F451048

General Info

Members Datasets Scaffolds Average Seq Length
473 241 946 139

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0279546|Ga0395899_0279546_103_576
Length 157
Sequence VAEHRAGLRPDLTHTVRAVEIPAAARAILESDAPAHLVTLNPDGTPQISCVWIGVDGDEIVSAHLSAAQKKLRNVRRDPRVALSVEGTEVQPPGLKQYVVVHGSARITEGGAPELLQELAYRYLGPDVKFPPMPDPPPGFVLRITPVRIGGVGPWAG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
154 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
155 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
156 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 10.78
Rhizosphere 86.68
Stem 0
Stem Tuber 0
Unclassified 15.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0279546 3300037312 Bacteria 1136
2 JGI24739J22299_10110825 3300001989 Bacteria 823
3 JGI24743J22301_10014895 3300001991 Bacteria 1437
4 JGI24738J21930_10026511 3300002075 Bacteria 1189
5 Ga0070658_10011385 3300005327 Bacteria 7134
6 Ga0070658_10997683 3300005327 Bacteria 728
7 Ga0070676_10450676 3300005328 Bacteria 905
8 Ga0070683_100000320 3300005329 Bacteria 33119
9 Ga0070683_100021058 3300005329 Bacteria 5815
10 Ga0070666_11170060 3300005335 Bacteria 572
11 Ga0070680_100024435 3300005336 Bacteria 4827
12 Ga0070682_100009431 3300005337 Bacteria 5523
13 Ga0070682_100031349 3300005337 Bacteria 3215
14 Ga0068868_100017073 3300005338 Bacteria 5400
15 Ga0070660_100013807 3300005339 Bacteria 5810
16 Ga0070660_100208512 3300005339 Bacteria 1586
17 Ga0070689_100386030 3300005340 Unclassified 1181
18 Ga0070691_10045696 3300005341 Bacteria 2078
19 Ga0070687_100320127 3300005343 Bacteria 990
20 Ga0070661_100018370 3300005344 Bacteria 4971
21 Ga0070661_100110967 3300005344 Bacteria 2048
22 Ga0070692_10006044 3300005345 Bacteria 5222
23 Ga0070692_10058520 3300005345 Unclassified 2024
24 Ga0070669_100212089 3300005353 Bacteria 1528
25 Ga0070675_100034304 3300005354 Bacteria 4117
26 Ga0070673_100014607 3300005364 Bacteria 5478
27 Ga0070688_100157439 3300005365 Bacteria 1558
28 Ga0070659_100010874 3300005366 Bacteria 6710
29 Ga0070714_100055407 3300005435 Bacteria 3388
30 Ga0070714_100058064 3300005435 Bacteria 3314
31 Ga0070714_100093294 3300005435 Bacteria 2640
32 Ga0070714_100264981 3300005435 Bacteria 1592
33 Ga0070714_100352279 3300005435 Bacteria 1383
34 Ga0070713_100155478 3300005436 Unclassified 2038
35 Ga0070713_102099077 3300005436 Bacteria 548
36 Ga0070710_11373542 3300005437 Bacteria 527
37 Ga0070701_10369502 3300005438 Bacteria 901
38 Ga0070700_100591275 3300005441 Unclassified 868
39 Ga0070694_100174423 3300005444 Bacteria 1586
40 Ga0070694_101078471 3300005444 Unclassified 669
41 Ga0070708_100261422 3300005445 Bacteria 1627
42 Ga0070663_100463903 3300005455 Bacteria 1046
43 Ga0070663_100814098 3300005455 Bacteria 802
44 Ga0070678_100054852 3300005456 Bacteria 2907
45 Ga0070662_100086288 3300005457 Bacteria 2347
46 Ga0070681_10043295 3300005458 Bacteria 4510
47 Ga0070681_11102048 3300005458 Bacteria 715
48 Ga0068867_100012845 3300005459 Bacteria 5927
49 Ga0070706_100778850 3300005467 Unclassified 886
50 Ga0070707_100072648 3300005468 Bacteria 3316
51 Ga0070684_100000431 3300005535 Bacteria 28771
52 Ga0070684_100020718 3300005535 Bacteria 5455
53 Ga0070684_100229465 3300005535 Bacteria 1695
54 Ga0068853_100021709 3300005539 Bacteria 5356
55 Ga0070672_100173782 3300005543 Bacteria 1793
56 Ga0070672_100180013 3300005543 Bacteria 1761
57 Ga0070686_100101879 3300005544 Bacteria 1941
58 Ga0070686_100162278 3300005544 Bacteria 1575
59 Ga0070693_100003453 3300005547 Bacteria 7371
60 Ga0070693_100202253 3300005547 Bacteria 1291
61 Ga0070704_100220059 3300005549 Bacteria 1543
62 Ga0070704_100840127 3300005549 Bacteria 823
63 Ga0070664_100040028 3300005564 Bacteria 3951
64 Ga0070664_100104518 3300005564 Bacteria 2466
65 Ga0068854_100004315 3300005578 Bacteria 8961
66 Ga0068854_100105223 3300005578 Bacteria 2121
67 Ga0068854_100554754 3300005578 Bacteria 975
68 Ga0068856_100028293 3300005614 Bacteria 5472
69 Ga0070702_100037148 3300005615 Bacteria 2704
70 Ga0068852_100005459 3300005616 Bacteria 9095
71 Ga0068851_10181100 3300005834 Bacteria 1167
72 Ga0068858_100540292 3300005842 Bacteria 1128
73 Ga0068860_100147129 3300005843 Bacteria 2267
74 Ga0081455_10047673 3300005937 Bacteria 3708
75 Ga0081538_10014104 3300005981 Bacteria 6278
76 Ga0081538_10020981 3300005981 Bacteria 4789
77 Ga0081538_10027258 3300005981 Bacteria 3967
78 Ga0081539_10023969 3300005985 Bacteria 3978
79 Ga0070717_10014456 3300006028 Bacteria 6074
80 Ga0070717_10038098 3300006028 Bacteria 3907
81 Ga0075368_10223571 3300006042 Unclassified 800
82 Ga0075432_10233469 3300006058 Bacteria 740
83 Ga0070712_100046919 3300006175 Bacteria 2988
84 Ga0070712_100062107 3300006175 Unclassified 2641
85 Ga0097621_100649514 3300006237 Unclassified 968
86 Ga0097621_100761042 3300006237 Bacteria 895
87 Ga0097621_101958904 3300006237 Bacteria 559
88 Ga0068871_100340822 3300006358 Bacteria 1324
89 Ga0075434_100343572 3300006871 Bacteria 1513
90 Ga0075434_101489462 3300006871 Bacteria 686
91 Ga0068865_100004853 3300006881 Bacteria 8131
92 Ga0075436_101271941 3300006914 Unclassified 556
93 Ga0075435_100458406 3300007076 Unclassified 1100
94 Ga0075435_101134217 3300007076 Bacteria 684
95 Ga0075435_101281353 3300007076 Archaea 642
96 Ga0105240_10979400 3300009093 Bacteria 906
97 Ga0111539_10055930 3300009094 Bacteria 4691
98 Ga0111539_10130921 3300009094 Bacteria 2937
99 Ga0105245_10003634 3300009098 Bacteria 13768
100 Ga0105245_10814088 3300009098 Bacteria 972
101 Ga0105245_10961752 3300009098 Bacteria 897
102 Ga0114129_10057919 3300009147 Bacteria 5421
103 Ga0114129_10105839 3300009147 Bacteria 3887
104 Ga0105243_10011761 3300009148 Bacteria 6618
105 Ga0105243_10574347 3300009148 Bacteria 1081
106 Ga0105243_10666432 3300009148 Unclassified 1010
107 Ga0105243_11475693 3300009148 Unclassified 703
108 Ga0105241_10328274 3300009174 Bacteria 1321
109 Ga0105241_11196681 3300009174 Unclassified 720
110 Ga0105242_10009025 3300009176 Bacteria 7661
111 Ga0105242_10226110 3300009176 Bacteria 1675
112 Ga0105248_10756213 3300009177 Unclassified 1097
113 Ga0105248_11131488 3300009177 Bacteria 885
114 Ga0105238_10600007 3300009551 Bacteria 1109
115 Ga0105239_10024338 3300010375 Bacteria 6670
116 Ga0105239_10210892 3300010375 Bacteria 2177
117 Ga0105246_10975361 3300011119 Bacteria 765
118 Ga0157344_1030123 3300012476 Unclassified 516
119 Ga0157371_10014814 3300013102 Bacteria 5869
120 Ga0157371_10234735 3300013102 Bacteria 1319
121 Ga0157369_10560234 3300013105 Unclassified 1181
122 Ga0157374_10492309 3300013296 Unclassified 1230
123 Ga0157374_11155359 3300013296 Bacteria 795
124 Ga0157374_12102277 3300013296 Bacteria 591
125 Ga0163162_10008756 3300013306 Bacteria 9844
126 Ga0163162_10326278 3300013306 Bacteria 1667
127 Ga0157372_10012791 3300013307 Bacteria 8943
128 Ga0157375_10016677 3300013308 Bacteria 6607
129 Ga0157375_10061092 3300013308 Bacteria 3740
130 Ga0163163_10495639 3300014325 Bacteria 1283
131 Ga0163163_11566850 3300014325 Unclassified 720
132 Ga0157380_10011075 3300014326 Bacteria 6504
133 Ga0157380_12890032 3300014326 Unclassified 547
134 Ga0157377_10522063 3300014745 Bacteria 834
135 Ga0157377_10683893 3300014745 Bacteria 743
136 Ga0157377_11463592 3300014745 Unclassified 541
137 Ga0157379_10090995 3300014968 Bacteria 2737
138 Ga0157376_10014110 3300014969 Bacteria 5984
139 Ga0157376_10907975 3300014969 Bacteria 899
140 Ga0157376_10911589 3300014969 Unclassified 897
141 Ga0163161_10116042 3300017792 Bacteria 2007
142 Ga0206354_10522651 3300020081 Unclassified 582
143 Ga0213874_10021230 3300021377 Unclassified 1788
144 Ga0207656_10135383 3300025321 Bacteria 1157
145 Ga0207688_10010859 3300025901 Bacteria 4955
146 Ga0207688_10166083 3300025901 Bacteria 1310
147 Ga0207699_10393831 3300025906 Bacteria 985
148 Ga0207684_11419174 3300025910 Unclassified 568
149 Ga0207707_10012612 3300025912 Bacteria 7344
150 Ga0207707_10292628 3300025912 Bacteria 1409
151 Ga0207693_10215665 3300025915 Bacteria 1508
152 Ga0207693_10686937 3300025915 Bacteria 793
153 Ga0207663_11153414 3300025916 Bacteria 623
154 Ga0207662_10086688 3300025918 Bacteria 1919
155 Ga0207662_10430866 3300025918 Bacteria 899
156 Ga0207657_10008287 3300025919 Bacteria 10575
157 Ga0207649_10141848 3300025920 Bacteria 1645
158 Ga0207646_10067825 3300025922 Bacteria 3185
159 Ga0207694_10015941 3300025924 Bacteria 5671
160 Ga0207650_10432087 3300025925 Bacteria 1094
161 Ga0207659_10010047 3300025926 Bacteria 5929
162 Ga0207659_10510975 3300025926 Bacteria 1018
163 Ga0207687_10002002 3300025927 Bacteria 14006
164 Ga0207687_11014871 3300025927 Unclassified 712
165 Ga0207700_10017611 3300025928 Bacteria 4776
166 Ga0207700_10845452 3300025928 Unclassified 819
167 Ga0207664_10022243 3300025929 Bacteria 4731
168 Ga0207664_10101781 3300025929 Bacteria 2374
169 Ga0207664_10665796 3300025929 Unclassified 936
170 Ga0207690_10004013 3300025932 Bacteria 8692
171 Ga0207706_10008484 3300025933 Bacteria 9479
172 Ga0207706_10019915 3300025933 Bacteria 6031
173 Ga0207686_10020165 3300025934 Bacteria 3804
174 Ga0207686_10679431 3300025934 Bacteria 817
175 Ga0207709_10061465 3300025935 Bacteria 2348
176 Ga0207709_11185075 3300025935 Unclassified 629
177 Ga0207704_10079683 3300025938 Bacteria 2111
178 Ga0207691_10089628 3300025940 Bacteria 2758
179 Ga0207691_10225254 3300025940 Bacteria 1625
180 Ga0207661_10000153 3300025944 Bacteria 44357
181 Ga0207661_10012779 3300025944 Bacteria 6118
182 Ga0207661_10066536 3300025944 Bacteria 2928
183 Ga0207679_10014579 3300025945 Bacteria 5172
184 Ga0207679_10021979 3300025945 Bacteria 4337
185 Ga0207679_10909048 3300025945 Bacteria 805
186 Ga0207651_10003402 3300025960 Bacteria 7813
187 Ga0207640_10007070 3300025981 Bacteria 6184
188 Ga0207677_10417095 3300026023 Bacteria 1142
189 Ga0207703_10277961 3300026035 Bacteria 1520
190 Ga0207639_10029161 3300026041 Bacteria 4037
191 Ga0207678_10574762 3300026067 Bacteria 987
192 Ga0207708_10379098 3300026075 Bacteria 1166
193 Ga0207702_10017511 3300026078 Bacteria 5927
194 Ga0207702_10116863 3300026078 Bacteria 2381
195 Ga0207648_10019974 3300026089 Bacteria 6044
196 Ga0207683_10075163 3300026121 Bacteria 2990
197 Ga0207698_10003944 3300026142 Bacteria 8988
198 Ga0209813_10146148 3300027866 Unclassified 843
199 Ga0207428_10338182 3300027907 Bacteria 1109
200 Ga0268264_10209492 3300028381 Bacteria 1788
201 Ga0265338_10499634 3300028800 Bacteria 856
202 Ga0307513_10069190 3300031456 Bacteria 3694
203 Ga0307408_100769305 3300031548 Bacteria 871
204 Ga0307508_10570270 3300031616 Unclassified 731
205 Ga0316575_10027988 3300031665 Unclassified 2195
206 Ga0316576_10193222 3300031727 Bacteria 1534
207 Ga0307405_10988129 3300031731 Bacteria 717
208 Ga0307413_11298436 3300031824 Bacteria 637
209 Ga0307410_10724208 3300031852 Bacteria 840
210 Ga0307406_10797052 3300031901 Bacteria 797
211 Ga0307409_100325330 3300031995 Bacteria 1441
212 Ga0307409_101309306 3300031995 Bacteria 750
213 Ga0307416_100736774 3300032002 Bacteria 1077
214 Ga0307416_101359932 3300032002 Bacteria 816
215 Ga0307416_101431894 3300032002 Unclassified 797
216 Ga0307415_100296886 3300032126 Bacteria 1337
217 Ga0316574_0141562 3300035398 Bacteria 1550
218 Ga0395899_0008067 3300037312 Bacteria 8108
219 Ga0395899_0015880 3300037312 Bacteria 5741
220 Ga0395900_0034517 3300037418 Bacteria 5209
221 Ga0395900_0208295 3300037418 Bacteria 1975
222 Ga0395900_0255085 3300037418 Bacteria 1753
223 Ga0395900_0484604 3300037418 Bacteria 1189
224 Ga0395898_0007382 3300037466 Bacteria 11664
225 Ga0395898_0038752 3300037466 Bacteria 4721
226 Ga0395898_0483107 3300037466 Bacteria 1178
227 Ga0395905_0028333 3300037471 Bacteria 5279
228 Ga0395905_0115448 3300037471 Bacteria 2523
229 Ga0395905_0129582 3300037471 Bacteria 2372
230 Ga0395905_1782831 3300037471 Bacteria 521
231 Ga0436364_1218275 3300037853 Bacteria 9934
232 Ga0436364_1485699 3300037853 Bacteria 2294
233 Ga0395901_0018496 3300038443 Bacteria 7113
234 Ga0395901_0026897 3300038443 Bacteria 5906
235 Ga0395901_0187102 3300038443 Bacteria 2172
236 Ga0395901_0315825 3300038443 Bacteria 1617
237 Ga0436365_0809628 3300039437 Unclassified 520
238 Ga0436365_1920113 3300039437 Bacteria 20212
239 Ga0436361_0809162 3300039447 Unclassified 748
240 Ga0451789_0767465 3300041443 Bacteria 3817
241 Ga0451791_1108235 3300041451 Bacteria 7943
242 Ga0451793_0676844 3300041452 Bacteria 13181
243 Ga0451797_0607927 3300041453 Bacteria 937
244 Ga0451797_1443856 3300041453 Bacteria 2364
245 Ga0451795_1517537 3300041456 Unclassified 1089
246 Ga0451800_0001943 3300041459 Bacteria 3463
247 Ga0451843_0764901 3300041509 Bacteria 2890
248 Ga0451853_1329888 3300041512 Bacteria 2642
249 Ga0450905_083026 3300042142 Unclassified 559
250 Ga0466969_0005595 3300044656 Bacteria 6679
251 Ga0466966_0028368 3300044684 Bacteria 3647
252 Ga0466966_0119633 3300044684 Bacteria 1619
253 Ga0466966_0229522 3300044684 Bacteria 1120
254 Ga0466966_0286397 3300044684 Bacteria 991
255 Ga0466961_0234682 3300044693 Unclassified 1128
256 Ga0466961_0299177 3300044693 Bacteria 983
257 Ga0466963_0069377 3300044694 Bacteria 2369
258 Ga0466963_0094881 3300044694 Bacteria 2035
259 Ga0466963_0319924 3300044694 Unclassified 1092
260 Ga0466964_0176722 3300044706 Bacteria 1009
261 Ga0466971_0093195 3300044719 Bacteria 1380
262 Ga0466971_0147799 3300044719 Unclassified 1096
263 Ga0466970_0111328 3300044765 Bacteria 1495
264 Ga0466970_0265862 3300044765 Bacteria 963
265 Ga0466960_0247504 3300044901 Bacteria 989
266 Ga0466959_0041987 3300045049 Unclassified 3375
267 Ga0466959_0065739 3300045049 Bacteria 2632
268 Ga0466959_0089497 3300045049 Bacteria 2211
269 Ga0466959_0247256 3300045049 Bacteria 1231
270 Ga0466959_0553175 3300045049 Bacteria 776
271 Ga0466959_1033514 3300045049 Bacteria 547
272 Ga0466958_0001420 3300045836 Bacteria 11343
273 Ga0466958_0002264 3300045836 Bacteria 9593
274 Ga0466958_0048422 3300045836 Unclassified 2569
275 Ga0466958_0080727 3300045836 Bacteria 2001
276 Ga0466958_0130915 3300045836 Unclassified 1575
277 Ga0466967_0001008 3300045976 Bacteria 15397
278 Ga0495603_0018701 3300046455 Bacteria 4192
279 Ga0495629_0444119 3300046459 Bacteria 879
280 Ga0495641_0074212 3300046461 Bacteria 1526
281 Ga0495641_0148148 3300046461 Bacteria 1049
282 Ga0495582_0215535 3300046473 Unclassified 1098
283 Ga0495594_0413656 3300046499 Bacteria 767
284 Ga0495618_0491879 3300046514 Unclassified 740
285 Ga0495609_0087747 3300046538 Bacteria 1355
286 Ga0495656_0338763 3300046615 Bacteria 777
287 Ga0495656_0518312 3300046615 Unclassified 633
288 Ga0495656_0644383 3300046615 Bacteria 568
289 Ga0495588_0061233 3300046674 Bacteria 1949
290 Ga0495613_0542530 3300046689 Bacteria 779
291 Ga0495674_0295491 3300047319 Bacteria 1324
292 Ga0495680_0662789 3300047322 Bacteria 692
293 Ga0495602_0955193 3300048088 Unclassified 568
294 Ga0496100_0489293 3300048903 Bacteria 947
295 Ga0496101_0138275 3300048904 Bacteria 1855
296 Ga0496101_0160957 3300048904 Bacteria 1721
297 Ga0496102_0000889 3300048905 Bacteria 28364
298 Ga0496102_0755175 3300048905 Bacteria 895
299 Ga0496103_0084846 3300048906 Bacteria 1995
300 Ga0496103_0365144 3300048906 Bacteria 928
301 Ga0496104_0001448 3300048907 Bacteria 20494
302 Ga0496104_0076379 3300048907 Unclassified 3191
303 Ga0496104_0118539 3300048907 Bacteria 2541
304 Ga0496104_0630147 3300048907 Unclassified 982
305 Ga0496104_0857354 3300048907 Unclassified 814
306 Ga0496105_0051690 3300048908 Bacteria 3395
307 Ga0496105_0158414 3300048908 Unclassified 1859
308 Ga0496105_0303504 3300048908 Bacteria 1283
309 Ga0496106_0204796 3300048909 Bacteria 1571
310 Ga0496106_0297783 3300048909 Bacteria 1293
311 Ga0496106_0365750 3300048909 Bacteria 1159
312 Ga0496106_0444765 3300048909 Bacteria 1041
313 Ga0496107_0798437 3300048910 Bacteria 691
314 Ga0496107_1138281 3300048910 Unclassified 563
315 Ga0496108_0272321 3300048911 Bacteria 1474
316 Ga0496108_0392553 3300048911 Bacteria 1212
317 Ga0496109_0055597 3300048912 Bacteria 3611
318 Ga0496109_0075794 3300048912 Unclassified 3093
319 Ga0496109_0236363 3300048912 Bacteria 1719
320 Ga0496109_0400133 3300048912 Unclassified 1297
321 Ga0496110_0049843 3300048913 Bacteria 3675
322 Ga0496110_0150276 3300048913 Bacteria 2109
323 Ga0496110_0186175 3300048913 Bacteria 1885
324 Ga0496110_1072102 3300048913 Unclassified 714
325 Ga0496110_1390057 3300048913 Unclassified 611
326 Ga0496111_0201882 3300048914 Unclassified 1478
327 Ga0496111_0265991 3300048914 Unclassified 1272
328 Ga0496112_0503148 3300048915 Unclassified 1147
329 Ga0496114_0011266 3300048917 Bacteria 7140
330 Ga0496114_0012862 3300048917 Bacteria 6703
331 Ga0496114_0160800 3300048917 Bacteria 1953
332 Ga0496114_0173187 3300048917 Bacteria 1882
333 Ga0496114_0602366 3300048917 Bacteria 969
334 Ga0496114_0719471 3300048917 Bacteria 874
335 Ga0496115_0198135 3300048918 Bacteria 1659
336 Ga0496115_0216343 3300048918 Bacteria 1582
337 Ga0496115_0251983 3300048918 Bacteria 1453
338 Ga0501031_0050813 3300049568 Bacteria 2700
339 Ga0501032_0045385 3300049569 Bacteria 2972
340 Ga0501033_0308958 3300049570 Bacteria 1112
341 Ga0501034_0085885 3300049571 Bacteria 3148
342 Ga0501036_0010229 3300049572 Bacteria 7736
343 Ga0501036_0014510 3300049572 Bacteria 6563
344 Ga0501036_0019290 3300049572 Bacteria 5723
345 Ga0501036_0027248 3300049572 Bacteria 4828
346 Ga0501036_0083421 3300049572 Unclassified 2701
347 Ga0501036_0294225 3300049572 Unclassified 1358
348 Ga0501037_0150526 3300049573 Bacteria 1663
349 Ga0501037_0547964 3300049573 Bacteria 781
350 Ga0501038_0022876 3300049574 Bacteria 5595
351 Ga0501038_0152062 3300049574 Bacteria 1886
352 Ga0501038_0387481 3300049574 Bacteria 1083
353 Ga0501039_0029802 3300049575 Bacteria 4204
354 Ga0501039_0043719 3300049575 Bacteria 3459
355 Ga0501040_0011605 3300049576 Bacteria 5767
356 Ga0501040_0012914 3300049576 Bacteria 5487
357 Ga0501040_0026718 3300049576 Bacteria 3883
358 Ga0501040_0294227 3300049576 Bacteria 1160
359 Ga0501040_0520373 3300049576 Bacteria 858
360 Ga0501041_0006507 3300049577 Bacteria 6839
361 Ga0501041_0070769 3300049577 Bacteria 2141
362 Ga0501041_0115126 3300049577 Bacteria 1669
363 Ga0501041_0354394 3300049577 Bacteria 927
364 Ga0501042_0004105 3300049578 Bacteria 9248
365 Ga0501042_0021989 3300049578 Bacteria 4452
366 Ga0501042_0028068 3300049578 Bacteria 3961
367 Ga0501042_0035512 3300049578 Bacteria 3536
368 Ga0501042_0279517 3300049578 Bacteria 1205
369 Ga0501043_0019136 3300049579 Bacteria 5375
370 Ga0501043_0047930 3300049579 Bacteria 3359
371 Ga0501043_0093189 3300049579 Bacteria 2368
372 Ga0501046_0005156 3300049580 Bacteria 11712
373 Ga0501046_0058821 3300049580 Bacteria 3012
374 Ga0501046_0157893 3300049580 Bacteria 1707
375 Ga0501046_0605558 3300049580 Bacteria 777
376 Ga0501047_0947408 3300049581 Bacteria 674
377 Ga0501048_0010135 3300049582 Bacteria 7049
378 Ga0501048_0012667 3300049582 Bacteria 6270
379 Ga0501048_0039854 3300049582 Bacteria 3367
380 Ga0501048_0083438 3300049582 Bacteria 2253
381 Ga0501067_0134058 3300049583 Bacteria 1379
382 Ga0501068_0009989 3300049584 Bacteria 5322
383 Ga0501068_0029258 3300049584 Bacteria 3261
384 Ga0501068_0066760 3300049584 Bacteria 2191
385 Ga0501068_0177320 3300049584 Bacteria 1347
386 Ga0501068_0932566 3300049584 Bacteria 572
387 Ga0501069_0118492 3300049585 Bacteria 1511
388 Ga0501069_0253729 3300049585 Bacteria 1026
389 Ga0501070_0023661 3300049586 Bacteria 5147
390 Ga0501070_0056545 3300049586 Bacteria 3252
391 Ga0501070_0073172 3300049586 Bacteria 2836
392 Ga0501070_0807077 3300049586 Bacteria 736
393 Ga0501071_0005995 3300049587 Bacteria 7874
394 Ga0501071_0008966 3300049587 Bacteria 6636
395 Ga0501071_0037245 3300049587 Bacteria 3472
396 Ga0501071_0040028 3300049587 Unclassified 3354
397 Ga0501071_1001212 3300049587 Bacteria 645
398 Ga0501072_0000889 3300049588 Bacteria 21919
399 Ga0501072_0018183 3300049588 Bacteria 5407
400 Ga0501072_0027631 3300049588 Bacteria 4425
401 Ga0501072_0071290 3300049588 Bacteria 2745
402 Ga0501072_0457082 3300049588 Unclassified 1011
403 Ga0501073_0008931 3300049589 Bacteria 7402
404 Ga0501073_0055540 3300049589 Bacteria 2771
405 Ga0501073_0359798 3300049589 Bacteria 1005
406 Ga0501074_0008848 3300049590 Bacteria 7297
407 Ga0501074_0034929 3300049590 Bacteria 3643
408 Ga0501074_0049626 3300049590 Bacteria 3030
409 Ga0501074_0132055 3300049590 Bacteria 1786
410 Ga0501075_0001771 3300049591 Bacteria 14199
411 Ga0501075_0004487 3300049591 Bacteria 9454
412 Ga0501075_0007681 3300049591 Bacteria 7485
413 Ga0501075_0010412 3300049591 Bacteria 6535
414 Ga0501075_0156417 3300049591 Unclassified 1738
415 Ga0501076_0003983 3300049592 Bacteria 10429
416 Ga0501076_0008390 3300049592 Bacteria 7570
417 Ga0501076_0008422 3300049592 Bacteria 7556
418 Ga0501076_0174209 3300049592 Bacteria 1754
419 Ga0501076_0238471 3300049592 Unclassified 1487
420 Ga0501076_0539757 3300049592 Bacteria 961
421 Ga0501076_0736971 3300049592 Bacteria 813
422 Ga0501077_0003802 3300049593 Bacteria 9091
423 Ga0501077_0011415 3300049593 Bacteria 5547
424 Ga0501077_0024583 3300049593 Bacteria 3825
425 Ga0501077_1023253 3300049593 Bacteria 531
426 Ga0501079_0005185 3300049741 Bacteria 9688
427 Ga0501079_0008442 3300049741 Bacteria 7808
428 Ga0501079_0016462 3300049741 Bacteria 5645
429 Ga0501079_0022391 3300049741 Bacteria 4845
430 Ga0501080_0010024 3300049742 Bacteria 8662
431 Ga0501080_0013478 3300049742 Bacteria 7521
432 Ga0501080_0124744 3300049742 Bacteria 2385
433 Ga0501080_0191719 3300049742 Bacteria 1878
434 Ga0501080_1627554 3300049742 Unclassified 546
435 Ga0501081_0021615 3300049743 Bacteria 4294
436 Ga0501081_0092465 3300049743 Bacteria 2128
437 Ga0501081_0093941 3300049743 Bacteria 2112
438 Ga0501083_0063513 3300049744 Bacteria 2463
439 Ga0501083_0086452 3300049744 Bacteria 2074
440 Ga0501035_0004588 3300049822 Bacteria 13099
441 Ga0501035_0101687 3300049822 Bacteria 2522
442 Ga0501035_0250603 3300049822 Bacteria 1504
443 Ga0501044_0201045 3300049823 Bacteria 1951
444 Ga0501045_0002284 3300049824 Bacteria 12987
445 Ga0501045_0002722 3300049824 Bacteria 12064
446 Ga0501045_0007834 3300049824 Bacteria 7431
447 Ga0501045_0027329 3300049824 Bacteria 4110
448 Ga0501045_0033602 3300049824 Bacteria 3719
449 Ga0501045_0146578 3300049824 Bacteria 1756
450 Ga0501045_0302825 3300049824 Unclassified 1190
451 nmdc:mga04h51_170053_c1 3300050495 Unclassified 843
452 nmdc:mga05p37_361115_c1 3300050507 Bacteria 1707
453 nmdc:mga05p37_53532_c1 3300050507 Bacteria 4963
454 nmdc:mga09592_803921_c1 3300050508 Bacteria 795
455 nmdc:mga08y16_485441_c2 3300050511 Unclassified 708
456 nmdc:mga0n895_191649_c1 3300050512 Bacteria 2075
457 nmdc:mga0rr50_1526881_c1 3300050513 Unclassified 564
458 nmdc:mga0rr50_353378_c1 3300050513 Bacteria 1236
459 nmdc:mga08x19_1126622_c1 3300050514 Unclassified 557
460 nmdc:mga0a205_529830_c1 3300050515 Bacteria 1034
461 Ga0501084_0001857 3300054114 Bacteria 16834
462 Ga0501084_0048891 3300054114 Bacteria 3540
463 Ga0501084_0068177 3300054114 Bacteria 2978
464 Ga0501084_0696834 3300054114 Bacteria 856
465 Ga0501082_0001530 3300060353 Bacteria 20348
466 Ga0501082_0021440 3300060353 Bacteria 5574
467 Ga0501082_0024749 3300060353 Bacteria 5175
468 Ga0501082_0057930 3300060353 Bacteria 3337
469 Ga0501082_0736327 3300060353 Bacteria 863
470 Ga0501082_1398598 3300060353 Bacteria 611
471 Ga0530510_0002901 3300061734 Bacteria 11755
472 Ga0530510_0016152 3300061734 Bacteria 5280
473 Ga0530510_0845086 3300061734 Bacteria 699
474 Ga0395899_0279546
475 JGI24739J22299_10110825
476 JGI24743J22301_10014895
477 JGI24738J21930_10026511
478 Ga0070658_10011385
479 Ga0070658_10997683
480 Ga0070676_10450676
481 Ga0070683_100000320
482 Ga0070683_100021058
483 Ga0070666_11170060
484 Ga0070680_100024435
485 Ga0070682_100009431
486 Ga0070682_100031349
487 Ga0068868_100017073
488 Ga0070660_100013807
489 Ga0070660_100208512
490 Ga0070689_100386030
491 Ga0070691_10045696
492 Ga0070687_100320127
493 Ga0070661_100018370
494 Ga0070661_100110967
495 Ga0070692_10006044
496 Ga0070692_10058520
497 Ga0070669_100212089
498 Ga0070675_100034304
499 Ga0070673_100014607
500 Ga0070688_100157439
501 Ga0070659_100010874
502 Ga0070714_100055407
503 Ga0070714_100058064
504 Ga0070714_100093294
505 Ga0070714_100264981
506 Ga0070714_100352279
507 Ga0070713_100155478
508 Ga0070713_102099077
509 Ga0070710_11373542
510 Ga0070701_10369502
511 Ga0070700_100591275
512 Ga0070694_100174423
513 Ga0070694_101078471
514 Ga0070708_100261422
515 Ga0070663_100463903
516 Ga0070663_100814098
517 Ga0070678_100054852
518 Ga0070662_100086288
519 Ga0070681_10043295
520 Ga0070681_11102048
521 Ga0068867_100012845
522 Ga0070706_100778850
523 Ga0070707_100072648
524 Ga0070684_100000431
525 Ga0070684_100020718
526 Ga0070684_100229465
527 Ga0068853_100021709
528 Ga0070672_100173782
529 Ga0070672_100180013
530 Ga0070686_100101879
531 Ga0070686_100162278
532 Ga0070693_100003453
533 Ga0070693_100202253
534 Ga0070704_100220059
535 Ga0070704_100840127
536 Ga0070664_100040028
537 Ga0070664_100104518
538 Ga0068854_100004315
539 Ga0068854_100105223
540 Ga0068854_100554754
541 Ga0068856_100028293
542 Ga0070702_100037148
543 Ga0068852_100005459
544 Ga0068851_10181100
545 Ga0068858_100540292
546 Ga0068860_100147129
547 Ga0081455_10047673
548 Ga0081538_10014104
549 Ga0081538_10020981
550 Ga0081538_10027258
551 Ga0081539_10023969
552 Ga0070717_10014456
553 Ga0070717_10038098
554 Ga0075368_10223571
555 Ga0075432_10233469
556 Ga0070712_100046919
557 Ga0070712_100062107
558 Ga0097621_100649514
559 Ga0097621_100761042
560 Ga0097621_101958904
561 Ga0068871_100340822
562 Ga0075434_100343572
563 Ga0075434_101489462
564 Ga0068865_100004853
565 Ga0075436_101271941
566 Ga0075435_100458406
567 Ga0075435_101134217
568 Ga0075435_101281353
569 Ga0105240_10979400
570 Ga0111539_10055930
571 Ga0111539_10130921
572 Ga0105245_10003634
573 Ga0105245_10814088
574 Ga0105245_10961752
575 Ga0114129_10057919
576 Ga0114129_10105839
577 Ga0105243_10011761
578 Ga0105243_10574347
579 Ga0105243_10666432
580 Ga0105243_11475693
581 Ga0105241_10328274
582 Ga0105241_11196681
583 Ga0105242_10009025
584 Ga0105242_10226110
585 Ga0105248_10756213
586 Ga0105248_11131488
587 Ga0105238_10600007
588 Ga0105239_10024338
589 Ga0105239_10210892
590 Ga0105246_10975361
591 Ga0157344_1030123
592 Ga0157371_10014814
593 Ga0157371_10234735
594 Ga0157369_10560234
595 Ga0157374_10492309
596 Ga0157374_11155359
597 Ga0157374_12102277
598 Ga0163162_10008756
599 Ga0163162_10326278
600 Ga0157372_10012791
601 Ga0157375_10016677
602 Ga0157375_10061092
603 Ga0163163_10495639
604 Ga0163163_11566850
605 Ga0157380_10011075
606 Ga0157380_12890032
607 Ga0157377_10522063
608 Ga0157377_10683893
609 Ga0157377_11463592
610 Ga0157379_10090995
611 Ga0157376_10014110
612 Ga0157376_10907975
613 Ga0157376_10911589
614 Ga0163161_10116042
615 Ga0206354_10522651
616 Ga0213874_10021230
617 Ga0207656_10135383
618 Ga0207688_10010859
619 Ga0207688_10166083
620 Ga0207699_10393831
621 Ga0207684_11419174
622 Ga0207707_10012612
623 Ga0207707_10292628
624 Ga0207693_10215665
625 Ga0207693_10686937
626 Ga0207663_11153414
627 Ga0207662_10086688
628 Ga0207662_10430866
629 Ga0207657_10008287
630 Ga0207649_10141848
631 Ga0207646_10067825
632 Ga0207694_10015941
633 Ga0207650_10432087
634 Ga0207659_10010047
635 Ga0207659_10510975
636 Ga0207687_10002002
637 Ga0207687_11014871
638 Ga0207700_10017611
639 Ga0207700_10845452
640 Ga0207664_10022243
641 Ga0207664_10101781
642 Ga0207664_10665796
643 Ga0207690_10004013
644 Ga0207706_10008484
645 Ga0207706_10019915
646 Ga0207686_10020165
647 Ga0207686_10679431
648 Ga0207709_10061465
649 Ga0207709_11185075
650 Ga0207704_10079683
651 Ga0207691_10089628
652 Ga0207691_10225254
653 Ga0207661_10000153
654 Ga0207661_10012779
655 Ga0207661_10066536
656 Ga0207679_10014579
657 Ga0207679_10021979
658 Ga0207679_10909048
659 Ga0207651_10003402
660 Ga0207640_10007070
661 Ga0207677_10417095
662 Ga0207703_10277961
663 Ga0207639_10029161
664 Ga0207678_10574762
665 Ga0207708_10379098
666 Ga0207702_10017511
667 Ga0207702_10116863
668 Ga0207648_10019974
669 Ga0207683_10075163
670 Ga0207698_10003944
671 Ga0209813_10146148
672 Ga0207428_10338182
673 Ga0268264_10209492
674 Ga0265338_10499634
675 Ga0307513_10069190
676 Ga0307408_100769305
677 Ga0307508_10570270
678 Ga0316575_10027988
679 Ga0316576_10193222
680 Ga0307405_10988129
681 Ga0307413_11298436
682 Ga0307410_10724208
683 Ga0307406_10797052
684 Ga0307409_100325330
685 Ga0307409_101309306
686 Ga0307416_100736774
687 Ga0307416_101359932
688 Ga0307416_101431894
689 Ga0307415_100296886
690 Ga0316574_0141562
691 Ga0395899_0008067
692 Ga0395899_0015880
693 Ga0395900_0034517
694 Ga0395900_0208295
695 Ga0395900_0255085
696 Ga0395900_0484604
697 Ga0395898_0007382
698 Ga0395898_0038752
699 Ga0395898_0483107
700 Ga0395905_0028333
701 Ga0395905_0115448
702 Ga0395905_0129582
703 Ga0395905_1782831
704 Ga0436364_1218275
705 Ga0436364_1485699
706 Ga0395901_0018496
707 Ga0395901_0026897
708 Ga0395901_0187102
709 Ga0395901_0315825
710 Ga0436365_0809628
711 Ga0436365_1920113
712 Ga0436361_0809162
713 Ga0451789_0767465
714 Ga0451791_1108235
715 Ga0451793_0676844
716 Ga0451797_0607927
717 Ga0451797_1443856
718 Ga0451795_1517537
719 Ga0451800_0001943
720 Ga0451843_0764901
721 Ga0451853_1329888
722 Ga0450905_083026
723 Ga0466969_0005595
724 Ga0466966_0028368
725 Ga0466966_0119633
726 Ga0466966_0229522
727 Ga0466966_0286397
728 Ga0466961_0234682
729 Ga0466961_0299177
730 Ga0466963_0069377
731 Ga0466963_0094881
732 Ga0466963_0319924
733 Ga0466964_0176722
734 Ga0466971_0093195
735 Ga0466971_0147799
736 Ga0466970_0111328
737 Ga0466970_0265862
738 Ga0466960_0247504
739 Ga0466959_0041987
740 Ga0466959_0065739
741 Ga0466959_0089497
742 Ga0466959_0247256
743 Ga0466959_0553175
744 Ga0466959_1033514
745 Ga0466958_0001420
746 Ga0466958_0002264
747 Ga0466958_0048422
748 Ga0466958_0080727
749 Ga0466958_0130915
750 Ga0466967_0001008
751 Ga0495603_0018701
752 Ga0495629_0444119
753 Ga0495641_0074212
754 Ga0495641_0148148
755 Ga0495582_0215535
756 Ga0495594_0413656
757 Ga0495618_0491879
758 Ga0495609_0087747
759 Ga0495656_0338763
760 Ga0495656_0518312
761 Ga0495656_0644383
762 Ga0495588_0061233
763 Ga0495613_0542530
764 Ga0495674_0295491
765 Ga0495680_0662789
766 Ga0495602_0955193
767 Ga0496100_0489293
768 Ga0496101_0138275
769 Ga0496101_0160957
770 Ga0496102_0000889
771 Ga0496102_0755175
772 Ga0496103_0084846
773 Ga0496103_0365144
774 Ga0496104_0001448
775 Ga0496104_0076379
776 Ga0496104_0118539
777 Ga0496104_0630147
778 Ga0496104_0857354
779 Ga0496105_0051690
780 Ga0496105_0158414
781 Ga0496105_0303504
782 Ga0496106_0204796
783 Ga0496106_0297783
784 Ga0496106_0365750
785 Ga0496106_0444765
786 Ga0496107_0798437
787 Ga0496107_1138281
788 Ga0496108_0272321
789 Ga0496108_0392553
790 Ga0496109_0055597
791 Ga0496109_0075794
792 Ga0496109_0236363
793 Ga0496109_0400133
794 Ga0496110_0049843
795 Ga0496110_0150276
796 Ga0496110_0186175
797 Ga0496110_1072102
798 Ga0496110_1390057
799 Ga0496111_0201882
800 Ga0496111_0265991
801 Ga0496112_0503148
802 Ga0496114_0011266
803 Ga0496114_0012862
804 Ga0496114_0160800
805 Ga0496114_0173187
806 Ga0496114_0602366
807 Ga0496114_0719471
808 Ga0496115_0198135
809 Ga0496115_0216343
810 Ga0496115_0251983
811 Ga0501031_0050813
812 Ga0501032_0045385
813 Ga0501033_0308958
814 Ga0501034_0085885
815 Ga0501036_0010229
816 Ga0501036_0014510
817 Ga0501036_0019290
818 Ga0501036_0027248
819 Ga0501036_0083421
820 Ga0501036_0294225
821 Ga0501037_0150526
822 Ga0501037_0547964
823 Ga0501038_0022876
824 Ga0501038_0152062
825 Ga0501038_0387481
826 Ga0501039_0029802
827 Ga0501039_0043719
828 Ga0501040_0011605
829 Ga0501040_0012914
830 Ga0501040_0026718
831 Ga0501040_0294227
832 Ga0501040_0520373
833 Ga0501041_0006507
834 Ga0501041_0070769
835 Ga0501041_0115126
836 Ga0501041_0354394
837 Ga0501042_0004105
838 Ga0501042_0021989
839 Ga0501042_0028068
840 Ga0501042_0035512
841 Ga0501042_0279517
842 Ga0501043_0019136
843 Ga0501043_0047930
844 Ga0501043_0093189
845 Ga0501046_0005156
846 Ga0501046_0058821
847 Ga0501046_0157893
848 Ga0501046_0605558
849 Ga0501047_0947408
850 Ga0501048_0010135
851 Ga0501048_0012667
852 Ga0501048_0039854
853 Ga0501048_0083438
854 Ga0501067_0134058
855 Ga0501068_0009989
856 Ga0501068_0029258
857 Ga0501068_0066760
858 Ga0501068_0177320
859 Ga0501068_0932566
860 Ga0501069_0118492
861 Ga0501069_0253729
862 Ga0501070_0023661
863 Ga0501070_0056545
864 Ga0501070_0073172
865 Ga0501070_0807077
866 Ga0501071_0005995
867 Ga0501071_0008966
868 Ga0501071_0037245
869 Ga0501071_0040028
870 Ga0501071_1001212
871 Ga0501072_0000889
872 Ga0501072_0018183
873 Ga0501072_0027631
874 Ga0501072_0071290
875 Ga0501072_0457082
876 Ga0501073_0008931
877 Ga0501073_0055540
878 Ga0501073_0359798
879 Ga0501074_0008848
880 Ga0501074_0034929
881 Ga0501074_0049626
882 Ga0501074_0132055
883 Ga0501075_0001771
884 Ga0501075_0004487
885 Ga0501075_0007681
886 Ga0501075_0010412
887 Ga0501075_0156417
888 Ga0501076_0003983
889 Ga0501076_0008390
890 Ga0501076_0008422
891 Ga0501076_0174209
892 Ga0501076_0238471
893 Ga0501076_0539757
894 Ga0501076_0736971
895 Ga0501077_0003802
896 Ga0501077_0011415
897 Ga0501077_0024583
898 Ga0501077_1023253
899 Ga0501079_0005185
900 Ga0501079_0008442
901 Ga0501079_0016462
902 Ga0501079_0022391
903 Ga0501080_0010024
904 Ga0501080_0013478
905 Ga0501080_0124744
906 Ga0501080_0191719
907 Ga0501080_1627554
908 Ga0501081_0021615
909 Ga0501081_0092465
910 Ga0501081_0093941
911 Ga0501083_0063513
912 Ga0501083_0086452
913 Ga0501035_0004588
914 Ga0501035_0101687
915 Ga0501035_0250603
916 Ga0501044_0201045
917 Ga0501045_0002284
918 Ga0501045_0002722
919 Ga0501045_0007834
920 Ga0501045_0027329
921 Ga0501045_0033602
922 Ga0501045_0146578
923 Ga0501045_0302825
924 nmdc:mga04h51_170053_c1
925 nmdc:mga05p37_361115_c1
926 nmdc:mga05p37_53532_c1
927 nmdc:mga09592_803921_c1
928 nmdc:mga08y16_485441_c2
929 nmdc:mga0n895_191649_c1
930 nmdc:mga0rr50_1526881_c1
931 nmdc:mga0rr50_353378_c1
932 nmdc:mga08x19_1126622_c1
933 nmdc:mga0a205_529830_c1
934 Ga0501084_0001857
935 Ga0501084_0048891
936 Ga0501084_0068177
937 Ga0501084_0696834
938 Ga0501082_0001530
939 Ga0501082_0021440
940 Ga0501082_0024749
941 Ga0501082_0057930
942 Ga0501082_0736327
943 Ga0501082_1398598
944 Ga0530510_0002901
945 Ga0530510_0016152
946 Ga0530510_0845086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

21

112

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8369 2 123
6vna-assembly1.cif.gz_C pden_1323 0.8349 2 81
6ymh-assembly1.cif.gz_AAA x-ray structure of the k72i, y129f, r133l, h199a quadruple mutant of pnp-oxidase from e. coli in complex with plp 0.8204 6 124
1wv4-assembly1.cif.gz_B x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.8107 6 122
1wv4-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.7928 6 122
ID Description Score Start End Superfamily
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8332 2 123 2.30.110.10
af_A0A1R3LXN8_584_738_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8166 4 77 2.30.110.10
1wv4B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8107 6 122 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7853 2 125 2.30.110.10
af_A0A1D8PQI8_1_209_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7796 2 124 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A536G7Y3-F1-model_v4 TIGR03618 family F420-dependent PPOX class oxidoreductase 0.9833 2 128 GO:0005829
GO:0016627
GO:0070967
AF-A0A7V8WJ96-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9824 11 129 GO:0005829
GO:0016627
GO:0070967
AF-A0A7W1HR86-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9712 11 132 GO:0005829
GO:0016627
GO:0070967
AF-A0A7V8WJ96-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9663 11 129 GO:0005829
GO:0016627
GO:0070967
AF-A0A6V8LMB8-F1-model_v4 Putative pyridoxamine 5'-phosphate oxidase 0.9607 2 133 GO:0005829
GO:0016627
GO:0070967

Map