60 3300031251 Ga0265327_10016068 Ga0265327_100160682 238
61 3300032005 Ga0307411_10097085 Ga0307411_100970851 238
62 3300036647 Ga0316582_0005600 Ga0316582_0005600_3877_4698 238
63 3300041456 Ga0451795_1614751 Ga0451795_1614751_243_989 238
64 3300041511 Ga0451855_0189049 Ga0451855_0189049_352_1095 238
65 3300041511 Ga0451855_1579243 Ga0451855_1579243_406_1152 238
66 3300042876 Ga0451577_0104915 Ga0451577_0104915_351_1100 238
67 3300044712 Ga0453684_0066629 Ga0453684_0066629_779_1528 238
68 3300044712 Ga0453684_0609090 Ga0453684_0609090_249_1004 238
69 3300049673 Ga0501240_000238 Ga0501240_000238_834_1577 238
70 iso_pu_bacteria 2513020052 2513234262 238
71 iso_pu_bacteria 2519899754 2520882165 238
72 iso_pu_bacteria 2643221600 2644010057 238
73 iso_pu_bacteria 2643221667 2644373402 238
74 iso_pu_bacteria 2643221716 2644640370 238
75 iso_pu_bacteria 2643221725 2644683498 238
76 iso_pu_bacteria 2738541279 2738733519 238
77 iso_pu_bacteria 2738541285 2738766057 238
78 iso_pu_bacteria 2738543007 2739215100 238
79 iso_pu_bacteria 2739367857 2740002182 238
80 iso_pu_bacteria 2739367858 2740006998 238
81 iso_pu_bacteria 2802428842 2802652617 238
82 iso_pu_bacteria 2816332280 2817417145 238
83 iso_pu_bacteria 2857613821 2857616087 238
84 iso_pu_bacteria 2857618242 2857620154 238
85 iso_pu_bacteria 2881247448 2881248234 238
86 iso_pu_bacteria 2881359912 2881362909 238
87 iso_pu_bacteria 2896317667 2896320433 238
88 iso_pu_bacteria 2903895155 2903898127 238
89 iso_pu_bacteria 2904419702 2904422276 238
90 iso_pu_bacteria 2904555929 2904558853 238
91 iso_pu_bacteria 2904780799 2904783422 238
92 iso_pu_bacteria 2919177583 2919181288 238
93 iso_pu_bacteria 2919191525 2919191831 238
94 iso_pu_bacteria 2919509842 2919509866 238
95 iso_pu_bacteria 2919683626 2919685760 238
96 iso_pu_bacteria 2929150217 2929154455 238
97 iso_pu_bacteria 2958458903 2958459344 238
98 iso_pu_bacteria 2958512119 2958512815 238
99 iso_pu_bacteria 2965320100 2965320393 238
100 iso_pu_bacteria 2977268062 2977271288 238
101 iso_pu_bacteria 8036736890 8036737843 238
102 iso_pu_bacteria 8054307821 8054310767 238
103 iso_pu_bacteria 8055419101 8055422753 238
104 iso_pu_bacteria 8055592153 8055592589 238
105 iso_pu_bacteria 8056440228 8056441968 238
106 3300002737 JGI25162J39368_1001096 JGI25162J39368_100109612 239
107 3300002772 JGI25164J39214_1002462 JGI25164J39214_10024622 239
108 3300003214 JGI25165J46597_1000621 JGI25165J46597_100062124 239
109 3300003320 rootH2_10167632 rootH2_101676325 239
110 3300005289 Ga0065704_10074225 Ga0065704_100742254 239
111 3300005614 Ga0068856_100036133 Ga0068856_1000361334 239
112 3300009093 Ga0105240_10028304 Ga0105240_100283046 239
113 3300009148 Ga0105243_10000003 Ga0105243_10000003100 239
114 3300009545 Ga0105237_10044571 Ga0105237_100445713 239
115 3300010375 Ga0105239_10032897 Ga0105239_100328977 239
116 3300025231 Ga0207427_100652 Ga0207427_1006525 239
117 3300025233 Ga0209437_100048 Ga0209437_100048121 239
118 3300025261 Ga0209233_1000029 Ga0209233_1000029256 239
119 3300025272 Ga0209455_1001061 Ga0209455_10010612 239
120 3300025913 Ga0207695_10002903 Ga0207695_100029034 239
121 3300025914 Ga0207671_10032517 Ga0207671_100325173 239
122 3300025935 Ga0207709_10000008 Ga0207709_10000008473 239
123 3300026078 Ga0207702_10032709 Ga0207702_100327093 239
124 3300028800 Ga0265338_10003394 Ga0265338_1000339414 239
125 3300031251 Ga0265327_10001564 Ga0265327_1000156410 239
126 3300032004 Ga0307414_10483969 Ga0307414_104839691 239
127 3300042876 Ga0451577_0288452 Ga0451577_0288452_88_816 239
128 3300044673 Ga0453683_0021937 Ga0453683_0021937_957_1685 239
129 3300044712 Ga0453684_0037456 Ga0453684_0037456_4150_4980 239
130 3300044712 Ga0453684_0056512 Ga0453684_0056512_4114_4953 239
131 3300045051 Ga0451576_0013544 Ga0451576_0013544_2343_3113 239
132 3300045051 Ga0451576_0052217 Ga0451576_0052217_1184_1960 239
133 3300045051 Ga0451576_0107687 Ga0451576_0107687_184_912 239
134 3300047472 Ga0495686_0002659 Ga0495686_0002659_3509_4252 239
135 3300048919 Ga0496116_0001157 Ga0496116_0001157_27610_28404 239
136 3300048920 Ga0496117_0000980 Ga0496117_0000980_26859_27653 239
137 3300048921 Ga0496118_0052864 Ga0496118_0052864_88_882 239
138 3300048925 Ga0496122_0002730 Ga0496122_0002730_7822_8616 239
139 3300048926 Ga0496123_0011350 Ga0496123_0011350_5066_5860 239
140 3300048928 Ga0496125_0151780 Ga0496125_0151780_237_1031 239
141 iso_pu_bacteria 2523533629 2524004432 239
142 iso_pu_bacteria 2582581873 2585426932 239
143 iso_pu_bacteria 2585428061 2587753521 239
144 iso_pu_bacteria 2585428095 2587867281 239
145 iso_pu_bacteria 2585428115 2587945055 239
146 iso_pu_bacteria 2585428187 2588232672 239
147 iso_pu_bacteria 2588254257 2590613395 239
148 iso_pu_bacteria 2739367651 2739588188 239
149 iso_pu_bacteria 2739367663 2739647051 239
150 iso_pu_bacteria 2775506739 2775671701 239
151 iso_pu_bacteria 2842722452 2842724008 239
152 iso_pu_bacteria 2842909656 2842912259 239
153 iso_pu_bacteria 2849281842 2849282691 239
154 iso_pu_bacteria 2857627736 2857629394 239
155 iso_pu_bacteria 2871720351 2871722278 239
156 iso_pu_bacteria 2889290771 2889294904 239
157 iso_pu_bacteria 2902048731 2902050373 239
158 iso_pu_bacteria 2919097161 2919098860 239
159 iso_pu_bacteria 2919399522 2919402407 239
160 iso_pu_bacteria 2945924605 2945925778 239
161 iso_pu_bacteria 2946019816 2946022979 239
162 iso_pu_bacteria 2954016120 2954021633 239
163 iso_pu_bacteria 8055588893 8055590122 239
164 3300002773 JGI25152J39213_1000469 JGI25152J39213_100046910 240
165 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001160 240
166 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001638 240
167 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001527 240
168 3300003322 rootL2_10381536 rootL2_103815361 240
169 3300005466 Ga0070685_10053821 Ga0070685_100538212 240
170 3300005616 Ga0068852_100230213 Ga0068852_1002302132 240
171 3300009545 Ga0105237_10001903 Ga0105237_100019036 240
172 3300013102 Ga0157371_10000074 Ga0157371_10000074114 240
173 3300013102 Ga0157371_10043596 Ga0157371_100435962 240
174 3300013104 Ga0157370_10003405 Ga0157370_100034058 240
175 3300013104 Ga0157370_10006700 Ga0157370_100067006 240
176 3300013104 Ga0157370_10190103 Ga0157370_101901032 240
177 3300013105 Ga0157369_10000031 Ga0157369_10000031137 240
178 3300013308 Ga0157375_10264787 Ga0157375_102647872 240
179 3300013308 Ga0157375_11025598 Ga0157375_110255981 240
180 3300014497 Ga0182008_10000048 Ga0182008_1000004832 240
181 3300014497 Ga0182008_10000491 Ga0182008_1000049117 240
182 3300014497 Ga0182008_10027508 Ga0182008_100275082 240
183 3300015261 Ga0182006_1000103 Ga0182006_100010334 240
184 3300015262 Ga0182007_10000002 Ga0182007_10000002166 240
185 3300015262 Ga0182007_10012183 Ga0182007_100121832 240
186 3300015682 Ga0183373_1004 Ga0183373_1004304 240
187 3300017792 Ga0163161_10000207 Ga0163161_100002079 240
188 3300017792 Ga0163161_10075641 Ga0163161_100756411 240
189 3300017792 Ga0163161_10449719 Ga0163161_104497191 240
190 3300025245 Ga0207425_1000002 Ga0207425_10000021002 240
191 3300025258 Ga0209129_1000002 Ga0209129_10000021002 240
192 3300025292 Ga0209676_1000009 Ga0209676_1000009170 240
193 3300025294 Ga0209025_1000004 Ga0209025_1000004188 240
194 3300025297 Ga0209758_1000006 Ga0209758_1000006188 240
195 3300025298 Ga0209050_1000094 Ga0209050_1000094170 240
196 3300025914 Ga0207671_10010150 Ga0207671_100101503 240
197 3300026142 Ga0207698_10196418 Ga0207698_101964182 240
198 3300028794 Ga0307515_10021616 Ga0307515_100216168 240
199 3300028800 Ga0265338_10118654 Ga0265338_101186542 240
200 3300031731 Ga0307405_10000015 Ga0307405_100000156 240
201 3300031824 Ga0307413_10017337 Ga0307413_100173372 240
202 3300031903 Ga0307407_10000031 Ga0307407_1000003132 240
203 3300031911 Ga0307412_10003796 Ga0307412_1000379611 240
204 3300032004 Ga0307414_10033994 Ga0307414_100339942 240
205 3300035398 Ga0316574_0349964 Ga0316574_0349964_54_806 240
206 3300037418 Ga0395900_0000139 Ga0395900_0000139_37640_38389 240
207 3300037418 Ga0395900_0072385 Ga0395900_0072385_2651_3448 240
208 3300039093 Ga0400489_63785 Ga0400489_63785_223_1026 240
209 3300041456 Ga0451795_1058609 Ga0451795_1058609_405_1133 240
210 3300041486 Ga0451807_1730649 Ga0451807_1730649_182_937 240
211 3300041511 Ga0451855_0532222 Ga0451855_0532222_59_790 240
212 3300041511 Ga0451855_1244572 Ga0451855_1244572_2045_2797 240
213 3300041511 Ga0451855_1695269 Ga0451855_1695269_377_1105 240
214 3300042876 Ga0451577_0000140 Ga0451577_0000140_73686_74474 240
215 3300042876 Ga0451577_0157952 Ga0451577_0157952_1123_1932 240
216 3300042876 Ga0451577_0290909 Ga0451577_0290909_297_1100 240
217 3300044673 Ga0453683_0150322 Ga0453683_0150322_654_1406 240
218 3300044712 Ga0453684_0000084 Ga0453684_0000084_47815_48603 240
219 3300044712 Ga0453684_0001860 Ga0453684_0001860_15553_16362 240
220 3300044712 Ga0453684_0025595 Ga0453684_0025595_899_1672 240
221 3300044712 Ga0453684_0142666 Ga0453684_0142666_374_1123 240
222 3300045051 Ga0451576_0000176 Ga0451576_0000176_47305_48093 240
223 3300045051 Ga0451576_0002009 Ga0451576_0002009_20236_21003 240
224 3300045051 Ga0451576_0019269 Ga0451576_0019269_6382_7119 240
225 3300045051 Ga0451576_0269978 Ga0451576_0269978_386_1195 240
226 3300046512 Ga0495610_0002222 Ga0495610_0002222_8343_9110 240
227 3300046523 Ga0495644_0009631 Ga0495644_0009631_639_1442 240
228 3300047445 Ga0495677_0025707 Ga0495677_0025707_810_1613 240
229 3300048926 Ga0496123_0007111 Ga0496123_0007111_1241_1999 240
230 3300048928 Ga0496125_0201958 Ga0496125_0201958_53_811 240
231 3300048929 Ga0496126_0340280 Ga0496126_0340280_181_948 240
232 3300049571 Ga0501034_0038653 Ga0501034_0038653_4047_4790 240
233 3300049663 Ga0501223_001238 Ga0501223_001238_4825_5574 240
234 3300049776 Ga0501280_001371 Ga0501280_001371_510_1271 240
235 3300053161 Ga0500634_0119800 Ga0500634_0119800_131_892 240
236 iso_pu_bacteria 2738541283 2738755627 240
237 iso_pu_bacteria 2738541302 2738855423 240
238 iso_pu_bacteria 2904445276 2904446421 240
239 iso_pu_bacteria 2945997725 2945999237 240
240 3300003320 rootH2_10143116 rootH2_101431162 241
241 3300003323 rootH1_10338304 rootH1_103383042 241
242 3300005563 Ga0068855_100150880 Ga0068855_1001508802 241
243 3300005563 Ga0068855_100157676 Ga0068855_1001576762 241
244 3300005577 Ga0068857_100195955 Ga0068857_1001959552 241
245 3300005614 Ga0068856_100016605 Ga0068856_1000166054 241
246 3300006175 Ga0070712_100190892 Ga0070712_1001908922 241
247 3300006942 Ga0099824_1000985 Ga0099824_100098512 241
248 3300025949 Ga0207667_10117514 Ga0207667_101175142 241
249 3300025949 Ga0207667_10297626 Ga0207667_102976261 241
250 3300026023 Ga0207677_10409640 Ga0207677_104096401 241
251 3300026078 Ga0207702_10099811 Ga0207702_100998111 241
252 3300026116 Ga0207674_10122802 Ga0207674_101228022 241
253 3300031235 Ga0265330_10090376 Ga0265330_100903762 241
254 3300031251 Ga0265327_10082193 Ga0265327_100821932 241
255 3300031344 Ga0265316_10000850 Ga0265316_100008503 241
256 3300031548 Ga0307408_100000988 Ga0307408_10000098810 241
257 3300031727 Ga0316576_10008324 Ga0316576_100083243 241
258 3300031727 Ga0316576_10012283 Ga0316576_100122833 241
259 3300031727 Ga0316576_10103257 Ga0316576_101032572 241
260 3300031727 Ga0316576_10137063 Ga0316576_101370632 241
261 3300031728 Ga0316578_10002532 Ga0316578_100025324 241
262 3300031728 Ga0316578_10025760 Ga0316578_100257604 241
263 3300032004 Ga0307414_10002926 Ga0307414_100029264 241
264 3300035398 Ga0316574_0089142 Ga0316574_0089142_163_906 241
265 3300035398 Ga0316574_0167850 Ga0316574_0167850_540_1331 241
266 3300036647 Ga0316582_0013780 Ga0316582_0013780_1363_2115 241
267 3300036712 Ga0316584_0009693 Ga0316584_0009693_413_1204 241
268 3300036712 Ga0316584_0096107 Ga0316584_0096107_324_1076 241
269 3300037471 Ga0395905_0000340 Ga0395905_0000340_13721_14482 241
270 3300038741 Ga0400488_41148 Ga0400488_41148_674_1426 241
271 3300039062 Ga0400483_228548 Ga0400483_228548_14264_15010 241
272 3300042876 Ga0451577_0000097 Ga0451577_0000097_145423_146256 241
273 3300044673 Ga0453683_0000463 Ga0453683_0000463_12532_13296 241
274 3300044673 Ga0453683_0005411 Ga0453683_0005411_8078_8833 241
275 3300044673 Ga0453683_0023941 Ga0453683_0023941_1555_2310 241
276 3300044673 Ga0453683_0090277 Ga0453683_0090277_56_838 241
277 3300044673 Ga0453683_0431788 Ga0453683_0431788_50_802 241
278 3300044712 Ga0453684_0015588 Ga0453684_0015588_3411_4160 241
279 3300044712 Ga0453684_0015694 Ga0453684_0015694_3171_3932 241
280 3300044712 Ga0453684_0103818 Ga0453684_0103818_1553_2311 241
281 3300044712 Ga0453684_0116993 Ga0453684_0116993_1220_2002 241
282 3300044712 Ga0453684_0415804 Ga0453684_0415804_226_981 241
283 3300044712 Ga0453684_0517921 Ga0453684_0517921_453_1247 241
284 3300044712 Ga0453684_0655090 Ga0453684_0655090_261_1067 241
285 3300045051 Ga0451576_0001027 Ga0451576_0001027_45872_46636 241
286 3300045051 Ga0451576_0004931 Ga0451576_0004931_10592_11347 241
287 3300045051 Ga0451576_0014770 Ga0451576_0014770_1947_2711 241
288 3300045051 Ga0451576_0308355 Ga0451576_0308355_470_1309 241
289 3300045051 Ga0451576_0347626 Ga0451576_0347626_497_1246 241
290 3300045051 Ga0451576_0571814 Ga0451576_0571814_49_831 241
291 3300046457 Ga0495590_0003419 Ga0495590_0003419_4554_5282 241
292 3300046501 Ga0495607_0042284 Ga0495607_0042284_1460_2188 241
293 iso_pu_bacteria 2919186247 2919189124 241
294 iso_pu_bacteria 2939664404 2939666721 241
295 3300003316 rootH1_10195063 rootH1_101950632 242
296 3300005288 Ga0065714_10003551 Ga0065714_100035512 242
297 3300005288 Ga0065714_10148095 Ga0065714_101480951 242
298 3300005544 Ga0070686_100202934 Ga0070686_1002029341 242
299 3300006946 Ga0079104_1000057 Ga0079104_100005725 242
300 3300006948 Ga0099826_10001279 Ga0099826_100012796 242
301 3300009011 Ga0105251_10029901 Ga0105251_100299012 242
302 3300009036 Ga0105244_10000002 Ga0105244_10000002151 242
303 3300013100 Ga0157373_10000001 Ga0157373_10000001408 242
304 3300013102 Ga0157371_10021922 Ga0157371_100219223 242
305 3300013104 Ga0157370_10000186 Ga0157370_100001869 242
306 3300013104 Ga0157370_10000529 Ga0157370_1000052947 242
307 3300013104 Ga0157370_10003715 Ga0157370_1000371518 242
308 3300013104 Ga0157370_10257385 Ga0157370_102573852 242
309 3300013306 Ga0163162_10263258 Ga0163162_102632582 242
310 3300015261 Ga0182006_1006914 Ga0182006_10069142 242
311 3300017792 Ga0163161_10000043 Ga0163161_1000004379 242
312 3300017792 Ga0163161_10078807 Ga0163161_100788072 242
313 3300025728 Ga0207655_1000012 Ga0207655_1000012183 242
314 3300027111 Ga0209281_1000372 Ga0209281_100037234 242
315 3300027361 Ga0209489_117543 Ga0209489_1175434 242
316 3300027666 Ga0209282_1028647 Ga0209282_10286472 242
317 3300032002 Ga0307416_100037161 Ga0307416_1000371614 242
318 3300032004 Ga0307414_10001903 Ga0307414_100019036 242
319 3300032004 Ga0307414_10005840 Ga0307414_100058403 242
320 3300032004 Ga0307414_10033168 Ga0307414_100331682 242
321 3300032004 Ga0307414_10241137 Ga0307414_102411372 242
322 3300032004 Ga0307414_10277790 Ga0307414_102777902 242
323 3300032005 Ga0307411_10000008 Ga0307411_10000008266 242
324 3300033180 Ga0307510_10020709 Ga0307510_100207096 242
325 3300041407 Ga0439447_008176 Ga0439447_008176_1059_1799 242
326 3300041411 Ga0439466_0003262 Ga0439466_0003262_2177_2917 242
327 3300041486 Ga0451807_1657289 Ga0451807_1657289_15_749 242
328 3300041486 Ga0451807_2511280 Ga0451807_2511280_438_1172 242
329 3300042876 Ga0451577_0133524 Ga0451577_0133524_1296_2057 242
330 3300044712 Ga0453684_0005040 Ga0453684_0005040_7197_7979 242
331 3300044712 Ga0453684_0022085 Ga0453684_0022085_6481_7242 242
332 3300044712 Ga0453684_0077947 Ga0453684_0077947_1395_2156 242
333 3300044712 Ga0453684_0752755 Ga0453684_0752755_126_908 242
334 3300045051 Ga0451576_0000012 Ga0451576_0000012_24958_25719 242
335 3300045051 Ga0451576_0183792 Ga0451576_0183792_1334_2095 242
336 3300046453 Ga0495627_002560 Ga0495627_002560_4478_5212 242
337 3300046507 Ga0495606_0021032 Ga0495606_0021032_970_1704 242
338 3300046512 Ga0495610_0164782 Ga0495610_0164782_18_752 242
339 3300046522 Ga0495643_0000597 Ga0495643_0000597_2760_3494 242
340 3300046660 Ga0495625_0020993 Ga0495625_0020993_3433_4167 242
341 3300046660 Ga0495625_0207323 Ga0495625_0207323_335_1069 242
342 3300048918 Ga0496115_0060702 Ga0496115_0060702_882_1616 242
343 3300048919 Ga0496116_0000004 Ga0496116_0000004_472078_472812 242
344 3300048921 Ga0496118_0026352 Ga0496118_0026352_4144_4878 242
345 3300048924 Ga0496121_0016210 Ga0496121_0016210_1850_2584 242
346 3300048924 Ga0496121_0218849 Ga0496121_0218849_273_1007 242
347 3300048927 Ga0496124_0171437 Ga0496124_0171437_485_1219 242
348 3300048928 Ga0496125_0000012 Ga0496125_0000012_469039_469773 242
349 3300048928 Ga0496125_0000310 Ga0496125_0000310_63214_63948 242
350 3300048929 Ga0496126_0024233 Ga0496126_0024233_1900_2634 242
351 3300049576 Ga0501040_0029924 Ga0501040_0029924_1872_2609 242
352 3300049671 Ga0501238_000066 Ga0501238_000066_15174_15914 242
353 3300049679 Ga0501249_000036 Ga0501249_000036_38084_38854 242
354 3300049679 Ga0501249_024664 Ga0501249_024664_437_1177 242
355 3300049763 Ga0501266_000004 Ga0501266_000004_353081_353821 242
356 3300049776 Ga0501280_000267 Ga0501280_000267_11577_12317 242
357 3300053096 Ga0500641_0000003 Ga0500641_0000003_190333_191067 242
358 3300053096 Ga0500641_0000053 Ga0500641_0000053_606_1340 242
359 3300053096 Ga0500641_0000086 Ga0500641_0000086_14205_14945 242
360 3300053118 Ga0500594_0004417 Ga0500594_0004417_102_842 242
361 3300053118 Ga0500594_0069774 Ga0500594_0069774_12_746 242
362 3300053134 Ga0500658_0000009 Ga0500658_0000009_128146_128880 242
363 3300053136 Ga0500559_0074238 Ga0500559_0074238_36_776 242
364 3300053156 Ga0500622_0062417 Ga0500622_0062417_180_914 242
365 3300053726 Ga0500584_064074 Ga0500584_064074_507_1247 242
366 iso_pu_bacteria 2890737413 2890740913 242
367 iso_pu_bacteria 2896344016 2896345531 242
368 2162886007 SwRhRL2b_contig_1813815 SwRhRL2b_0473.00001200 243
369 3300001915 JGI24741J21665_1007052 JGI24741J21665_10070522 243
370 3300003322 rootL2_10098176 rootL2_100981762 243
371 3300005288 Ga0065714_10002520 Ga0065714_1000252016 243
372 3300005289 Ga0065704_10070975 Ga0065704_1007097517 243
373 3300005289 Ga0065704_10078830 Ga0065704_100788303 243
374 3300005327 Ga0070658_10409439 Ga0070658_104094391 243
375 3300005337 Ga0070682_100000087 Ga0070682_10000008724 243
376 3300005347 Ga0070668_100009837 Ga0070668_1000098373 243
377 3300005535 Ga0070684_100004059 Ga0070684_1000040596 243
378 3300009036 Ga0105244_10000001 Ga0105244_10000001723 243
379 3300009148 Ga0105243_10000234 Ga0105243_1000023444 243
380 3300009553 Ga0105249_10027265 Ga0105249_100272657 243
381 3300013100 Ga0157373_10000080 Ga0157373_1000008048 243
382 3300013100 Ga0157373_10206693 Ga0157373_102066933 243
383 3300013102 Ga0157371_10000036 Ga0157371_10000036145 243
384 3300013102 Ga0157371_10047689 Ga0157371_100476894 243
385 3300013102 Ga0157371_10056159 Ga0157371_100561591 243
386 3300013104 Ga0157370_10002014 Ga0157370_1000201415 243
387 3300013104 Ga0157370_10032744 Ga0157370_100327442 243
388 3300013105 Ga0157369_10001311 Ga0157369_1000131116 243
389 3300013308 Ga0157375_10032435 Ga0157375_100324355 243
390 3300014497 Ga0182008_10000232 Ga0182008_1000023218 243
391 3300015261 Ga0182006_1000003 Ga0182006_1000003611 243
392 3300015262 Ga0182007_10013798 Ga0182007_100137983 243
393 3300017792 Ga0163161_10003343 Ga0163161_100033439 243
394 3300017792 Ga0163161_10010683 Ga0163161_100106834 243
395 3300025291 Ga0209675_1000059 Ga0209675_1000059140 243
396 3300025728 Ga0207655_1000018 Ga0207655_1000018252 243
397 3300025935 Ga0207709_10001052 Ga0207709_100010528 243
398 3300025944 Ga0207661_10003784 Ga0207661_1000378412 243
399 3300025972 Ga0207668_10062783 Ga0207668_100627832 243
400 3300031911 Ga0307412_10000072 Ga0307412_1000007210 243
401 3300031911 Ga0307412_10008688 Ga0307412_100086882 243
402 3300032002 Ga0307416_100000013 Ga0307416_10000001365 243
403 3300032004 Ga0307414_10000049 Ga0307414_100000497 243
404 3300032004 Ga0307414_10021942 Ga0307414_100219425 243
405 3300032004 Ga0307414_10111503 Ga0307414_101115032 243
406 3300041413 Ga0439465_0004522 Ga0439465_0004522_1754_2491 243
407 3300042004 Ga0439445_0008503 Ga0439445_0008503_1462_2193 243
408 3300042436 Ga0439435_0107147 Ga0439435_0107147_29_763 243
409 3300046453 Ga0495627_000067 Ga0495627_000067_67665_68399 243
410 3300046453 Ga0495627_006933 Ga0495627_006933_2635_3369 243
411 3300046500 Ga0495596_0028911 Ga0495596_0028911_958_1689 243
412 3300046507 Ga0495606_0006112 Ga0495606_0006112_2361_3152 243
413 3300046507 Ga0495606_0022325 Ga0495606_0022325_2119_2859 243
414 3300046512 Ga0495610_0000006 Ga0495610_0000006_194003_194737 243
415 3300046519 Ga0495632_0005199 Ga0495632_0005199_6136_6870 243
416 3300046525 Ga0495663_0000026 Ga0495663_0000026_34474_35205 243
417 3300046525 Ga0495663_0001302 Ga0495663_0001302_393_1184 243
418 3300046530 Ga0495654_0000017 Ga0495654_0000017_233716_234450 243
419 3300046538 Ga0495609_0000017 Ga0495609_0000017_267814_268548 243
420 3300046558 Ga0495633_0000407 Ga0495633_0000407_11553_12287 243
421 3300046558 Ga0495633_0003694 Ga0495633_0003694_3970_4704 243
422 3300046660 Ga0495625_0000685 Ga0495625_0000685_33624_34358 243
423 3300046810 Ga0495660_0053303 Ga0495660_0053303_446_1180 243
424 3300047472 Ga0495686_0000127 Ga0495686_0000127_127924_128658 243
425 3300048905 Ga0496102_0035791 Ga0496102_0035791_2355_3086 243
426 3300048919 Ga0496116_0000199 Ga0496116_0000199_114292_115023 243
427 3300048920 Ga0496117_0000082 Ga0496117_0000082_208444_209175 243
428 3300048921 Ga0496118_0001029 Ga0496118_0001029_11691_12422 243
429 3300048921 Ga0496118_0033576 Ga0496118_0033576_2330_3064 243
430 3300048922 Ga0496119_0000021 Ga0496119_0000021_244039_244770 243
431 3300048924 Ga0496121_0120822 Ga0496121_0120822_10_741 243
432 3300048925 Ga0496122_0000155 Ga0496122_0000155_139945_140676 243
433 3300048925 Ga0496122_0000168 Ga0496122_0000168_27039_27770 243
434 3300048925 Ga0496122_0001176 Ga0496122_0001176_11730_12461 243
435 3300048925 Ga0496122_0004107 Ga0496122_0004107_238_1122 243
436 3300048925 Ga0496122_0056894 Ga0496122_0056894_1312_2046 243
437 3300048926 Ga0496123_0003195 Ga0496123_0003195_10287_11018 243
438 3300048926 Ga0496123_0030030 Ga0496123_0030030_984_1715 243
439 3300048926 Ga0496123_0034147 Ga0496123_0034147_1895_2629 243
440 3300048927 Ga0496124_0000966 Ga0496124_0000966_23132_23863 243
441 3300048927 Ga0496124_0128749 Ga0496124_0128749_772_1506 243
442 3300048928 Ga0496125_0001263 Ga0496125_0001263_3903_4637 243
443 3300048928 Ga0496125_0001457 Ga0496125_0001457_33327_34058 243
444 3300048928 Ga0496125_0034300 Ga0496125_0034300_1565_2299 243
445 3300048929 Ga0496126_0001324 Ga0496126_0001324_1393_2124 243
446 3300049758 Ga0501241_000017 Ga0501241_000017_26900_27640 243
447 3300049766 Ga0501269_000373 Ga0501269_000373_2039_2773 243
448 iso_pu_bacteria 2511231000 2511235010 243
449 iso_pu_bacteria 2582581278 2585144498 243
450 iso_pu_bacteria 2582581281 2585159622 243
451 iso_pu_bacteria 2582581282 2585163879 243
452 iso_pu_bacteria 2585428045 2587681117 243
453 iso_pu_bacteria 2585428060 2587750183 243
454 iso_pu_bacteria 2585428182 2588210597 243
455 iso_pu_bacteria 2585428183 2588214158 243
456 iso_pu_bacteria 2585428184 2588221570 243
457 iso_pu_bacteria 2585428185 2588223399 243
458 iso_pu_bacteria 2588253712 2588443697 243
459 iso_pu_bacteria 2588254255 2590601867 243
460 iso_pu_bacteria 2728369107 2729200388 243
461 iso_pu_bacteria 2738541273 2738701208 243
462 iso_pu_bacteria 2738543014 2739255506 243
463 iso_pu_bacteria 2739367874 2740059363 243
464 iso_pu_bacteria 2751185877 2753673436 243
465 iso_pu_bacteria 2765235839 2765574536 243
466 iso_pu_bacteria 2772190705 2772606605 243
467 iso_pu_bacteria 2816332188 2816874753 243
468 iso_pu_bacteria 2842083920 2842085278 243
469 iso_pu_bacteria 2905999023 2906001528 243
470 iso_pu_bacteria 2977243572 2977244678 243
471 iso_pu_bacteria 2984572630 2984573451 243
472 iso_pu_bacteria 2984606641 2984606889 243
473 iso_pu_bacteria 2993480792 2993482921 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

191

293

0.96

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

56

153

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9435 2 242
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9323 2 242
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.9293 2 242
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9286 2 242
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.9183 2 242
ID Description Score Start End Superfamily
af_Q2FW37_1_104_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9645 1 102 3.30.70.580
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9606 2 101 3.30.70.580
af_A0A0R0F7R0_40_148_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9547 2 101 3.30.70.580
af_Q2QWH9_69_188_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9488 2 101 3.30.70.580
af_Q2FW37_106_241_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.941 106 236 3.30.70.660
ID Description Score Start End GO Terms
AF-A0A1E5UCS0-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9903 14 243 GO:0003723
GO:0031119
GO:0160147
AF-A0A077KNT9-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9896 56 243 GO:0003723
GO:0031119
GO:0160147
AF-A0A1F3NZ15-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9863 1 242 GO:0003723
GO:0031119
GO:0160147
AF-A0A3C1S191-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9854 1 139 GO:0003723
GO:0009982
GO:0031119
GO:0140098
AF-A0A0B7II19-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.985 1 242 GO:0003723
GO:0031119
GO:0160147

Feature Viewer

pLDDT pTM Quality
94.92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map