metagRoot

F451080

General Info

Members	Datasets	Scaffolds	Average Seq Length
473	295	455	320

Family's Representative Sequence

Representative Sequence	3300046530\|Ga0495654_0000729\|Ga0495654_0000729_19654_20715
Length	353
Sequence	MRKQSFLPAQFSGLMGVFMLFVHKVFMQISTQRRRLTQVALSLIAALPFVAMAADDYPAKPLRIVVPYPAGGIADKIARETAEQLQVRLKQPVVVENRSGAAGNIGFDYVAHQPADGYTLLLAPASNLTVQPALFKNLSYDLARDFTPVSLLVQTPQVLLVHPALPVNSVKELIDYSKKNPGKVNYGVSLGAYSHLAGELLRSQTGADFTAIPYQGGAPAIVDLLSGQTQFIFNEVITAIPHIQSGKLKPLAVAYRTRAPWLPNVPTTAEAGFPGFEVTSWYGVVVRSGTPSAVVTRLSQELKAIVQAPEFKKRYDDLGAFTVGNTPEEFGRFIQSETVKWTAVVKQAGIEQN

Samples

	Sample ID	Description	Type	Environment
1	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
2	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
3	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
4	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
5	2738541307	Variovorax sp. GV008	Isolate	Unclassified
6	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
7	2818991446	Variovorax sp. 1180	Isolate	Unclassified
8	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
9	2842775625	Roseomonas sp. R-71825	Isolate	Unclassified
10	2885198086	Variovorax sp. 679	Isolate	Unclassified
11	2885211737	Variovorax sp. 553	Isolate	Unclassified
12	2899924645	Variovorax sp. 369	Isolate	Unclassified
13	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
14	2928037797	Variovorax sp. 1126	Isolate	Unclassified
15	2928044640	Variovorax sp. 1128	Isolate	Unclassified
16	2928051484	Variovorax sp. 1133	Isolate	Unclassified
17	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
18	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
19	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
20	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
21	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
22	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
23	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
24	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
25	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
26	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
27	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
28	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
29	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
30	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
31	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
32	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
33	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
34	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
35	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
36	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
37	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
38	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
39	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
40	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
41	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
42	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
43	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
44	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
45	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
46	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
47	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
48	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
49	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
50	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
51	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
52	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
53	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
54	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
55	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
56	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
57	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
58	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
59	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
60	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
61	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
62	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
63	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
64	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
65	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
66	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
67	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
68	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
69	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
70	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
71	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
72	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
73	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
74	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
75	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
76	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
77	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
78	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
79	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
80	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
81	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
82	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
83	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
84	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
85	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
86	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
87	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
88	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
89	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
90	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
91	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
92	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
93	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
94	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
95	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
96	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
97	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
98	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
99	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
100	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
101	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
102	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
103	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
104	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
105	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
106	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
107	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
108	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
109	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
110	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
111	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
112	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
113	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
114	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
115	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
116	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
117	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
118	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
119	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
120	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
121	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
122	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
123	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
124	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
125	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
126	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
127	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
128	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
129	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
130	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
134	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
136	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
137	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
138	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
140	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
143	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
146	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
148	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
189	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
193	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
194	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
195	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
196	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
197	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
198	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
199	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
200	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
201	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
202	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
203	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
204	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
205	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
206	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
207	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
208	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
209	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
210	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
211	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
212	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
213	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
214	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
215	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
216	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
217	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
218	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
219	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
220	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
221	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
222	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
223	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
224	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
225	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
226	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
227	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
228	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
229	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
230	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
231	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
232	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
233	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
234	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
235	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
236	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
237	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
238	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
239	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
240	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
241	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
242	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
243	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
244	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
245	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
246	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
247	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
248	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
249	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
250	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
251	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
252	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
253	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
254	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
255	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
256	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
257	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
258	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
259	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
260	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
261	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
262	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
263	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
264	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
265	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
266	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
267	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
268	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
269	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
270	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
271	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
272	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
273	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
274	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
275	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
276	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
277	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
278	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
279	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
280	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
281	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
282	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
283	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
284	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
285	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
286	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
287	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
288	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
289	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
290	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
291	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
292	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
293	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
294	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
295	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	95.98
Metatranscriptomes	0
Isolates	4.02

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	10.15
Nodule	0
Rhizoplane	1.06
Rhizosphere	81.61
Stem	0
Stem Tuber	0
Unclassified	7.19

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10004771	3300001979	Bacteria	5789
2	JGI25158J39367_1005660	3300002739	Bacteria	1826
3	JGI25152J39213_1002901	3300002773	Bacteria	6117
4	JGI25150J39212_1001956	3300002774	Bacteria	5406
5	JGI25159J45721_1003010	3300002987	Bacteria	6117
6	JGI25151J46595_10001365	3300003187	Bacteria	16888
7	JGI25151J46595_10006106	3300003187	Bacteria	6117
8	JGI25153J46596_10006199	3300003215	Bacteria	6117
9	rootH1_10065880	3300003316	Bacteria	2402
10	rootH2_10052291	3300003320	Bacteria	2992
11	rootH1_10020868	3300003316	Bacteria	1997
12	rootH1_10020868	3300003323	Bacteria	5682
13	JGI25160J50197_1004807	3300003354	Bacteria	5761
14	JGI25161J50226_1001347	3300003374	Bacteria	7551
15	Ga0055535_1000133	3300003761	Bacteria	79386
16	Ga0055542_1000003	3300003762	Bacteria	582721
17	Ga0055526_1006781	3300003771	Bacteria	6117
18	Ga0055537_1001334	3300003773	Bacteria	10089
19	Ga0055524_1004857	3300003775	Bacteria	6117
20	Ga0055534_1001302	3300003784	Bacteria	10089
21	Ga0055528_1002396	3300003790	Bacteria	10089
22	Ga0055540_1012427	3300003792	Bacteria	2673
23	Ga0055543_1002021	3300004625	Bacteria	7168
24	Ga0065165_1003783	3300005262	Bacteria	10127
25	Ga0065712_10010825	3300005290	Unclassified	1910
26	Ga0065707_10123584	3300005295	Bacteria	2062
27	Ga0065707_10210865	3300005295	Bacteria	1266
28	Ga0070658_10092025	3300005327	Bacteria	2500
29	Ga0070676_10023999	3300005328	Bacteria	3432
30	Ga0070690_100000584	3300005330	Bacteria	18375
31	Ga0070690_100074146	3300005330	Bacteria	2216
32	Ga0068869_100007469	3300005334	Bacteria	6991
33	Ga0068869_100366580	3300005334	Unclassified	1178
34	Ga0070666_10068974	3300005335	Bacteria	2403
35	Ga0070680_100010667	3300005336	Bacteria	7090
36	Ga0070682_100017000	3300005337	Bacteria	4236
37	Ga0068868_100002180	3300005338	Bacteria	13496
38	Ga0068868_100091546	3300005338	Unclassified	2450
39	Ga0070660_100029881	3300005339	Bacteria	4086
40	Ga0070689_100003146	3300005340	Bacteria	10917
41	Ga0070689_100538341	3300005340	Bacteria	1005
42	Ga0070691_10005825	3300005341	Bacteria	5622
43	Ga0070687_100000222	3300005343	Bacteria	19700
44	Ga0070687_100029484	3300005343	Bacteria	2673
45	Ga0070692_10005098	3300005345	Bacteria	5555
46	Ga0070692_10076035	3300005345	Bacteria	1799
47	Ga0070668_100013515	3300005347	Bacteria	6094
48	Ga0070668_100099594	3300005347	Bacteria	2301
49	Ga0070675_100004484	3300005354	Bacteria	10657
50	Ga0070675_100082241	3300005354	Bacteria	2686
51	Ga0070673_100261444	3300005364	Bacteria	1512
52	Ga0070673_100317509	3300005364	Unclassified	1375
53	Ga0070688_100205974	3300005365	Unclassified	1379
54	Ga0070688_100226913	3300005365	Bacteria	1319
55	Ga0070667_100069651	3300005367	Bacteria	2994
56	Ga0070714_100018052	3300005435	Bacteria	5722
57	Ga0070714_100057636	3300005435	Bacteria	3326
58	Ga0070714_100372199	3300005435	Bacteria	1345
59	Ga0070701_10000348	3300005438	Bacteria	15325
60	Ga0070701_10060865	3300005438	Bacteria	1989
61	Ga0070701_10176820	3300005438	Bacteria	1247
62	Ga0070705_100164912	3300005440	Bacteria	1485
63	Ga0070700_100000679	3300005441	Bacteria	16847
64	Ga0070700_100233793	3300005441	Unclassified	1310
65	Ga0070694_100001106	3300005444	Bacteria	15430
66	Ga0070694_100025059	3300005444	Bacteria	3856
67	Ga0070694_100032659	3300005444	Bacteria	3419
68	Ga0070694_100158471	3300005444	Bacteria	1659
69	Ga0070678_100177535	3300005456	Unclassified	1740
70	Ga0070681_10002398	3300005458	Bacteria	17121
71	Ga0068867_100000644	3300005459	Bacteria	23097
72	Ga0070698_100019829	3300005471	Bacteria	7053
73	Ga0070699_100019350	3300005518	Bacteria	5860
74	Ga0070679_100002719	3300005530	Bacteria	16112
75	Ga0070679_100011861	3300005530	Bacteria	8316
76	Ga0070679_100029053	3300005530	Bacteria	5454
77	Ga0070679_100257880	3300005530	Bacteria	1699
78	Ga0068853_100013424	3300005539	Bacteria	6686
79	Ga0068853_100538569	3300005539	Bacteria	1105
80	Ga0070686_100002108	3300005544	Bacteria	10972
81	Ga0070695_100000295	3300005545	Bacteria	25143
82	Ga0070696_100008109	3300005546	Bacteria	7022
83	Ga0070696_100008848	3300005546	Bacteria	6733
84	Ga0070696_100015222	3300005546	Bacteria	5164
85	Ga0070696_100029183	3300005546	Bacteria	3768
86	Ga0070693_100003050	3300005547	Bacteria	7771
87	Ga0070693_100187438	3300005547	Bacteria	1336
88	Ga0070665_100007724	3300005548	Bacteria	10919
89	Ga0070665_100414517	3300005548	Unclassified	1356
90	Ga0070704_100002131	3300005549	Bacteria	11015
91	Ga0070704_100003184	3300005549	Bacteria	9383
92	Ga0070704_100014264	3300005549	Bacteria	4959
93	Ga0070704_100104719	3300005549	Bacteria	2140
94	Ga0068855_100004930	3300005563	Bacteria	16279
95	Ga0068855_100005768	3300005563	Bacteria	15120
96	Ga0068855_100010360	3300005563	Bacteria	11245
97	Ga0068855_100167114	3300005563	Bacteria	2493
98	Ga0070664_100188265	3300005564	Unclassified	1838
99	Ga0068856_100033451	3300005614	Bacteria	5034
100	Ga0070702_100005398	3300005615	Bacteria	5948
101	Ga0070702_100020556	3300005615	Bacteria	3460
102	Ga0068859_100003501	3300005617	Bacteria	15988
103	Ga0068859_100020903	3300005617	Bacteria	6570
104	Ga0068864_100362683	3300005618	Bacteria	1370
105	Ga0068866_10136434	3300005718	Unclassified	1403
106	Ga0068861_100002258	3300005719	Bacteria	12519
107	Ga0068861_100180078	3300005719	Unclassified	1759
108	Ga0068851_10007590	3300005834	Bacteria	4986
109	Ga0068870_10139393	3300005840	Unclassified	1417
110	Ga0068870_10168438	3300005840	Bacteria	1305
111	Ga0068863_100105813	3300005841	Bacteria	2676
112	Ga0068863_100113981	3300005841	Bacteria	2575
113	Ga0068858_100007255	3300005842	Bacteria	10738
114	Ga0068858_100063281	3300005842	Bacteria	3423
115	Ga0068858_100142312	3300005842	Bacteria	2252
116	Ga0068860_100007630	3300005843	Bacteria	10824
117	Ga0068860_100036924	3300005843	Bacteria	4677
118	Ga0068860_100107583	3300005843	Bacteria	2665
119	Ga0068860_100174468	3300005843	Bacteria	2077
120	Ga0068862_100023239	3300005844	Bacteria	5193
121	Ga0068862_100070827	3300005844	Bacteria	3011
122	Ga0068862_100241197	3300005844	Unclassified	1643
123	Ga0068862_100425998	3300005844	Bacteria	1246
124	Ga0081539_10000276	3300005985	Bacteria	117151
125	Ga0070716_100211163	3300006173	Bacteria	1297
126	Ga0097621_100001291	3300006237	Bacteria	17227
127	Ga0097621_100527799	3300006237	Bacteria	1072
128	Ga0075370_10047340	3300006353	Bacteria	2435
129	Ga0068871_100007929	3300006358	Bacteria	7614
130	Ga0068871_100008482	3300006358	Bacteria	7392
131	Ga0075428_100001881	3300006844	Bacteria	22514
132	Ga0075428_100006936	3300006844	Bacteria	12581
133	Ga0075428_100463231	3300006844	Unclassified	1357
134	Ga0075430_100002741	3300006846	Bacteria	14712
135	Ga0075430_100015343	3300006846	Bacteria	6525
136	Ga0075430_100057793	3300006846	Bacteria	3262
137	Ga0075431_100000405	3300006847	Bacteria	34877
138	Ga0075431_100158764	3300006847	Bacteria	2326
139	Ga0075431_100407968	3300006847	Bacteria	1359
140	Ga0075433_10002082	3300006852	Bacteria	15128
141	Ga0075433_10005913	3300006852	Bacteria	9636
142	Ga0075433_10344596	3300006852	Bacteria	1317
143	Ga0075434_100000566	3300006871	Bacteria	28488
144	Ga0075434_100001188	3300006871	Bacteria	21590
145	Ga0075434_100181608	3300006871	Bacteria	2124
146	Ga0075429_100000663	3300006880	Bacteria	26620
147	Ga0075429_100246578	3300006880	Bacteria	1564
148	Ga0068865_100002791	3300006881	Bacteria	10376
149	Ga0075436_100000075	3300006914	Bacteria	59554
150	Ga0075436_100000111	3300006914	Bacteria	47863
151	Ga0075436_100003489	3300006914	Bacteria	10787
152	Ga0097620_100003501	3300006931	Bacteria	15988
153	Ga0097620_100020903	3300006931	Bacteria	6570
154	Ga0075435_100000249	3300007076	Bacteria	33358
155	Ga0075435_100001823	3300007076	Bacteria	13853
156	Ga0105240_10005247	3300009093	Bacteria	19351
157	Ga0105240_10333180	3300009093	Bacteria	1726
158	Ga0105240_10496623	3300009093	Bacteria	1358
159	Ga0111539_10005717	3300009094	Bacteria	16081
160	Ga0111539_10013734	3300009094	Bacteria	10118
161	Ga0111539_10017049	3300009094	Bacteria	8990
162	Ga0111539_10026655	3300009094	Bacteria	7065
163	Ga0111539_10053928	3300009094	Unclassified	4786
164	Ga0111539_10158456	3300009094	Bacteria	2648
165	Ga0111539_10163310	3300009094	Bacteria	2605
166	Ga0111539_10264095	3300009094	Bacteria	2004
167	Ga0111539_10335304	3300009094	Unclassified	1760
168	Ga0111539_10393011	3300009094	Unclassified	1615
169	Ga0105245_10001445	3300009098	Bacteria	21558
170	Ga0105245_10449146	3300009098	Unclassified	1297
171	Ga0114129_10009868	3300009147	Bacteria	13611
172	Ga0105243_10005409	3300009148	Bacteria	9964
173	Ga0105243_10427601	3300009148	Unclassified	1237
174	Ga0105242_10005658	3300009176	Bacteria	9646
175	Ga0105242_10069743	3300009176	Unclassified	2912
176	Ga0105242_10154982	3300009176	Bacteria	2001
177	Ga0105249_10017839	3300009553	Bacteria	6306
178	Ga0105249_10093695	3300009553	Bacteria	2814
179	Ga0105239_10382881	3300010375	Bacteria	1590
180	Ga0105246_10089814	3300011119	Bacteria	2211
181	Ga0157370_10002017	3300013104	Bacteria	24951
182	Ga0157370_10223592	3300013104	Bacteria	1743
183	Ga0157374_10070746	3300013296	Bacteria	3288
184	Ga0157378_10001797	3300013297	Bacteria	19262
185	Ga0157378_10054016	3300013297	Bacteria	3577
186	Ga0163162_10632375	3300013306	Bacteria	1195
187	Ga0157372_10005636	3300013307	Bacteria	13313
188	Ga0157375_10267244	3300013308	Bacteria	1872
189	Ga0157375_10632066	3300013308	Bacteria	1228
190	Ga0163163_10368208	3300014325	Unclassified	1494
191	Ga0157380_10178217	3300014326	Bacteria	1865
192	Ga0157380_10235271	3300014326	Bacteria	1648
193	Ga0157380_10296232	3300014326	Bacteria	1488
194	Ga0182008_10001446	3300014497	Bacteria	15868
195	Ga0157379_10192415	3300014968	Bacteria	1843
196	Ga0157379_10344290	3300014968	Bacteria	1364
197	Ga0157376_10000791	3300014969	Bacteria	20705
198	Ga0157376_10217984	3300014969	Bacteria	1766
199	Ga0163161_10101892	3300017792	Bacteria	2138
200	Ga0163161_10261551	3300017792	Bacteria	1351
201	Ga0209672_105877	3300025228	Bacteria	2059
202	Ga0209147_100449	3300025229	Bacteria	25874
203	Ga0209258_100015	3300025242	Bacteria	706310
204	Ga0207425_1000958	3300025245	Bacteria	13588
205	Ga0209148_1000028	3300025254	Bacteria	582773
206	Ga0209129_1000661	3300025258	Bacteria	22935
207	Ga0209565_1000263	3300025263	Bacteria	55261
208	Ga0209673_1000396	3300025273	Bacteria	77797
209	Ga0209130_1000687	3300025284	Bacteria	30541
210	Ga0209675_1000206	3300025291	Bacteria	62446
211	Ga0209675_1003694	3300025291	Bacteria	7138
212	Ga0209676_1006816	3300025292	Bacteria	5538
213	Ga0209025_1000410	3300025294	Bacteria	86076
214	Ga0209025_1001143	3300025294	Bacteria	37800
215	Ga0209564_1000110	3300025295	Bacteria	212842
216	Ga0209758_1000039	3300025297	Bacteria	428951
217	Ga0209050_1009475	3300025298	Bacteria	4976
218	Ga0209256_1000074	3300025299	Bacteria	236893
219	Ga0207426_1000121	3300025302	Bacteria	219007
220	Ga0209257_1008333	3300025304	Bacteria	5930
221	Ga0207697_10040338	3300025315	Bacteria	1917
222	Ga0207697_10064829	3300025315	Bacteria	1524
223	Ga0207656_10047339	3300025321	Bacteria	1848
224	Ga0207682_10000987	3300025893	Bacteria	13141
225	Ga0207688_10064403	3300025901	Bacteria	2070
226	Ga0207688_10100007	3300025901	Bacteria	1674
227	Ga0207643_10065283	3300025908	Bacteria	2084
228	Ga0207643_10093575	3300025908	Unclassified	1755
229	Ga0207707_10004636	3300025912	Bacteria	12071
230	Ga0207707_10097781	3300025912	Bacteria	2566
231	Ga0207660_10056667	3300025917	Bacteria	2804
232	Ga0207662_10000643	3300025918	Bacteria	15753
233	Ga0207662_10047805	3300025918	Bacteria	2534
234	Ga0207657_10026585	3300025919	Bacteria	5314
235	Ga0207652_10016590	3300025921	Bacteria	6016
236	Ga0207652_10023585	3300025921	Bacteria	5098
237	Ga0207652_10254555	3300025921	Bacteria	1584
238	Ga0207650_10016490	3300025925	Bacteria	5166
239	Ga0207659_10008287	3300025926	Bacteria	6443
240	Ga0207659_10110591	3300025926	Unclassified	2088
241	Ga0207687_10205518	3300025927	Bacteria	1542
242	Ga0207664_10031686	3300025929	Bacteria	4047
243	Ga0207664_10173395	3300025929	Bacteria	1847
244	Ga0207706_10037607	3300025933	Bacteria	4296
245	Ga0207686_10003591	3300025934	Bacteria	8313
246	Ga0207709_10002014	3300025935	Bacteria	13186
247	Ga0207670_10024999	3300025936	Bacteria	3742
248	Ga0207670_10224303	3300025936	Unclassified	1440
249	Ga0207670_10381532	3300025936	Bacteria	1123
250	Ga0207704_10007180	3300025938	Bacteria	5245
251	Ga0207691_10140970	3300025940	Unclassified	2125
252	Ga0207689_10007368	3300025942	Bacteria	9647
253	Ga0207689_10211352	3300025942	Unclassified	1603
254	Ga0207679_10050498	3300025945	Bacteria	3040
255	Ga0207667_10006675	3300025949	Bacteria	13953
256	Ga0207667_10010861	3300025949	Bacteria	10618
257	Ga0207667_10176980	3300025949	Bacteria	2191
258	Ga0207712_10029585	3300025961	Bacteria	3676
259	Ga0207668_10007950	3300025972	Bacteria	6310
260	Ga0207668_10032861	3300025972	Bacteria	3434
261	Ga0207640_10010403	3300025981	Bacteria	5242
262	Ga0207658_10050785	3300025986	Bacteria	3053
263	Ga0207677_10002863	3300026023	Bacteria	9103
264	Ga0207703_10043991	3300026035	Bacteria	3586
265	Ga0207703_10048270	3300026035	Bacteria	3436
266	Ga0207703_10056163	3300026035	Bacteria	3205
267	Ga0207639_10016001	3300026041	Bacteria	5297
268	Ga0207639_10482789	3300026041	Bacteria	1130
269	Ga0207678_10249306	3300026067	Unclassified	1521
270	Ga0207708_10004329	3300026075	Bacteria	10456
271	Ga0207708_10010547	3300026075	Bacteria	6859
272	Ga0207708_10052891	3300026075	Bacteria	3093
273	Ga0207702_10095435	3300026078	Bacteria	2613
274	Ga0207702_10199467	3300026078	Bacteria	1854
275	Ga0207702_10242290	3300026078	Bacteria	1690
276	Ga0207641_10138292	3300026088	Unclassified	2194
277	Ga0207648_10006731	3300026089	Bacteria	11399
278	Ga0207648_10012306	3300026089	Bacteria	8012
279	Ga0207676_10294143	3300026095	Bacteria	1480
280	Ga0207674_10132044	3300026116	Bacteria	2460
281	Ga0207675_100008518	3300026118	Bacteria	9646
282	Ga0207683_10080482	3300026121	Bacteria	2890
283	Ga0207683_10140891	3300026121	Bacteria	2173
284	Ga0207698_10104606	3300026142	Bacteria	2356
285	Ga0207428_10007868	3300027907	Bacteria	9695
286	Ga0207428_10028730	3300027907	Bacteria	4617
287	Ga0207428_10060728	3300027907	Bacteria	2994
288	Ga0207428_10130153	3300027907	Bacteria	1926
289	Ga0207428_10157183	3300027907	Bacteria	1728
290	Ga0268266_10010272	3300028379	Bacteria	8196
291	Ga0268265_10056796	3300028380	Bacteria	2980
292	Ga0268265_10186619	3300028380	Bacteria	1787
293	Ga0268264_10003700	3300028381	Bacteria	13128
294	Ga0307515_10000215	3300028794	Bacteria	142594
295	Ga0307515_10000438	3300028794	Bacteria	99963
296	Ga0307515_10070567	3300028794	Bacteria	4752
297	Ga0265331_10023907	3300031250	Bacteria	3098
298	Ga0307513_10159636	3300031456	Bacteria	2149
299	Ga0307413_10106410	3300031824	Bacteria	1867
300	Ga0307410_10273647	3300031852	Bacteria	1322
301	Ga0307410_10277819	3300031852	Bacteria	1313
302	Ga0307416_100550273	3300032002	Bacteria	1227
303	Ga0307414_10461815	3300032004	Bacteria	1116
304	Ga0307411_10144398	3300032005	Bacteria	1759
305	Ga0307415_100105313	3300032126	Bacteria	2080
306	Ga0307415_100144066	3300032126	Bacteria	1824
307	Ga0373930_0021313	3300034816	Bacteria	1271
308	Ga0373926_0000256	3300035083	Bacteria	12777
309	Ga0373926_0000442	3300035083	Bacteria	10795
310	Ga0373926_0013499	3300035083	Bacteria	2772
311	Ga0373929_0011322	3300035085	Bacteria	1680
312	Ga0373944_0001182	3300035089	Bacteria	6515
313	Ga0373949_0003425	3300035090	Bacteria	3780
314	Ga0373952_0006849	3300035092	Bacteria	2121
315	Ga0373923_0033418	3300035111	Bacteria	2083
316	Ga0373923_0137706	3300035111	Bacteria	1102
317	Ga0373932_0029371	3300035112	Bacteria	1517
318	Ga0373936_0000304	3300035113	Bacteria	16506
319	Ga0373939_0002090	3300035114	Bacteria	4758
320	Ga0373941_0005546	3300035115	Bacteria	2976
321	Ga0373941_0008413	3300035115	Bacteria	2560
322	Ga0373945_0002476	3300035116	Bacteria	5791
323	Ga0373945_0035665	3300035116	Bacteria	1778
324	Ga0373960_0047381	3300035121	Bacteria	1264
325	Ga0373943_0000331	3300035170	Bacteria	19768
326	Ga0373943_0011834	3300035170	Bacteria	3925
327	Ga0373943_0088803	3300035170	Bacteria	1597
328	Ga0373943_0126470	3300035170	Bacteria	1363
329	Ga0373946_0008934	3300035171	Bacteria	3683
330	Ga0373946_0021992	3300035171	Bacteria	2478
331	Ga0373942_0001503	3300035207	Bacteria	5992
332	Ga0373931_0002339	3300035691	Bacteria	8367
333	Ga0373927_0005946	3300035695	Bacteria	8355
334	Ga0373927_0097753	3300035695	Bacteria	1908
335	Ga0373947_0005911	3300035725	Bacteria	7130
336	Ga0373947_0023292	3300035725	Bacteria	3600
337	Ga0373947_0041301	3300035725	Bacteria	2749
338	Ga0373925_0003844	3300037068	Bacteria	11505
339	Ga0373925_0011972	3300037068	Bacteria	6278
340	Ga0373925_0076060	3300037068	Bacteria	2545
341	Ga0395900_0033035	3300037418	Bacteria	5325
342	Ga0395898_0022609	3300037466	Bacteria	6367
343	Ga0395905_0000138	3300037471	Bacteria	120373
344	Ga0395905_0023595	3300037471	Bacteria	5811
345	Ga0395905_0033997	3300037471	Bacteria	4788
346	Ga0395905_0161158	3300037471	Bacteria	2108
347	Ga0436364_0762709	3300037853	Bacteria	2008
348	Ga0395901_0079560	3300038443	Bacteria	3423
349	Ga0395901_0084645	3300038443	Bacteria	3314
350	Ga0466964_0137434	3300044706	Bacteria	1119
351	Ga0451576_0068722	3300045051	Bacteria	3686
352	Ga0466958_0169016	3300045836	Bacteria	1384
353	Ga0466967_0121007	3300045976	Bacteria	2418
354	Ga0495603_0000417	3300046455	Bacteria	23550
355	Ga0495603_0048157	3300046455	Bacteria	2538
356	Ga0495629_0291074	3300046459	Bacteria	1119
357	Ga0495653_0079355	3300046463	Bacteria	2431
358	Ga0495580_0000432	3300046472	Bacteria	34580
359	Ga0495580_0189356	3300046472	Bacteria	1419
360	Ga0495639_0008001	3300046475	Bacteria	4541
361	Ga0495639_0125313	3300046475	Bacteria	1227
362	Ga0495662_0008541	3300046476	Bacteria	5032
363	Ga0495664_0001222	3300046477	Bacteria	13449
364	Ga0495584_0077975	3300046491	Bacteria	1667
365	Ga0495594_0040111	3300046499	Bacteria	2561
366	Ga0495594_0133513	3300046499	Bacteria	1406
367	Ga0495618_0003009	3300046514	Bacteria	10652
368	Ga0495630_0020835	3300046517	Bacteria	4839
369	Ga0495630_0087967	3300046517	Bacteria	2346
370	Ga0495666_0011237	3300046526	Bacteria	4466
371	Ga0495666_0031619	3300046526	Bacteria	2593
372	Ga0495642_0110809	3300046528	Unclassified	1173
373	Ga0495642_0124811	3300046528	Bacteria	1106
374	Ga0495652_0106338	3300046529	Bacteria	2266
375	Ga0495654_0000729	3300046530	Bacteria	25617
376	Ga0495665_0039289	3300046531	Bacteria	2521
377	Ga0495665_0064292	3300046531	Bacteria	1936
378	Ga0495640_0001938	3300046533	Bacteria	16498
379	Ga0495586_0005953	3300046535	Bacteria	6526
380	Ga0495598_0012076	3300046537	Bacteria	2109
381	Ga0495609_0000849	3300046538	Bacteria	22538
382	Ga0495621_0011758	3300046539	Bacteria	2718
383	Ga0495621_0013409	3300046539	Bacteria	2574
384	Ga0495621_0033871	3300046539	Bacteria	1763
385	Ga0495645_0039283	3300046543	Bacteria	3452
386	Ga0495656_0009700	3300046615	Bacteria	3472
387	Ga0495656_0051581	3300046615	Bacteria	1761
388	Ga0495634_0025886	3300046642	Bacteria	4097
389	Ga0495635_0010940	3300046663	Bacteria	6362
390	Ga0495661_0002485	3300046665	Bacteria	14179
391	Ga0495588_0004518	3300046674	Bacteria	6152
392	Ga0495647_0000318	3300046681	Bacteria	13555
393	Ga0495647_0000748	3300046681	Bacteria	9643
394	Ga0495658_0001664	3300046683	Bacteria	11561
395	Ga0495658_0004535	3300046683	Bacteria	6828
396	Ga0495669_0073961	3300046684	Unclassified	1557
397	Ga0495624_0021885	3300046690	Bacteria	4235
398	Ga0495581_0009000	3300047315	Bacteria	5779
399	Ga0495636_0039486	3300047318	Bacteria	1955
400	Ga0495674_0055795	3300047319	Bacteria	3463
401	Ga0495676_0034557	3300047321	Bacteria	4240
402	Ga0495684_0007891	3300047471	Bacteria	8234
403	Ga0495684_0165120	3300047471	Bacteria	1650
404	Ga0495593_0137694	3300047673	Bacteria	1237
405	Ga0496108_0191497	3300048911	Unclassified	1773
406	Ga0496110_0278630	3300048913	Unclassified	1523
407	Ga0496116_0029183	3300048919	Bacteria	3981
408	Ga0496117_0008726	3300048920	Bacteria	9577
409	Ga0496117_0039488	3300048920	Bacteria	3483
410	Ga0496118_0007686	3300048921	Bacteria	11337
411	Ga0496121_0001862	3300048924	Bacteria	33856
412	Ga0496121_0060245	3300048924	Bacteria	3123
413	Ga0496123_0030308	3300048926	Bacteria	3962
414	Ga0496123_0049240	3300048926	Bacteria	2827
415	Ga0496125_0010738	3300048928	Bacteria	9224
416	Ga0496125_0031080	3300048928	Bacteria	4765
417	Ga0496125_0035562	3300048928	Bacteria	4365
418	Ga0496125_0035615	3300048928	Bacteria	4361
419	Ga0496126_0321806	3300048929	Bacteria	1271
420	Ga0501070_0180679	3300049586	Bacteria	1736
421	nmdc:mga07m45_47479_c1	3300050496	Bacteria	2414
422	nmdc:mga05p37_14146_c1	3300050507	Bacteria	9577
423	nmdc:mga09592_124663_c1	3300050508	Bacteria	2214
424	nmdc:mga09592_185322_c1	3300050508	Bacteria	1801
425	nmdc:mga09592_3688_c1	3300050508	Bacteria	12347
426	nmdc:mga0qj67_151019_c1	3300050509	Bacteria	1885
427	nmdc:mga0qj67_222482_c1	3300050509	Bacteria	1532
428	nmdc:mga06r32_145313_c1	3300050510	Bacteria	2349
429	nmdc:mga06r32_20088_c1	3300050510	Bacteria	6143
430	nmdc:mga08y16_176148_c1	3300050511	Bacteria	2221
431	nmdc:mga08y16_2344_c1	3300050511	Bacteria	19402
432	nmdc:mga08y16_28984_c1	3300050511	Bacteria	5835
433	nmdc:mga08y16_3077_c1	3300050511	Bacteria	17246
434	nmdc:mga08y16_3602_c1	3300050511	Bacteria	16080
435	nmdc:mga08y16_397953_c1	3300050511	Unclassified	1410
436	nmdc:mga08y16_43754_c1	3300050511	Unclassified	4693
437	nmdc:mga08y16_77239_c1	3300050511	Bacteria	3472
438	nmdc:mga0n895_256228_c1	3300050512	Bacteria	1775
439	nmdc:mga0rr50_652_c1	3300050513	Bacteria	18640
440	nmdc:mga08x19_108805_c1	3300050514	Bacteria	1847
441	nmdc:mga08x19_1105_c1	3300050514	Bacteria	16812
442	nmdc:mga08x19_51729_c1	3300050514	Bacteria	2640
443	nmdc:mga08x19_915_c1	3300050514	Bacteria	18639
444	nmdc:mga0a205_1519_c1	3300050515	Bacteria	19827
445	nmdc:mga0a205_399556_c1	3300050515	Bacteria	1238
446	nmdc:mga0a205_4880_c1	3300050515	Bacteria	12067
447	Ga0495601_0003403	3300053077	Bacteria	9120
448	Ga0495612_0005697	3300053078	Bacteria	5144
449	Ga0495619_0004910	3300053085	Bacteria	8490
450	Ga0500644_0070214	3300053088	Bacteria	1260
451	Ga0500562_003677	3300053108	Bacteria	3852
452	Ga0500626_003882	3300053128	Bacteria	5562
453	Ga0500559_0001540	3300053136	Bacteria	12904
454	Ga0500574_016401	3300053141	Bacteria	1789
455	Ga0500616_0052711	3300053153	Bacteria	2138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005546	Ga0070696_100029183	Ga0070696_1000291832	262
2	3300009094	Ga0111539_10158456	Ga0111539_101584563	292
3	3300046539	Ga0495621_0011758	Ga0495621_0011758_843_1775	294
4	3300046615	Ga0495656_0051581	Ga0495656_0051581_493_1524	294
5	3300005438	Ga0070701_10176820	Ga0070701_101768201	295
6	3300009176	Ga0105242_10154982	Ga0105242_101549821	295
7	3300048929	Ga0496126_0321806	Ga0496126_0321806_132_1130	295
8	3300005340	Ga0070689_100538341	Ga0070689_1005383411	298
9	3300009094	Ga0111539_10264095	Ga0111539_102640952	298
10	3300026121	Ga0207683_10140891	Ga0207683_101408912	298
11	3300027907	Ga0207428_10130153	Ga0207428_101301532	298
12	3300028380	Ga0268265_10056796	Ga0268265_100567963	298
13	3300035092	Ga0373952_0006849	Ga0373952_0006849_770_1672	298
14	3300035115	Ga0373941_0005546	Ga0373941_0005546_564_1466	298
15	3300050511	nmdc:mga08y16_77239_c1	nmdc:mga08y16_77239_c1_651_1598	298
16	3300005354	Ga0070675_100082241	Ga0070675_1000822411	299
17	3300031250	Ga0265331_10023907	Ga0265331_100239072	300
18	3300025918	Ga0207662_10047805	Ga0207662_100478053	301
19	3300046491	Ga0495584_0077975	Ga0495584_0077975_219_1181	301
20	3300046539	Ga0495621_0033871	Ga0495621_0033871_18_980	301
21	3300003320	rootH2_10052291	rootH2_100522912	302
22	3300037853	Ga0436364_0762709	Ga0436364_0762709_672_1628	302
23	3300014326	Ga0157380_10235271	Ga0157380_102352712	305
24	3300046528	Ga0495642_0110809	Ga0495642_0110809_15_947	308
25	3300046684	Ga0495669_0073961	Ga0495669_0073961_13_945	308
26	3300003316	rootH1_10065880	rootH1_100658802	311
27	3300003323	rootH1_10020868	rootH1_100208683	311
28	3300003761	Ga0055535_1000133	Ga0055535_100013314	311
29	3300003762	Ga0055542_1000003	Ga0055542_1000003434	311
30	3300005444	Ga0070694_100025059	Ga0070694_1000250593	311
31	3300005549	Ga0070704_100003184	Ga0070704_1000031841	311
32	3300005834	Ga0068851_10007590	Ga0068851_100075905	311
33	3300006353	Ga0075370_10047340	Ga0075370_100473402	311
34	3300013297	Ga0157378_10054016	Ga0157378_100540164	311
35	3300013307	Ga0157372_10005636	Ga0157372_100056364	311
36	3300025228	Ga0209672_105877	Ga0209672_1058772	311
37	3300025229	Ga0209147_100449	Ga0209147_10044916	311
38	3300025242	Ga0209258_100015	Ga0209258_100015554	311
39	3300025254	Ga0209148_1000028	Ga0209148_1000028115	311
40	3300025291	Ga0209675_1003694	Ga0209675_10036942	311
41	3300025292	Ga0209676_1006816	Ga0209676_10068166	311
42	3300025298	Ga0209050_1009475	Ga0209050_10094752	311
43	3300025321	Ga0207656_10047339	Ga0207656_100473391	311
44	3300048919	Ga0496116_0029183	Ga0496116_0029183_2345_3325	311
45	3300048920	Ga0496117_0039488	Ga0496117_0039488_1782_2762	311
46	3300048924	Ga0496121_0060245	Ga0496121_0060245_440_1420	311
47	3300048926	Ga0496123_0030308	Ga0496123_0030308_2715_3695	311
48	3300048926	Ga0496123_0049240	Ga0496123_0049240_1264_2244	311
49	3300050496	nmdc:mga07m45_47479_c1	nmdc:mga07m45_47479_c1_288_1268	311
50	3300053128	Ga0500626_003882	Ga0500626_003882_605_1585	311
51	3300053136	Ga0500559_0001540	Ga0500559_0001540_10509_11489	311
52	3300053141	Ga0500574_016401	Ga0500574_016401_366_1346	311
53	3300006846	Ga0075430_100002741	Ga0075430_10000274115	312
54	3300009094	Ga0111539_10005717	Ga0111539_100057171	312
55	3300050508	nmdc:mga09592_185322_c1	nmdc:mga09592_185322_c1_140_1084	312
56	3300050511	nmdc:mga08y16_2344_c1	nmdc:mga08y16_2344_c1_3437_4381	312
57	3300035083	Ga0373926_0000256	Ga0373926_0000256_1789_2736	313
58	3300035089	Ga0373944_0001182	Ga0373944_0001182_4833_5780	313
59	3300035113	Ga0373936_0000304	Ga0373936_0000304_10361_11308	313
60	3300035116	Ga0373945_0002476	Ga0373945_0002476_4580_5527	313
61	3300035170	Ga0373943_0000331	Ga0373943_0000331_17045_17992	313
62	3300035171	Ga0373946_0008934	Ga0373946_0008934_2378_3325	313
63	3300035695	Ga0373927_0005946	Ga0373927_0005946_6922_7869	313
64	3300035725	Ga0373947_0023292	Ga0373947_0023292_877_1824	313
65	3300037068	Ga0373925_0011972	Ga0373925_0011972_298_1245	313
66	3300046455	Ga0495603_0000417	Ga0495603_0000417_16416_17363	313
67	3300046499	Ga0495594_0040111	Ga0495594_0040111_1222_2169	313
68	3300046531	Ga0495665_0039289	Ga0495665_0039289_495_1442	313
69	3300046535	Ga0495586_0005953	Ga0495586_0005953_1446_2393	313
70	3300046674	Ga0495588_0004518	Ga0495588_0004518_66_1013	313
71	3300046681	Ga0495647_0000318	Ga0495647_0000318_9307_10254	313
72	3300046683	Ga0495658_0001664	Ga0495658_0001664_8600_9547	313
73	3300047315	Ga0495581_0009000	Ga0495581_0009000_4341_5288	313
74	3300047321	Ga0495676_0034557	Ga0495676_0034557_1966_2913	313
75	3300005330	Ga0070690_100074146	Ga0070690_1000741462	314
76	3300005546	Ga0070696_100008848	Ga0070696_1000088486	314
77	3300005547	Ga0070693_100187438	Ga0070693_1001874382	314
78	3300005618	Ga0068864_100362683	Ga0068864_1003626832	314
79	3300005842	Ga0068858_100063281	Ga0068858_1000632814	314
80	3300006852	Ga0075433_10002082	Ga0075433_100020823	314
81	3300006871	Ga0075434_100001188	Ga0075434_10000118819	314
82	3300006914	Ga0075436_100000075	Ga0075436_10000007522	314
83	3300006914	Ga0075436_100000111	Ga0075436_1000001114	314
84	3300007076	Ga0075435_100001823	Ga0075435_10000182314	314
85	3300009094	Ga0111539_10026655	Ga0111539_100266554	314
86	3300025936	Ga0207670_10024999	Ga0207670_100249995	314
87	3300026035	Ga0207703_10043991	Ga0207703_100439914	314
88	3300028380	Ga0268265_10186619	Ga0268265_101866192	314
89	3300050511	nmdc:mga08y16_3602_c1	nmdc:mga08y16_3602_c1_4854_5804	314
90	3300050514	nmdc:mga08x19_1105_c1	nmdc:mga08x19_1105_c1_15296_16246	314
91	3300050514	nmdc:mga08x19_51729_c1	nmdc:mga08x19_51729_c1_1571_2524	314
92	3300050515	nmdc:mga0a205_1519_c1	nmdc:mga0a205_1519_c1_6029_6979	314
93	3300006871	Ga0075434_100181608	Ga0075434_1001816082	315
94	3300044706	Ga0466964_0137434	Ga0466964_0137434_132_1088	315
95	3300045836	Ga0466958_0169016	Ga0466958_0169016_307_1263	315
96	3300045976	Ga0466967_0121007	Ga0466967_0121007_285_1241	315
97	3300046475	Ga0495639_0125313	Ga0495639_0125313_109_1062	315
98	3300046531	Ga0495665_0064292	Ga0495665_0064292_136_1089	315
99	3300046642	Ga0495634_0025886	Ga0495634_0025886_594_1547	315
100	3300050512	nmdc:mga0n895_256228_c1	nmdc:mga0n895_256228_c1_332_1288	315
101	3300005290	Ga0065712_10010825	Ga0065712_100108252	316
102	3300005335	Ga0070666_10068974	Ga0070666_100689742	316
103	3300005338	Ga0068868_100091546	Ga0068868_1000915462	316
104	3300005347	Ga0070668_100099594	Ga0070668_1000995942	316
105	3300005365	Ga0070688_100205974	Ga0070688_1002059742	316
106	3300005438	Ga0070701_10060865	Ga0070701_100608652	316
107	3300005441	Ga0070700_100233793	Ga0070700_1002337932	316
108	3300005456	Ga0070678_100177535	Ga0070678_1001775352	316
109	3300005458	Ga0070681_10002398	Ga0070681_1000239814	316
110	3300005530	Ga0070679_100257880	Ga0070679_1002578802	316
111	3300005548	Ga0070665_100414517	Ga0070665_1004145172	316
112	3300005615	Ga0070702_100020556	Ga0070702_1000205562	316
113	3300005718	Ga0068866_10136434	Ga0068866_101364341	316
114	3300005719	Ga0068861_100180078	Ga0068861_1001800782	316
115	3300005844	Ga0068862_100241197	Ga0068862_1002411972	316
116	3300005985	Ga0081539_10000276	Ga0081539_10000276112	316
117	3300006358	Ga0068871_100008482	Ga0068871_1000084822	316
118	3300009094	Ga0111539_10335304	Ga0111539_103353042	316
119	3300009098	Ga0105245_10449146	Ga0105245_104491461	316
120	3300009148	Ga0105243_10427601	Ga0105243_104276012	316
121	3300009176	Ga0105242_10069743	Ga0105242_100697433	316
122	3300014968	Ga0157379_10192415	Ga0157379_101924151	316
123	3300017792	Ga0163161_10101892	Ga0163161_101018923	316
124	3300025315	Ga0207697_10040338	Ga0207697_100403381	316
125	3300025893	Ga0207682_10000987	Ga0207682_100009878	316
126	3300025901	Ga0207688_10064403	Ga0207688_100644031	316
127	3300025908	Ga0207643_10093575	Ga0207643_100935752	316
128	3300025912	Ga0207707_10004636	Ga0207707_100046366	316
129	3300025921	Ga0207652_10254555	Ga0207652_102545551	316
130	3300025926	Ga0207659_10110591	Ga0207659_101105912	316
131	3300025933	Ga0207706_10037607	Ga0207706_100376072	316
132	3300025936	Ga0207670_10224303	Ga0207670_102243031	316
133	3300025972	Ga0207668_10032861	Ga0207668_100328613	316
134	3300026067	Ga0207678_10249306	Ga0207678_102493062	316
135	3300026075	Ga0207708_10010547	Ga0207708_100105474	316
136	3300026088	Ga0207641_10138292	Ga0207641_101382922	316
137	3300026089	Ga0207648_10012306	Ga0207648_100123067	316
138	3300035083	Ga0373926_0013499	Ga0373926_0013499_1525_2487	316
139	3300035111	Ga0373923_0137706	Ga0373923_0137706_40_996	316
140	3300035116	Ga0373945_0035665	Ga0373945_0035665_27_989	316
141	3300035170	Ga0373943_0088803	Ga0373943_0088803_322_1284	316
142	3300035170	Ga0373943_0126470	Ga0373943_0126470_71_1027	316
143	3300035171	Ga0373946_0021992	Ga0373946_0021992_313_1275	316
144	3300035695	Ga0373927_0097753	Ga0373927_0097753_407_1369	316
145	3300035725	Ga0373947_0005911	Ga0373947_0005911_5148_6110	316
146	3300037068	Ga0373925_0003844	Ga0373925_0003844_279_1241	316
147	3300037068	Ga0373925_0076060	Ga0373925_0076060_25_981	316
148	3300046459	Ga0495629_0291074	Ga0495629_0291074_26_988	316
149	3300046463	Ga0495653_0079355	Ga0495653_0079355_1043_1999	316
150	3300046472	Ga0495580_0189356	Ga0495580_0189356_291_1253	316
151	3300046476	Ga0495662_0008541	Ga0495662_0008541_337_1293	316
152	3300046477	Ga0495664_0001222	Ga0495664_0001222_12403_13359	316
153	3300046514	Ga0495618_0003009	Ga0495618_0003009_4155_5111	316
154	3300046517	Ga0495630_0020835	Ga0495630_0020835_2516_3472	316
155	3300046517	Ga0495630_0087967	Ga0495630_0087967_324_1286	316
156	3300046526	Ga0495666_0031619	Ga0495666_0031619_1584_2540	316
157	3300046529	Ga0495652_0106338	Ga0495652_0106338_456_1412	316
158	3300046533	Ga0495640_0001938	Ga0495640_0001938_15438_16394	316
159	3300046543	Ga0495645_0039283	Ga0495645_0039283_2356_3312	316
160	3300046663	Ga0495635_0010940	Ga0495635_0010940_3772_4728	316
161	3300046690	Ga0495624_0021885	Ga0495624_0021885_1467_2429	316
162	3300047319	Ga0495674_0055795	Ga0495674_0055795_1732_2688	316
163	3300047471	Ga0495684_0007891	Ga0495684_0007891_2021_2977	316
164	3300047471	Ga0495684_0165120	Ga0495684_0165120_278_1240	316
165	3300047673	Ga0495593_0137694	Ga0495593_0137694_83_1045	316
166	3300050511	nmdc:mga08y16_397953_c1	nmdc:mga08y16_397953_c1_141_1133	316
167	3300053077	Ga0495601_0003403	Ga0495601_0003403_832_1788	316
168	3300053078	Ga0495612_0005697	Ga0495612_0005697_805_1761	316
169	3300053085	Ga0495619_0004910	Ga0495619_0004910_2305_3261	316
170	iso_pu_bacteria	2842775625	2842776452	316
171	3300005328	Ga0070676_10023999	Ga0070676_100239992	317
172	3300005435	Ga0070714_100018052	Ga0070714_1000180525	317
173	3300005563	Ga0068855_100005768	Ga0068855_10000576818	317
174	3300005844	Ga0068862_100425998	Ga0068862_1004259981	317
175	3300006844	Ga0075428_100463231	Ga0075428_1004632312	317
176	3300009093	Ga0105240_10005247	Ga0105240_100052476	317
177	3300009094	Ga0111539_10053928	Ga0111539_100539286	317
178	3300013306	Ga0163162_10632375	Ga0163162_106323751	317
179	3300013308	Ga0157375_10267244	Ga0157375_102672442	317
180	3300014326	Ga0157380_10296232	Ga0157380_102962321	317
181	3300014969	Ga0157376_10217984	Ga0157376_102179841	317
182	3300025315	Ga0207697_10064829	Ga0207697_100648291	317
183	3300025929	Ga0207664_10031686	Ga0207664_100316864	317
184	3300025949	Ga0207667_10176980	Ga0207667_101769802	317
185	3300026078	Ga0207702_10199467	Ga0207702_101994672	317
186	3300027907	Ga0207428_10060728	Ga0207428_100607283	317
187	3300037418	Ga0395900_0033035	Ga0395900_0033035_216_1184	317
188	3300037466	Ga0395898_0022609	Ga0395898_0022609_521_1489	317
189	3300048913	Ga0496110_0278630	Ga0496110_0278630_485_1468	317
190	3300050511	nmdc:mga08y16_43754_c1	nmdc:mga08y16_43754_c1_334_1314	317
191	3300050515	nmdc:mga0a205_399556_c1	nmdc:mga0a205_399556_c1_69_1037	317
192	iso_pu_bacteria	2816332133	2816470623	317
193	3300005330	Ga0070690_100000584	Ga0070690_10000058410	318
194	3300005334	Ga0068869_100007469	Ga0068869_1000074694	318
195	3300005336	Ga0070680_100010667	Ga0070680_1000106673	318
196	3300005337	Ga0070682_100017000	Ga0070682_1000170001	318
197	3300005338	Ga0068868_100002180	Ga0068868_10000218014	318
198	3300005340	Ga0070689_100003146	Ga0070689_10000314611	318
199	3300005341	Ga0070691_10005825	Ga0070691_100058251	318
200	3300005343	Ga0070687_100000222	Ga0070687_1000002223	318
201	3300005345	Ga0070692_10005098	Ga0070692_100050985	318
202	3300005347	Ga0070668_100013515	Ga0070668_1000135155	318
203	3300005354	Ga0070675_100004484	Ga0070675_1000044847	318
204	3300005364	Ga0070673_100261444	Ga0070673_1002614442	318
205	3300005367	Ga0070667_100069651	Ga0070667_1000696513	318
206	3300005435	Ga0070714_100057636	Ga0070714_1000576361	318
207	3300005438	Ga0070701_10000348	Ga0070701_100003484	318
208	3300005441	Ga0070700_100000679	Ga0070700_10000067914	318
209	3300005444	Ga0070694_100001106	Ga0070694_1000011068	318
210	3300005444	Ga0070694_100032659	Ga0070694_1000326592	318
211	3300005459	Ga0068867_100000644	Ga0068867_10000064420	318
212	3300005518	Ga0070699_100019350	Ga0070699_1000193503	318
213	3300005530	Ga0070679_100011861	Ga0070679_1000118616	318
214	3300005544	Ga0070686_100002108	Ga0070686_10000210811	318
215	3300005545	Ga0070695_100000295	Ga0070695_10000029511	318
216	3300005546	Ga0070696_100015222	Ga0070696_1000152225	318
217	3300005547	Ga0070693_100003050	Ga0070693_1000030503	318
218	3300005548	Ga0070665_100007724	Ga0070665_1000077244	318
219	3300005549	Ga0070704_100002131	Ga0070704_1000021314	318
220	3300005549	Ga0070704_100014264	Ga0070704_1000142644	318
221	3300005549	Ga0070704_100104719	Ga0070704_1001047192	318
222	3300005563	Ga0068855_100004930	Ga0068855_10000493015	318
223	3300005563	Ga0068855_100167114	Ga0068855_1001671142	318
224	3300005614	Ga0068856_100033451	Ga0068856_1000334512	318
225	3300005615	Ga0070702_100005398	Ga0070702_1000053983	318
226	3300005617	Ga0068859_100003501	Ga0068859_10000350113	318
227	3300005617	Ga0068859_100020903	Ga0068859_1000209033	318
228	3300005719	Ga0068861_100002258	Ga0068861_10000225815	318
229	3300005840	Ga0068870_10168438	Ga0068870_101684381	318
230	3300005841	Ga0068863_100105813	Ga0068863_1001058133	318
231	3300005842	Ga0068858_100007255	Ga0068858_10000725510	318
232	3300005842	Ga0068858_100142312	Ga0068858_1001423123	318
233	3300005843	Ga0068860_100007630	Ga0068860_1000076308	318
234	3300005843	Ga0068860_100036924	Ga0068860_1000369244	318
235	3300005843	Ga0068860_100107583	Ga0068860_1001075832	318
236	3300005843	Ga0068860_100174468	Ga0068860_1001744682	318
237	3300005844	Ga0068862_100023239	Ga0068862_1000232393	318
238	3300005844	Ga0068862_100070827	Ga0068862_1000708272	318
239	3300006173	Ga0070716_100211163	Ga0070716_1002111632	318
240	3300006237	Ga0097621_100001291	Ga0097621_10000129117	318
241	3300006237	Ga0097621_100527799	Ga0097621_1005277991	318
242	3300006358	Ga0068871_100007929	Ga0068871_1000079292	318
243	3300006844	Ga0075428_100006936	Ga0075428_1000069369	318
244	3300006847	Ga0075431_100158764	Ga0075431_1001587642	318
245	3300006847	Ga0075431_100407968	Ga0075431_1004079681	318
246	3300006852	Ga0075433_10005913	Ga0075433_100059138	318
247	3300006871	Ga0075434_100000566	Ga0075434_10000056624	318
248	3300006880	Ga0075429_100000663	Ga0075429_10000066326	318
249	3300006881	Ga0068865_100002791	Ga0068865_1000027918	318
250	3300006914	Ga0075436_100003489	Ga0075436_10000348914	318
251	3300006931	Ga0097620_100003501	Ga0097620_1000035019	318
252	3300006931	Ga0097620_100020903	Ga0097620_1000209033	318
253	3300007076	Ga0075435_100000249	Ga0075435_10000024931	318
254	3300009094	Ga0111539_10017049	Ga0111539_100170492	318
255	3300009094	Ga0111539_10163310	Ga0111539_101633102	318
256	3300009098	Ga0105245_10001445	Ga0105245_1000144517	318
257	3300009147	Ga0114129_10009868	Ga0114129_100098687	318
258	3300009148	Ga0105243_10005409	Ga0105243_100054099	318
259	3300009176	Ga0105242_10005658	Ga0105242_100056588	318
260	3300009553	Ga0105249_10017839	Ga0105249_100178392	318
261	3300009553	Ga0105249_10093695	Ga0105249_100936952	318
262	3300011119	Ga0105246_10089814	Ga0105246_100898142	318
263	3300013297	Ga0157378_10001797	Ga0157378_1000179715	318
264	3300013308	Ga0157375_10632066	Ga0157375_106320661	318
265	3300014326	Ga0157380_10178217	Ga0157380_101782172	318
266	3300014968	Ga0157379_10344290	Ga0157379_103442901	318
267	3300014969	Ga0157376_10000791	Ga0157376_1000079113	318
268	3300017792	Ga0163161_10261551	Ga0163161_102615512	318
269	3300025901	Ga0207688_10100007	Ga0207688_101000072	318
270	3300025908	Ga0207643_10065283	Ga0207643_100652831	318
271	3300025917	Ga0207660_10056667	Ga0207660_100566672	318
272	3300025918	Ga0207662_10000643	Ga0207662_100006438	318
273	3300025921	Ga0207652_10016590	Ga0207652_100165902	318
274	3300025926	Ga0207659_10008287	Ga0207659_100082875	318
275	3300025927	Ga0207687_10205518	Ga0207687_102055182	318
276	3300025929	Ga0207664_10173395	Ga0207664_101733952	318
277	3300025934	Ga0207686_10003591	Ga0207686_100035918	318
278	3300025935	Ga0207709_10002014	Ga0207709_100020148	318
279	3300025936	Ga0207670_10381532	Ga0207670_103815322	318
280	3300025938	Ga0207704_10007180	Ga0207704_100071805	318
281	3300025942	Ga0207689_10007368	Ga0207689_100073684	318
282	3300025949	Ga0207667_10010861	Ga0207667_100108612	318
283	3300025961	Ga0207712_10029585	Ga0207712_100295852	318
284	3300025972	Ga0207668_10007950	Ga0207668_100079505	318
285	3300025981	Ga0207640_10010403	Ga0207640_100104036	318
286	3300025986	Ga0207658_10050785	Ga0207658_100507852	318
287	3300026023	Ga0207677_10002863	Ga0207677_100028639	318
288	3300026035	Ga0207703_10048270	Ga0207703_100482703	318
289	3300026035	Ga0207703_10056163	Ga0207703_100561633	318
290	3300026075	Ga0207708_10004329	Ga0207708_100043293	318
291	3300026075	Ga0207708_10052891	Ga0207708_100528913	318
292	3300026078	Ga0207702_10095435	Ga0207702_100954352	318
293	3300026078	Ga0207702_10242290	Ga0207702_102422902	318
294	3300026089	Ga0207648_10006731	Ga0207648_100067314	318
295	3300026095	Ga0207676_10294143	Ga0207676_102941431	318
296	3300026118	Ga0207675_100008518	Ga0207675_1000085184	318
297	3300026142	Ga0207698_10104606	Ga0207698_101046062	318
298	3300027907	Ga0207428_10007868	Ga0207428_100078687	318
299	3300027907	Ga0207428_10157183	Ga0207428_101571832	318
300	3300028379	Ga0268266_10010272	Ga0268266_100102724	318
301	3300028381	Ga0268264_10003700	Ga0268264_1000370014	318
302	3300034816	Ga0373930_0021313	Ga0373930_0021313_95_1057	318
303	3300035083	Ga0373926_0000442	Ga0373926_0000442_1121_2083	318
304	3300035085	Ga0373929_0011322	Ga0373929_0011322_420_1382	318
305	3300035090	Ga0373949_0003425	Ga0373949_0003425_871_1833	318
306	3300035111	Ga0373923_0033418	Ga0373923_0033418_380_1342	318
307	3300035112	Ga0373932_0029371	Ga0373932_0029371_141_1103	318
308	3300035114	Ga0373939_0002090	Ga0373939_0002090_1258_2220	318
309	3300035115	Ga0373941_0008413	Ga0373941_0008413_200_1162	318
310	3300035121	Ga0373960_0047381	Ga0373960_0047381_57_1019	318
311	3300035170	Ga0373943_0011834	Ga0373943_0011834_724_1686	318
312	3300035207	Ga0373942_0001503	Ga0373942_0001503_2902_3864	318
313	3300035691	Ga0373931_0002339	Ga0373931_0002339_6227_7189	318
314	3300035725	Ga0373947_0041301	Ga0373947_0041301_726_1688	318
315	3300037471	Ga0395905_0000138	Ga0395905_0000138_13309_14268	318
316	3300045051	Ga0451576_0068722	Ga0451576_0068722_2097_3059	318
317	3300046455	Ga0495603_0048157	Ga0495603_0048157_348_1310	318
318	3300046472	Ga0495580_0000432	Ga0495580_0000432_15566_16528	318
319	3300046475	Ga0495639_0008001	Ga0495639_0008001_2727_3689	318
320	3300046499	Ga0495594_0133513	Ga0495594_0133513_55_1017	318
321	3300046528	Ga0495642_0124811	Ga0495642_0124811_71_1036	318
322	3300046537	Ga0495598_0012076	Ga0495598_0012076_134_1096	318
323	3300046538	Ga0495609_0000849	Ga0495609_0000849_11764_12726	318
324	3300046615	Ga0495656_0009700	Ga0495656_0009700_516_1478	318
325	3300046665	Ga0495661_0002485	Ga0495661_0002485_4890_5852	318
326	3300046681	Ga0495647_0000748	Ga0495647_0000748_7734_8696	318
327	3300046683	Ga0495658_0004535	Ga0495658_0004535_5069_6031	318
328	3300048928	Ga0496125_0035562	Ga0496125_0035562_1129_2127	318
329	3300050507	nmdc:mga05p37_14146_c1	nmdc:mga05p37_14146_c1_4378_5340	318
330	3300050508	nmdc:mga09592_3688_c1	nmdc:mga09592_3688_c1_4260_5222	318
331	3300050509	nmdc:mga0qj67_222482_c1	nmdc:mga0qj67_222482_c1_488_1450	318
332	3300050510	nmdc:mga06r32_145313_c1	nmdc:mga06r32_145313_c1_405_1367	318
333	3300050511	nmdc:mga08y16_176148_c1	nmdc:mga08y16_176148_c1_1205_2167	318
334	3300050511	nmdc:mga08y16_3077_c1	nmdc:mga08y16_3077_c1_7441_8403	318
335	3300050513	nmdc:mga0rr50_652_c1	nmdc:mga0rr50_652_c1_10034_10996	318
336	3300050514	nmdc:mga08x19_915_c1	nmdc:mga08x19_915_c1_6825_7787	318
337	3300050515	nmdc:mga0a205_4880_c1	nmdc:mga0a205_4880_c1_11020_11982	318
338	iso_pu_bacteria	2842733646	2842737325	318
339	3300005471	Ga0070698_100019829	Ga0070698_1000198295	319
340	3300006846	Ga0075430_100057793	Ga0075430_1000577934	319
341	3300009094	Ga0111539_10393011	Ga0111539_103930111	319
342	3300028794	Ga0307515_10000438	Ga0307515_1000043836	319
343	3300031852	Ga0307410_10273647	Ga0307410_102736471	319
344	3300032004	Ga0307414_10461815	Ga0307414_104618151	319
345	3300032005	Ga0307411_10144398	Ga0307411_101443981	319
346	3300032126	Ga0307415_100144066	Ga0307415_1001440662	319
347	3300047318	Ga0495636_0039486	Ga0495636_0039486_53_1018	319
348	3300048928	Ga0496125_0035615	Ga0496125_0035615_760_1725	319
349	3300050514	nmdc:mga08x19_108805_c1	nmdc:mga08x19_108805_c1_414_1385	319
350	3300005295	Ga0065707_10123584	Ga0065707_101235843	320
351	3300005295	Ga0065707_10210865	Ga0065707_102108651	320
352	3300005327	Ga0070658_10092025	Ga0070658_100920252	320
353	3300005345	Ga0070692_10076035	Ga0070692_100760352	320
354	3300005365	Ga0070688_100226913	Ga0070688_1002269131	320
355	3300005440	Ga0070705_100164912	Ga0070705_1001649122	320
356	3300005444	Ga0070694_100158471	Ga0070694_1001584712	320
357	3300005546	Ga0070696_100008109	Ga0070696_1000081098	320
358	3300009094	Ga0111539_10013734	Ga0111539_100137343	320
359	3300026116	Ga0207674_10132044	Ga0207674_101320442	320
360	3300037471	Ga0395905_0033997	Ga0395905_0033997_2249_3229	320
361	3300037471	Ga0395905_0161158	Ga0395905_0161158_962_1939	320
362	3300038443	Ga0395901_0084645	Ga0395901_0084645_1848_2825	320
363	3300050511	nmdc:mga08y16_28984_c1	nmdc:mga08y16_28984_c1_3590_4567	320
364	3300006844	Ga0075428_100001881	Ga0075428_1000018815	321
365	3300006852	Ga0075433_10344596	Ga0075433_103445961	321
366	3300027907	Ga0207428_10028730	Ga0207428_100287302	321
367	3300031852	Ga0307410_10277819	Ga0307410_102778191	321
368	3300032002	Ga0307416_100550273	Ga0307416_1005502732	321
369	3300032126	Ga0307415_100105313	Ga0307415_1001053131	321
370	3300037471	Ga0395905_0023595	Ga0395905_0023595_4065_5036	321
371	3300048924	Ga0496121_0001862	Ga0496121_0001862_21809_22798	321
372	3300048928	Ga0496125_0010738	Ga0496125_0010738_5039_6004	321
373	3300006846	Ga0075430_100015343	Ga0075430_1000153437	322
374	3300006847	Ga0075431_100000405	Ga0075431_10000040523	322
375	3300006880	Ga0075429_100246578	Ga0075429_1002465781	322
376	3300046530	Ga0495654_0000729	Ga0495654_0000729_19654_20715	322
377	3300050508	nmdc:mga09592_124663_c1	nmdc:mga09592_124663_c1_783_1787	322
378	3300050509	nmdc:mga0qj67_151019_c1	nmdc:mga0qj67_151019_c1_123_1127	322
379	3300050510	nmdc:mga06r32_20088_c1	nmdc:mga06r32_20088_c1_3896_4900	322
380	iso_pu_bacteria	2599185214	2599621450	322
381	iso_pu_bacteria	2599185226	2599670866	322
382	iso_pu_bacteria	2599185227	2599679356	322
383	iso_pu_bacteria	2599185229	2599690961	322
384	iso_pu_bacteria	2738541307	2738883633	322
385	iso_pu_bacteria	2818991446	2819597616	322
386	iso_pu_bacteria	2885198086	2885204234	322
387	iso_pu_bacteria	2885211737	2885217432	322
388	iso_pu_bacteria	2899924645	2899929036	322
389	iso_pu_bacteria	2904541872	2904543046	322
390	iso_pu_bacteria	2928037797	2928040530	322
391	iso_pu_bacteria	2928044640	2928046721	322
392	iso_pu_bacteria	2928051484	2928058090	322
393	iso_pu_bacteria	2928064002	2928067570	322
394	iso_pu_bacteria	2928070936	2928072107	322
395	iso_pu_bacteria	2929160207	2929160275	322
396	3300028794	Ga0307515_10000215	Ga0307515_1000021534	323
397	3300031456	Ga0307513_10159636	Ga0307513_101596362	323
398	3300031824	Ga0307413_10106410	Ga0307413_101064102	323
399	3300005334	Ga0068869_100366580	Ga0068869_1003665801	324
400	3300005343	Ga0070687_100029484	Ga0070687_1000294843	324
401	3300005364	Ga0070673_100317509	Ga0070673_1003175092	324
402	3300005539	Ga0068853_100538569	Ga0068853_1005385691	324
403	3300005564	Ga0070664_100188265	Ga0070664_1001882652	324
404	3300005840	Ga0068870_10139393	Ga0068870_101393932	324
405	3300005841	Ga0068863_100113981	Ga0068863_1001139812	324
406	3300013296	Ga0157374_10070746	Ga0157374_100707463	324
407	3300014325	Ga0163163_10368208	Ga0163163_103682082	324
408	3300025925	Ga0207650_10016490	Ga0207650_100164905	324
409	3300025940	Ga0207691_10140970	Ga0207691_101409703	324
410	3300025942	Ga0207689_10211352	Ga0207689_102113522	324
411	3300025945	Ga0207679_10050498	Ga0207679_100504983	324
412	3300026041	Ga0207639_10482789	Ga0207639_104827891	324
413	3300026121	Ga0207683_10080482	Ga0207683_100804822	324
414	3300028794	Ga0307515_10070567	Ga0307515_100705672	324
415	3300046539	Ga0495621_0013409	Ga0495621_0013409_1331_2317	324
416	3300048911	Ga0496108_0191497	Ga0496108_0191497_243_1229	324
417	3300053088	Ga0500644_0070214	Ga0500644_0070214_71_1048	324
418	3300053108	Ga0500562_003677	Ga0500562_003677_857_1834	324
419	3300053153	Ga0500616_0052711	Ga0500616_0052711_508_1485	324
420	3300005563	Ga0068855_100010360	Ga0068855_1000103605	325
421	3300009093	Ga0105240_10496623	Ga0105240_104966232	325
422	3300013104	Ga0157370_10002017	Ga0157370_1000201720	325
423	3300014497	Ga0182008_10001446	Ga0182008_100014466	325
424	3300025912	Ga0207707_10097781	Ga0207707_100977812	325
425	3300025949	Ga0207667_10006675	Ga0207667_1000667510	325
426	3300046526	Ga0495666_0011237	Ga0495666_0011237_3290_4288	325
427	3300049586	Ga0501070_0180679	Ga0501070_0180679_372_1364	325
428	3300001979	JGI24740J21852_10004771	JGI24740J21852_100047715	326
429	3300002739	JGI25158J39367_1005660	JGI25158J39367_10056601	326
430	3300002773	JGI25152J39213_1002901	JGI25152J39213_10029012	326
431	3300002774	JGI25150J39212_1001956	JGI25150J39212_10019563	326
432	3300002987	JGI25159J45721_1003010	JGI25159J45721_10030102	326
433	3300003187	JGI25151J46595_10001365	JGI25151J46595_100013659	326
434	3300003187	JGI25151J46595_10006106	JGI25151J46595_100061065	326
435	3300003215	JGI25153J46596_10006199	JGI25153J46596_100061995	326
436	3300003354	JGI25160J50197_1004807	JGI25160J50197_10048072	326
437	3300003374	JGI25161J50226_1001347	JGI25161J50226_10013475	326
438	3300003771	Ga0055526_1006781	Ga0055526_10067812	326
439	3300003773	Ga0055537_1001334	Ga0055537_100133411	326
440	3300003775	Ga0055524_1004857	Ga0055524_10048575	326
441	3300003784	Ga0055534_1001302	Ga0055534_100130211	326
442	3300003790	Ga0055528_1002396	Ga0055528_100239611	326
443	3300003792	Ga0055540_1012427	Ga0055540_10124272	326
444	3300004625	Ga0055543_1002021	Ga0055543_10020213	326
445	3300005262	Ga0065165_1003783	Ga0065165_100378311	326
446	3300005339	Ga0070660_100029881	Ga0070660_1000298813	326
447	3300005435	Ga0070714_100372199	Ga0070714_1003721991	326
448	3300005530	Ga0070679_100002719	Ga0070679_10000271915	326
449	3300005530	Ga0070679_100029053	Ga0070679_1000290534	326
450	3300005539	Ga0068853_100013424	Ga0068853_1000134244	326
451	3300009093	Ga0105240_10333180	Ga0105240_103331802	326
452	3300010375	Ga0105239_10382881	Ga0105239_103828812	326
453	3300013104	Ga0157370_10223592	Ga0157370_102235922	326
454	3300025245	Ga0207425_1000958	Ga0207425_10009584	326
455	3300025258	Ga0209129_1000661	Ga0209129_100066127	326
456	3300025263	Ga0209565_1000263	Ga0209565_10002633	326
457	3300025273	Ga0209673_1000396	Ga0209673_100039680	326
458	3300025284	Ga0209130_1000687	Ga0209130_10006873	326
459	3300025291	Ga0209675_1000206	Ga0209675_100020663	326
460	3300025294	Ga0209025_1000410	Ga0209025_100041088	326
461	3300025294	Ga0209025_1001143	Ga0209025_100114326	326
462	3300025295	Ga0209564_1000110	Ga0209564_1000110121	326
463	3300025297	Ga0209758_1000039	Ga0209758_1000039121	326
464	3300025299	Ga0209256_1000074	Ga0209256_1000074121	326
465	3300025302	Ga0207426_1000121	Ga0207426_1000121120	326
466	3300025304	Ga0209257_1008333	Ga0209257_10083336	326
467	3300025919	Ga0207657_10026585	Ga0207657_100265854	326
468	3300025921	Ga0207652_10023585	Ga0207652_100235855	326
469	3300026041	Ga0207639_10016001	Ga0207639_100160012	326
470	3300038443	Ga0395901_0079560	Ga0395901_0079560_1824_2816	326
471	3300048920	Ga0496117_0008726	Ga0496117_0008726_5988_6968	326
472	3300048921	Ga0496118_0007686	Ga0496118_0007686_2399_3379	326
473	3300048928	Ga0496125_0031080	Ga0496125_0031080_3186_4166	326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

77

350

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2qpq-assembly3.cif.gz_C	structure of bug27 from bordetella pertussis	0.9405	31	326
2qpq-assembly3.cif.gz_C	structure of bug27 from bordetella pertussis	0.9374	31	326
2qpq-assembly2.cif.gz_B	structure of bug27 from bordetella pertussis	0.9325	30	326
2qpq-assembly2.cif.gz_B	structure of bug27 from bordetella pertussis	0.9294	30	326
8hkb-assembly1.cif.gz_A	tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d	0.9278	33	326

ID	Description	Score	Start	End	Superfamily
6hkeC02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9578	129	251	3.40.190.10
6hkeC02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9429	129	251	3.40.190.10
2dvzA02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9289	130	247	3.40.190.10
2qpqB01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1	0.9263	30	326	3.40.190.150
2dvzA01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1	0.9245	30	326	3.40.190.150

ID	Description	Score	Start	End
AF-A0A536XT46-F1-model_v4	Tripartite tricarboxylate transporter substrate binding protein	0.9747	59	326
AF-A0A519I8E8-F1-model_v4	deleted	0.9725	106	326
AF-A0A356HG38-F1-model_v4	deleted	0.9721	35	200
AF-A0A132HEP5-F1-model_v4	deleted	0.971	33	326
AF-A0A3N5WIT6-F1-model_v4	Tripartite tricarboxylate transporter substrate binding protein	0.9699	30	326

Feature Viewer

pLDDT	pTM	Quality
90.73	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F451080

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

77

350

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map