F450897

General Info

Members Datasets Scaffolds Average Seq Length
472 228 944 203

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0368533|Ga0501034_0368533_106_804
Length 232
Sequence VPSGVMRRNQKKFHSAPAGPGRRAATPYAPAMNWVLLTEVFVTLFVIMDPVGTIPIFLSLTGGRSAQVARRAAWQAVTVSFGVISAFAFFGQQILEYLHISLPALQCAGGLLLLLVALELLTGKEEGPTATADTNVALVPLGTPLLAGPGAIVATMVFSKKVDHVGEFAAVALGVILVHVALWLSMRFSLPILRLIRESGVMLVTRIAGLLLSAIAVQMVADAVRAFIAGEG

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
85 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
86 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
87 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
88 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
110 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
111 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
112 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2643221576 Nocardioides sp. Root614 Isolate Unclassified
209 2643221590 Nocardioides sp. Root682 Isolate Unclassified
210 2643221604 Nocardioides sp. Root190 Isolate Unclassified
211 2643221617 Nocardioides sp. Root79 Isolate Unclassified
212 2643221620 Nocardioides sp. Root240 Isolate Unclassified
213 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
214 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
215 2738541305 Nocardioides sp. CF167 Isolate Unclassified
216 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
217 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
218 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
219 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
220 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
221 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
222 2808606394 Promicromonospora sp. C35 Isolate Unclassified
223 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
224 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
225 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
226 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
227 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
228 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.49
Metatranscriptomes 1.06
Isolates 4.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.39
Nodule 0
Rhizoplane 4.66
Rhizosphere 87.08
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0368533 3300049571 Bacteria 1363
2 JGI24735J21928_10052895 3300002067 Bacteria 1171
3 rootL2_10219583 3300003322 Bacteria 1157
4 JGI25407J50210_10003792 3300003373 Bacteria 3651
5 Ga0006562J51391_1189941 3300003578 Bacteria 1120
6 JGI25405J52794_10034580 3300003911 Bacteria 1056
7 Ga0070658_10069780 3300005327 Bacteria 2876
8 Ga0070658_10092411 3300005327 Bacteria 2495
9 Ga0070658_10096172 3300005327 Bacteria 2445
10 Ga0070658_10119983 3300005327 Bacteria 2185
11 Ga0070658_10174717 3300005327 Bacteria 1806
12 Ga0070683_100020930 3300005329 Bacteria 5832
13 Ga0070683_100077502 3300005329 Bacteria 3108
14 Ga0070683_100632007 3300005329 Bacteria 1025
15 Ga0070683_100902122 3300005329 Bacteria 848
16 Ga0070690_100129586 3300005330 Bacteria 1702
17 Ga0070670_100859801 3300005331 Bacteria 821
18 Ga0068869_100056996 3300005334 Bacteria 2851
19 Ga0070680_100000155 3300005336 Bacteria 42668
20 Ga0070680_100154810 3300005336 Bacteria 1925
21 Ga0070682_100016917 3300005337 Bacteria 4244
22 Ga0068868_100053634 3300005338 Bacteria 3176
23 Ga0068868_100445821 3300005338 Bacteria 1125
24 Ga0070660_100051052 3300005339 Bacteria 3184
25 Ga0070660_100055192 3300005339 Bacteria 3070
26 Ga0070660_100231129 3300005339 Bacteria 1505
27 Ga0070689_100497105 3300005340 Bacteria 1044
28 Ga0070675_100935065 3300005354 Bacteria 795
29 Ga0070659_100000118 3300005366 Bacteria 59407
30 Ga0070659_100014661 3300005366 Bacteria 5861
31 Ga0070714_100011712 3300005435 Bacteria 6967
32 Ga0070714_100045113 3300005435 Bacteria 3734
33 Ga0070705_100414277 3300005440 Bacteria 1001
34 Ga0070678_100161729 3300005456 Bacteria 1815
35 Ga0070681_10000109 3300005458 Bacteria 61563
36 Ga0070681_10051450 3300005458 Bacteria 4109
37 Ga0070681_10056474 3300005458 Bacteria 3907
38 Ga0070685_10062428 3300005466 Bacteria 2185
39 Ga0070698_100001164 3300005471 Bacteria 29171
40 Ga0070679_100000237 3300005530 Bacteria 45794
41 Ga0070679_100004104 3300005530 Bacteria 13426
42 Ga0070679_100014097 3300005530 Bacteria 7666
43 Ga0070679_100247386 3300005530 Bacteria 1740
44 Ga0070684_100099609 3300005535 Bacteria 2594
45 Ga0070684_100119294 3300005535 Bacteria 2372
46 Ga0070684_100191324 3300005535 Bacteria 1862
47 Ga0070684_100223251 3300005535 Bacteria 1719
48 Ga0070684_100229695 3300005535 Bacteria 1694
49 Ga0070665_100000482 3300005548 Bacteria 57252
50 Ga0068855_100076140 3300005563 Bacteria 3895
51 Ga0070664_100015605 3300005564 Bacteria 6216
52 Ga0068857_100775749 3300005577 Bacteria 914
53 Ga0068856_100201258 3300005614 Bacteria 2006
54 Ga0068864_100701093 3300005618 Bacteria 989
55 Ga0068864_100722563 3300005618 Bacteria 974
56 Ga0081455_10000884 3300005937 Bacteria 38841
57 Ga0081455_10187997 3300005937 Bacteria 1558
58 Ga0081538_10000095 3300005981 Bacteria 86487
59 Ga0075365_10004237 3300006038 Bacteria 7561
60 Ga0075365_10038363 3300006038 Bacteria 3113
61 Ga0075365_10294027 3300006038 Bacteria 1143
62 Ga0075365_10426005 3300006038 Bacteria 937
63 Ga0075363_100050060 3300006048 Bacteria 2226
64 Ga0075363_100133678 3300006048 Bacteria 1393
65 Ga0075364_10305601 3300006051 Bacteria 1083
66 Ga0075364_10356028 3300006051 Bacteria 998
67 Ga0075428_100001540 3300006844 Bacteria 24687
68 Ga0075428_100014606 3300006844 Bacteria 8722
69 Ga0075428_100810286 3300006844 Bacteria 995
70 Ga0075430_100020073 3300006846 Bacteria 5687
71 Ga0075430_100021799 3300006846 Bacteria 5446
72 Ga0075431_100000338 3300006847 Bacteria 36930
73 Ga0075431_100001048 3300006847 Bacteria 24677
74 Ga0075431_100010306 3300006847 Bacteria 9389
75 Ga0075431_100436600 3300006847 Bacteria 1307
76 Ga0075433_10081332 3300006852 Bacteria 2856
77 Ga0075434_100448299 3300006871 Bacteria 1312
78 Ga0075429_100000071 3300006880 Bacteria 51057
79 Ga0075429_100000366 3300006880 Bacteria 33350
80 Ga0068865_100127023 3300006881 Bacteria 1905
81 Ga0111539_10013903 3300009094 Bacteria 10063
82 Ga0111539_10114497 3300009094 Bacteria 3163
83 Ga0105245_10230759 3300009098 Bacteria 1790
84 Ga0105245_10451469 3300009098 Bacteria 1294
85 Ga0114129_10003185 3300009147 Bacteria 23009
86 Ga0114129_10009116 3300009147 Bacteria 14144
87 Ga0105239_10073228 3300010375 Bacteria 3766
88 Ga0105246_10154938 3300011119 Bacteria 1739
89 Ga0157369_10002237 3300013105 Bacteria 23285
90 Ga0157369_10336307 3300013105 Bacteria 1569
91 Ga0157374_11506061 3300013296 Bacteria 696
92 Ga0157372_10052631 3300013307 Bacteria 4534
93 Ga0157372_10160010 3300013307 Bacteria 2602
94 Ga0157372_10405865 3300013307 Bacteria 1588
95 Ga0157372_10756055 3300013307 Bacteria 1130
96 Ga0157372_10914312 3300013307 Bacteria 1018
97 Ga0157375_10199939 3300013308 Bacteria 2154
98 Ga0157375_10403603 3300013308 Bacteria 1533
99 Ga0157380_10954018 3300014326 Bacteria 888
100 Ga0182008_10109913 3300014497 Bacteria 1366
101 Ga0182008_10169875 3300014497 Bacteria 1100
102 Ga0157377_10326541 3300014745 Bacteria 1021
103 Ga0163161_10023306 3300017792 Bacteria 4367
104 Ga0163161_10171378 3300017792 Bacteria 1660
105 Ga0206354_11310668 3300020081 Bacteria 1663
106 Ga0206353_10352587 3300020082 Bacteria 1675
107 Ga0206353_10401723 3300020082 Bacteria 2814
108 Ga0206353_10722999 3300020082 Bacteria 2777
109 Ga0213876_10002860 3300021384 Bacteria 10032
110 Ga0207647_10009800 3300025904 Bacteria 6794
111 Ga0207647_10017451 3300025904 Bacteria 4878
112 Ga0207647_10415159 3300025904 Bacteria 757
113 Ga0207705_10067915 3300025909 Bacteria 2580
114 Ga0207705_10087908 3300025909 Bacteria 2273
115 Ga0207705_10156286 3300025909 Bacteria 1711
116 Ga0207707_10000290 3300025912 Bacteria 53506
117 Ga0207660_10000152 3300025917 Bacteria 42671
118 Ga0207660_10018779 3300025917 Bacteria 4614
119 Ga0207660_10118926 3300025917 Bacteria 1999
120 Ga0207662_10081413 3300025918 Bacteria 1976
121 Ga0207657_10057124 3300025919 Bacteria 3364
122 Ga0207657_10099392 3300025919 Bacteria 2417
123 Ga0207657_10297157 3300025919 Bacteria 1280
124 Ga0207657_10344592 3300025919 Bacteria 1176
125 Ga0207652_10000185 3300025921 Bacteria 66048
126 Ga0207652_10008205 3300025921 Bacteria 8386
127 Ga0207652_10008463 3300025921 Bacteria 8276
128 Ga0207652_10741705 3300025921 Bacteria 874
129 Ga0207687_10151807 3300025927 Bacteria 1768
130 Ga0207690_10000065 3300025932 Bacteria 94536
131 Ga0207690_10057307 3300025932 Bacteria 2632
132 Ga0207709_10292310 3300025935 Bacteria 1208
133 Ga0207704_10105324 3300025938 Bacteria 1891
134 Ga0207691_10269904 3300025940 Bacteria 1465
135 Ga0207689_10071157 3300025942 Bacteria 2857
136 Ga0207661_10021977 3300025944 Bacteria 4793
137 Ga0207661_10065864 3300025944 Bacteria 2942
138 Ga0207661_10116761 3300025944 Bacteria 2266
139 Ga0207661_10164785 3300025944 Bacteria 1925
140 Ga0207661_10852106 3300025944 Bacteria 839
141 Ga0207679_10551693 3300025945 Bacteria 1034
142 Ga0207667_10111752 3300025949 Bacteria 2818
143 Ga0207667_10986029 3300025949 Bacteria 831
144 Ga0207640_10466960 3300025981 Bacteria 1044
145 Ga0207678_10061741 3300026067 Bacteria 3223
146 Ga0207678_10093813 3300026067 Bacteria 2564
147 Ga0207648_10180398 3300026089 Bacteria 1869
148 Ga0207676_10682580 3300026095 Bacteria 994
149 Ga0207683_10034304 3300026121 Bacteria 4409
150 Ga0207683_10223173 3300026121 Bacteria 1717
151 Ga0207683_11111221 3300026121 Bacteria 733
152 Ga0207428_10000799 3300027907 Bacteria 35638
153 Ga0268266_10002733 3300028379 Bacteria 18462
154 Ga0316177_1214384 3300030731 Bacteria 1289
155 Ga0316176_1125957 3300030732 Bacteria 1573
156 Ga0314311_1072290 3300030733 Bacteria 2589
157 Ga0314311_1226052 3300030733 Bacteria 1498
158 Ga0316179_1069728 3300030734 Bacteria 1540
159 Ga0316180_1042685 3300030736 Bacteria 952
160 Ga0307408_100599349 3300031548 Bacteria 979
161 Ga0316579_10046722 3300031691 Unclassified 2020
162 Ga0307405_10900127 3300031731 Bacteria 748
163 Ga0307410_10228504 3300031852 Bacteria 1435
164 Ga0307410_10459685 3300031852 Bacteria 1040
165 Ga0307406_10154131 3300031901 Bacteria 1643
166 Ga0307407_10012585 3300031903 Bacteria 4073
167 Ga0307412_10035257 3300031911 Bacteria 3195
168 Ga0307412_10608317 3300031911 Bacteria 927
169 Ga0307409_100031661 3300031995 Bacteria 3822
170 Ga0307409_100138230 3300031995 Bacteria 2095
171 Ga0307409_100143406 3300031995 Bacteria 2062
172 Ga0307409_100245380 3300031995 Bacteria 1633
173 Ga0307416_100106060 3300032002 Bacteria 2462
174 Ga0307416_100206357 3300032002 Bacteria 1870
175 Ga0307416_100575584 3300032002 Bacteria 1203
176 Ga0307416_100993237 3300032002 Bacteria 942
177 Ga0307416_101326170 3300032002 Bacteria 825
178 Ga0307415_100120443 3300032126 Bacteria 1966
179 Ga0307415_100335110 3300032126 Bacteria 1267
180 Ga0316583_10113473 3300032133 Bacteria 945
181 Ga0373946_0232909 3300035171 Unclassified 893
182 Ga0316574_0575569 3300035398 Bacteria 697
183 Ga0316584_0217526 3300036712 Bacteria 1405
184 Ga0373925_0873004 3300037068 Unclassified 741
185 Ga0395899_0258945 3300037312 Bacteria 1191
186 Ga0395900_0067015 3300037418 Bacteria 3689
187 Ga0395900_0589338 3300037418 Bacteria 1053
188 Ga0395898_0160143 3300037466 Bacteria 2153
189 Ga0395898_0690670 3300037466 Bacteria 962
190 Ga0395905_0013024 3300037471 Bacteria 7991
191 Ga0395905_0108603 3300037471 Bacteria 2605
192 Ga0395905_0828289 3300037471 Bacteria 828
193 Ga0395901_0106677 3300038443 Bacteria 2940
194 Ga0395901_0351671 3300038443 Bacteria 1521
195 Ga0395901_0734861 3300038443 Bacteria 981
196 Ga0439436_0059261 3300041404 Bacteria 1073
197 Ga0439438_048518 3300041405 Bacteria 1086
198 Ga0439447_031721 3300041407 Bacteria 1325
199 Ga0439461_0019565 3300041410 Bacteria 1334
200 Ga0439466_0083118 3300041411 Bacteria 1009
201 Ga0451800_1620114 3300041459 Bacteria 728
202 Ga0451837_1703840 3300041494 Bacteria 725
203 Ga0451841_0750684 3300041498 Bacteria 773
204 Ga0439431_0004521 3300041997 Bacteria 3059
205 Ga0439446_0007015 3300042156 Bacteria 2951
206 Ga0466969_0010007 3300044656 Bacteria 5029
207 Ga0466972_0023258 3300044658 Bacteria 3082
208 Ga0466972_0137686 3300044658 Bacteria 1149
209 Ga0466965_0061359 3300044683 Bacteria 1879
210 Ga0466965_0066335 3300044683 Bacteria 1809
211 Ga0466966_0020019 3300044684 Bacteria 4402
212 Ga0466966_0062430 3300044684 Bacteria 2349
213 Ga0466961_0008262 3300044693 Bacteria 6631
214 Ga0466961_0011211 3300044693 Bacteria 5732
215 Ga0466961_0036731 3300044693 Bacteria 3144
216 Ga0466961_0045021 3300044693 Bacteria 2824
217 Ga0466961_0057404 3300044693 Bacteria 2478
218 Ga0466961_0122121 3300044693 Bacteria 1635
219 Ga0466961_0227042 3300044693 Bacteria 1150
220 Ga0466961_0236784 3300044693 Bacteria 1123
221 Ga0466961_0306508 3300044693 Bacteria 969
222 Ga0466963_0005938 3300044694 Bacteria 7189
223 Ga0466963_0066609 3300044694 Bacteria 2416
224 Ga0466963_0085513 3300044694 Bacteria 2141
225 Ga0466963_0088071 3300044694 Bacteria 2112
226 Ga0466963_0171271 3300044694 Bacteria 1514
227 Ga0466963_0191421 3300044694 Bacteria 1429
228 Ga0466963_0306256 3300044694 Bacteria 1118
229 Ga0466963_0533467 3300044694 Bacteria 829
230 Ga0466964_0077464 3300044706 Bacteria 1420
231 Ga0466964_0111418 3300044706 Bacteria 1221
232 Ga0466964_0164046 3300044706 Bacteria 1041
233 Ga0466964_0380407 3300044706 Bacteria 733
234 Ga0466971_0017891 3300044719 Bacteria 3139
235 Ga0466971_0120847 3300044719 Bacteria 1212
236 Ga0466971_0136817 3300044719 Bacteria 1140
237 Ga0466968_0032185 3300044735 Bacteria 2180
238 Ga0466968_0136040 3300044735 Bacteria 1121
239 Ga0466968_0189160 3300044735 Bacteria 960
240 Ga0466970_0005766 3300044765 Bacteria 6155
241 Ga0466970_0012365 3300044765 Bacteria 4363
242 Ga0466970_0013731 3300044765 Bacteria 4153
243 Ga0466970_0060465 3300044765 Bacteria 2029
244 Ga0466970_0297016 3300044765 Bacteria 910
245 Ga0466970_0422067 3300044765 Bacteria 763
246 Ga0466957_0029034 3300044842 Bacteria 3295
247 Ga0466957_0037034 3300044842 Bacteria 2936
248 Ga0466957_0043919 3300044842 Bacteria 2708
249 Ga0466957_0085881 3300044842 Bacteria 1966
250 Ga0466957_0144002 3300044842 Bacteria 1537
251 Ga0466957_0288369 3300044842 Bacteria 1100
252 Ga0466957_0674541 3300044842 Bacteria 728
253 Ga0466960_0004782 3300044901 Bacteria 5319
254 Ga0466960_0007150 3300044901 Bacteria 4516
255 Ga0466960_0055925 3300044901 Bacteria 1920
256 Ga0466960_0083566 3300044901 Bacteria 1614
257 Ga0466960_0131749 3300044901 Bacteria 1320
258 Ga0466960_0220393 3300044901 Bacteria 1044
259 Ga0466960_0281226 3300044901 Bacteria 933
260 Ga0466960_0351882 3300044901 Bacteria 840
261 Ga0466959_0016728 3300045049 Bacteria 5365
262 Ga0466959_0114876 3300045049 Bacteria 1918
263 Ga0466958_0021395 3300045836 Bacteria 3779
264 Ga0466958_0023304 3300045836 Bacteria 3632
265 Ga0466958_0063214 3300045836 Bacteria 2257
266 Ga0466967_0016504 3300045976 Bacteria 5826
267 Ga0466967_0035548 3300045976 Bacteria 4243
268 Ga0466967_0036619 3300045976 Bacteria 4190
269 Ga0466967_0039643 3300045976 Bacteria 4051
270 Ga0466967_0067309 3300045976 Bacteria 3194
271 Ga0466967_0126508 3300045976 Bacteria 2368
272 Ga0466967_0195833 3300045976 Bacteria 1911
273 Ga0466967_0214444 3300045976 Bacteria 1827
274 Ga0466967_0222938 3300045976 Bacteria 1792
275 Ga0466967_0233146 3300045976 Bacteria 1753
276 Ga0466967_0430699 3300045976 Bacteria 1287
277 Ga0466967_0974915 3300045976 Bacteria 844
278 Ga0495603_0127356 3300046455 Bacteria 1484
279 Ga0495629_0188465 3300046459 Unclassified 1428
280 Ga0495653_0115051 3300046463 Bacteria 1926
281 Ga0495580_0006222 3300046472 Bacteria 9753
282 Ga0495582_0019348 3300046473 Bacteria 3722
283 Ga0495664_0148149 3300046477 Bacteria 1423
284 Ga0495608_0527100 3300046511 Bacteria 714
285 Ga0495635_0138942 3300046663 Bacteria 1655
286 Ga0495635_0375157 3300046663 Bacteria 947
287 Ga0495658_0000143 3300046683 Bacteria 39833
288 Ga0495581_0043107 3300047315 Bacteria 2611
289 Ga0495581_0229709 3300047315 Unclassified 1085
290 Ga0495685_172564 3300047447 Bacteria 698
291 Ga0495593_0248405 3300047673 Bacteria 891
292 Ga0496101_0051023 3300048904 Bacteria 2980
293 Ga0496102_0092304 3300048905 Bacteria 2803
294 Ga0496102_0103563 3300048905 Bacteria 2647
295 Ga0496102_0332179 3300048905 Bacteria 1432
296 Ga0496102_0535593 3300048905 Bacteria 1094
297 Ga0496104_0266164 3300048907 Bacteria 1626
298 Ga0496106_0089453 3300048909 Bacteria 2374
299 Ga0496107_0063027 3300048910 Bacteria 2686
300 Ga0496108_0054952 3300048911 Bacteria 3342
301 Ga0496108_0212593 3300048911 Bacteria 1679
302 Ga0496108_0557140 3300048911 Bacteria 1000
303 Ga0496109_0183213 3300048912 Bacteria 1967
304 Ga0496109_0200570 3300048912 Bacteria 1875
305 Ga0496110_0064261 3300048913 Bacteria 3243
306 Ga0496110_0354586 3300048913 Bacteria 1336
307 Ga0496113_0009335 3300048916 Bacteria 6432
308 Ga0496113_0439334 3300048916 Bacteria 1048
309 Ga0496113_0823537 3300048916 Bacteria 737
310 Ga0496114_0210424 3300048917 Bacteria 1705
311 Ga0496114_0448960 3300048917 Bacteria 1142
312 Ga0496115_0205882 3300048918 Bacteria 1625
313 Ga0501031_0055924 3300049568 Bacteria 2571
314 Ga0501031_0201477 3300049568 Bacteria 1298
315 Ga0501032_0020296 3300049569 Bacteria 4630
316 Ga0501032_0182107 3300049569 Bacteria 1375
317 Ga0501033_0000762 3300049570 Bacteria 29642
318 Ga0501034_0007108 3300049571 Bacteria 11942
319 Ga0501034_0095551 3300049571 Bacteria 2968
320 Ga0501034_0102082 3300049571 Bacteria 2861
321 Ga0501034_0489673 3300049571 Bacteria 1144
322 Ga0501036_0038620 3300049572 Bacteria 4040
323 Ga0501036_0119531 3300049572 Bacteria 2225
324 Ga0501036_0228320 3300049572 Bacteria 1562
325 Ga0501036_0280335 3300049572 Bacteria 1395
326 Ga0501036_0687128 3300049572 Bacteria 846
327 Ga0501036_0836092 3300049572 Bacteria 757
328 Ga0501037_0040161 3300049573 Bacteria 3443
329 Ga0501037_0048150 3300049573 Bacteria 3124
330 Ga0501037_0051072 3300049573 Bacteria 3024
331 Ga0501038_0006608 3300049574 Bacteria 10727
332 Ga0501038_0015841 3300049574 Bacteria 6850
333 Ga0501038_0052667 3300049574 Bacteria 3508
334 Ga0501038_0146109 3300049574 Bacteria 1931
335 Ga0501039_0043569 3300049575 Bacteria 3466
336 Ga0501039_0048433 3300049575 Bacteria 3285
337 Ga0501039_0056267 3300049575 Bacteria 3047
338 Ga0501039_0716196 3300049575 Bacteria 782
339 Ga0501040_0158140 3300049576 Bacteria 1601
340 Ga0501041_0022811 3300049577 Bacteria 3750
341 Ga0501041_0317382 3300049577 Bacteria 983
342 Ga0501041_0474080 3300049577 Bacteria 795
343 Ga0501041_0532704 3300049577 Bacteria 748
344 Ga0501042_0028214 3300049578 Bacteria 3952
345 Ga0501042_0046259 3300049578 Bacteria 3102
346 Ga0501042_0161119 3300049578 Bacteria 1619
347 Ga0501042_0419255 3300049578 Bacteria 970
348 Ga0501042_0689001 3300049578 Bacteria 743
349 Ga0501043_0260419 3300049579 Bacteria 1334
350 Ga0501046_0001888 3300049580 Bacteria 19916
351 Ga0501046_0006718 3300049580 Bacteria 10157
352 Ga0501047_0025156 3300049581 Bacteria 5719
353 Ga0501047_0036655 3300049581 Bacteria 4740
354 Ga0501047_0136219 3300049581 Bacteria 2336
355 Ga0501048_0005064 3300049582 Bacteria 10043
356 Ga0501048_0028273 3300049582 Bacteria 4070
357 Ga0501067_0001580 3300049583 Bacteria 12466
358 Ga0501067_0003346 3300049583 Bacteria 8809
359 Ga0501067_0016293 3300049583 Bacteria 4107
360 Ga0501067_0042401 3300049583 Bacteria 2526
361 Ga0501067_0071323 3300049583 Bacteria 1924
362 Ga0501067_0115711 3300049583 Bacteria 1491
363 Ga0501067_0128055 3300049583 Bacteria 1413
364 Ga0501067_0219673 3300049583 Bacteria 1058
365 Ga0501067_0336888 3300049583 Bacteria 840
366 Ga0501068_0002796 3300049584 Bacteria 9283
367 Ga0501068_0008941 3300049584 Bacteria 5591
368 Ga0501068_0381766 3300049584 Bacteria 907
369 Ga0501069_0014193 3300049585 Bacteria 4255
370 Ga0501069_0086362 3300049585 Bacteria 1771
371 Ga0501069_0125341 3300049585 Bacteria 1469
372 Ga0501069_0140163 3300049585 Bacteria 1387
373 Ga0501069_0335151 3300049585 Bacteria 890
374 Ga0501070_0000628 3300049586 Bacteria 32441
375 Ga0501070_0015750 3300049586 Bacteria 6358
376 Ga0501070_0021212 3300049586 Bacteria 5453
377 Ga0501070_0251769 3300049586 Bacteria 1445
378 Ga0501070_0401966 3300049586 Bacteria 1108
379 Ga0501070_0402712 3300049586 Bacteria 1106
380 Ga0501070_0409888 3300049586 Bacteria 1095
381 Ga0501071_0005339 3300049587 Bacteria 8250
382 Ga0501071_0107148 3300049587 Bacteria 2063
383 Ga0501071_0934469 3300049587 Bacteria 669
384 Ga0501072_0007764 3300049588 Bacteria 8145
385 Ga0501072_0020134 3300049588 Bacteria 5166
386 Ga0501072_0029303 3300049588 Bacteria 4299
387 Ga0501072_0237618 3300049588 Bacteria 1451
388 Ga0501072_0258776 3300049588 Bacteria 1385
389 Ga0501073_0010030 3300049589 Bacteria 6963
390 Ga0501073_0031343 3300049589 Bacteria 3793
391 Ga0501073_0135932 3300049589 Bacteria 1704
392 Ga0501073_0157015 3300049589 Bacteria 1576
393 Ga0501073_0274493 3300049589 Bacteria 1163
394 Ga0501074_0000472 3300049590 Bacteria 24338
395 Ga0501074_0015260 3300049590 Bacteria 5583
396 Ga0501074_0053875 3300049590 Bacteria 2901
397 Ga0501074_0111423 3300049590 Bacteria 1958
398 Ga0501075_0156762 3300049591 Bacteria 1736
399 Ga0501075_0312379 3300049591 Bacteria 1198
400 Ga0501075_0377397 3300049591 Bacteria 1081
401 Ga0501076_0193475 3300049592 Bacteria 1660
402 Ga0501077_0009390 3300049593 Bacteria 6077
403 Ga0501077_0152373 3300049593 Bacteria 1467
404 Ga0501079_0014802 3300049741 Bacteria 5947
405 Ga0501079_0140934 3300049741 Bacteria 1878
406 Ga0501080_0003999 3300049742 Bacteria 13050
407 Ga0501080_0049782 3300049742 Bacteria 3900
408 Ga0501080_0050280 3300049742 Bacteria 3881
409 Ga0501080_0361774 3300049742 Bacteria 1309
410 Ga0501080_0954075 3300049742 Bacteria 745
411 Ga0501081_0011480 3300049743 Bacteria 5797
412 Ga0501083_0019945 3300049744 Bacteria 4666
413 Ga0501083_0022669 3300049744 Bacteria 4357
414 Ga0501035_0055958 3300049822 Bacteria 3521
415 Ga0501035_0092962 3300049822 Bacteria 2653
416 Ga0501035_0118226 3300049822 Bacteria 2319
417 Ga0501044_0104015 3300049823 Bacteria 2853
418 Ga0501044_0173563 3300049823 Bacteria 2126
419 Ga0501045_0271176 3300049824 Bacteria 1263
420 nmdc:mga03n38_18154_c1 3300050490 Bacteria 2771
421 nmdc:mga0yw44_23900_c1 3300050492 Bacteria 3450
422 nmdc:mga0yw44_491718_c1 3300050492 Bacteria 832
423 nmdc:mga0yw44_50886_c1 3300050492 Bacteria 2507
424 nmdc:mga0yw44_74670_c1 3300050492 Bacteria 2112
425 nmdc:mga05p37_20433_c1 3300050507 Bacteria 8010
426 nmdc:mga05p37_371_c1 3300050507 Bacteria 48241
427 nmdc:mga09592_277_c1 3300050508 Bacteria 37159
428 nmdc:mga09592_95238_c1 3300050508 Bacteria 2547
429 nmdc:mga0qj67_10363_c1 3300050509 Bacteria 6962
430 nmdc:mga0qj67_35314_c1 3300050509 Bacteria 3908
431 nmdc:mga06r32_19018_c1 3300050510 Bacteria 6298
432 nmdc:mga06r32_35_c1 3300050510 Bacteria 82946
433 nmdc:mga06r32_91143_c1 3300050510 Bacteria 2979
434 nmdc:mga08y16_3166_c1 3300050511 Bacteria 17044
435 nmdc:mga0n895_417653_c1 3300050512 Bacteria 1356
436 Ga0495601_0060854 3300053077 Bacteria 2396
437 Ga0495595_0067229 3300053084 Bacteria 1689
438 Ga0500559_0005902 3300053136 Bacteria 5577
439 Ga0500568_0086691 3300053139 Bacteria 1184
440 Ga0500620_036277 3300053155 Bacteria 1594
441 Ga0501084_0035080 3300054114 Bacteria 4193
442 Ga0501084_0098330 3300054114 Bacteria 2457
443 Ga0501084_0180664 3300054114 Bacteria 1781
444 Ga0590074_036675 3300059423 Bacteria 876
445 Ga0590077_034451 3300059426 Bacteria 1113
446 Ga0501082_0027243 3300060353 Bacteria 4921
447 Ga0501082_0048058 3300060353 Bacteria 3677
448 Ga0466962_0006751 3300061719 Bacteria 5504
449 Ga0466962_0015924 3300061719 Bacteria 3629
450 Ga0530510_0042022 3300061734 Bacteria 3302
451 Ga0530510_0295551 3300061734 Bacteria 1212
452 2643889791 2643221576 Bacteria 5214352
453 2643958847 2643221590 Bacteria 5214697
454 2644035197 2643221604 Bacteria 5014917
455 2644099415 2643221617 Bacteria 5139111
456 2644116391 2643221620 Bacteria 5134593
457 2731908236 2731639228 Bacteria 4187555
458 2738693598 2738541272 Bacteria 6848551
459 2738867611 2738541305 Bacteria 4910150
460 2739322991 2738543027 Bacteria 6409078
461 2739607575 2739367654 Bacteria 6049412
462 2760304535 2758568522 Bacteria 5953541
463 2760621669 2758568621 Bacteria 5967089
464 2774396590 2773857762 Bacteria 5971770
465 2799185455 2799112218 Bacteria 4315149
466 2809026458 2808606394 Bacteria 6248540
467 2809198254 2808606439 Bacteria 5952208
468 2812331859 2811994874 Bacteria 5367947
469 2855389218 2855386786 Bacteria 4752232
470 2857484973 2857481737 Bacteria 4761446
471 2891969299 2891968417 Bacteria 5821697
472 8056583381 8056579771 Bacteria 5840325
473 Ga0501034_0368533
474 JGI24735J21928_10052895
475 rootL2_10219583
476 JGI25407J50210_10003792
477 Ga0006562J51391_1189941
478 JGI25405J52794_10034580
479 Ga0070658_10069780
480 Ga0070658_10092411
481 Ga0070658_10096172
482 Ga0070658_10119983
483 Ga0070658_10174717
484 Ga0070683_100020930
485 Ga0070683_100077502
486 Ga0070683_100632007
487 Ga0070683_100902122
488 Ga0070690_100129586
489 Ga0070670_100859801
490 Ga0068869_100056996
491 Ga0070680_100000155
492 Ga0070680_100154810
493 Ga0070682_100016917
494 Ga0068868_100053634
495 Ga0068868_100445821
496 Ga0070660_100051052
497 Ga0070660_100055192
498 Ga0070660_100231129
499 Ga0070689_100497105
500 Ga0070675_100935065
501 Ga0070659_100000118
502 Ga0070659_100014661
503 Ga0070714_100011712
504 Ga0070714_100045113
505 Ga0070705_100414277
506 Ga0070678_100161729
507 Ga0070681_10000109
508 Ga0070681_10051450
509 Ga0070681_10056474
510 Ga0070685_10062428
511 Ga0070698_100001164
512 Ga0070679_100000237
513 Ga0070679_100004104
514 Ga0070679_100014097
515 Ga0070679_100247386
516 Ga0070684_100099609
517 Ga0070684_100119294
518 Ga0070684_100191324
519 Ga0070684_100223251
520 Ga0070684_100229695
521 Ga0070665_100000482
522 Ga0068855_100076140
523 Ga0070664_100015605
524 Ga0068857_100775749
525 Ga0068856_100201258
526 Ga0068864_100701093
527 Ga0068864_100722563
528 Ga0081455_10000884
529 Ga0081455_10187997
530 Ga0081538_10000095
531 Ga0075365_10004237
532 Ga0075365_10038363
533 Ga0075365_10294027
534 Ga0075365_10426005
535 Ga0075363_100050060
536 Ga0075363_100133678
537 Ga0075364_10305601
538 Ga0075364_10356028
539 Ga0075428_100001540
540 Ga0075428_100014606
541 Ga0075428_100810286
542 Ga0075430_100020073
543 Ga0075430_100021799
544 Ga0075431_100000338
545 Ga0075431_100001048
546 Ga0075431_100010306
547 Ga0075431_100436600
548 Ga0075433_10081332
549 Ga0075434_100448299
550 Ga0075429_100000071
551 Ga0075429_100000366
552 Ga0068865_100127023
553 Ga0111539_10013903
554 Ga0111539_10114497
555 Ga0105245_10230759
556 Ga0105245_10451469
557 Ga0114129_10003185
558 Ga0114129_10009116
559 Ga0105239_10073228
560 Ga0105246_10154938
561 Ga0157369_10002237
562 Ga0157369_10336307
563 Ga0157374_11506061
564 Ga0157372_10052631
565 Ga0157372_10160010
566 Ga0157372_10405865
567 Ga0157372_10756055
568 Ga0157372_10914312
569 Ga0157375_10199939
570 Ga0157375_10403603
571 Ga0157380_10954018
572 Ga0182008_10109913
573 Ga0182008_10169875
574 Ga0157377_10326541
575 Ga0163161_10023306
576 Ga0163161_10171378
577 Ga0206354_11310668
578 Ga0206353_10352587
579 Ga0206353_10401723
580 Ga0206353_10722999
581 Ga0213876_10002860
582 Ga0207647_10009800
583 Ga0207647_10017451
584 Ga0207647_10415159
585 Ga0207705_10067915
586 Ga0207705_10087908
587 Ga0207705_10156286
588 Ga0207707_10000290
589 Ga0207660_10000152
590 Ga0207660_10018779
591 Ga0207660_10118926
592 Ga0207662_10081413
593 Ga0207657_10057124
594 Ga0207657_10099392
595 Ga0207657_10297157
596 Ga0207657_10344592
597 Ga0207652_10000185
598 Ga0207652_10008205
599 Ga0207652_10008463
600 Ga0207652_10741705
601 Ga0207687_10151807
602 Ga0207690_10000065
603 Ga0207690_10057307
604 Ga0207709_10292310
605 Ga0207704_10105324
606 Ga0207691_10269904
607 Ga0207689_10071157
608 Ga0207661_10021977
609 Ga0207661_10065864
610 Ga0207661_10116761
611 Ga0207661_10164785
612 Ga0207661_10852106
613 Ga0207679_10551693
614 Ga0207667_10111752
615 Ga0207667_10986029
616 Ga0207640_10466960
617 Ga0207678_10061741
618 Ga0207678_10093813
619 Ga0207648_10180398
620 Ga0207676_10682580
621 Ga0207683_10034304
622 Ga0207683_10223173
623 Ga0207683_11111221
624 Ga0207428_10000799
625 Ga0268266_10002733
626 Ga0316177_1214384
627 Ga0316176_1125957
628 Ga0314311_1072290
629 Ga0314311_1226052
630 Ga0316179_1069728
631 Ga0316180_1042685
632 Ga0307408_100599349
633 Ga0316579_10046722
634 Ga0307405_10900127
635 Ga0307410_10228504
636 Ga0307410_10459685
637 Ga0307406_10154131
638 Ga0307407_10012585
639 Ga0307412_10035257
640 Ga0307412_10608317
641 Ga0307409_100031661
642 Ga0307409_100138230
643 Ga0307409_100143406
644 Ga0307409_100245380
645 Ga0307416_100106060
646 Ga0307416_100206357
647 Ga0307416_100575584
648 Ga0307416_100993237
649 Ga0307416_101326170
650 Ga0307415_100120443
651 Ga0307415_100335110
652 Ga0316583_10113473
653 Ga0373946_0232909
654 Ga0316574_0575569
655 Ga0316584_0217526
656 Ga0373925_0873004
657 Ga0395899_0258945
658 Ga0395900_0067015
659 Ga0395900_0589338
660 Ga0395898_0160143
661 Ga0395898_0690670
662 Ga0395905_0013024
663 Ga0395905_0108603
664 Ga0395905_0828289
665 Ga0395901_0106677
666 Ga0395901_0351671
667 Ga0395901_0734861
668 Ga0439436_0059261
669 Ga0439438_048518
670 Ga0439447_031721
671 Ga0439461_0019565
672 Ga0439466_0083118
673 Ga0451800_1620114
674 Ga0451837_1703840
675 Ga0451841_0750684
676 Ga0439431_0004521
677 Ga0439446_0007015
678 Ga0466969_0010007
679 Ga0466972_0023258
680 Ga0466972_0137686
681 Ga0466965_0061359
682 Ga0466965_0066335
683 Ga0466966_0020019
684 Ga0466966_0062430
685 Ga0466961_0008262
686 Ga0466961_0011211
687 Ga0466961_0036731
688 Ga0466961_0045021
689 Ga0466961_0057404
690 Ga0466961_0122121
691 Ga0466961_0227042
692 Ga0466961_0236784
693 Ga0466961_0306508
694 Ga0466963_0005938
695 Ga0466963_0066609
696 Ga0466963_0085513
697 Ga0466963_0088071
698 Ga0466963_0171271
699 Ga0466963_0191421
700 Ga0466963_0306256
701 Ga0466963_0533467
702 Ga0466964_0077464
703 Ga0466964_0111418
704 Ga0466964_0164046
705 Ga0466964_0380407
706 Ga0466971_0017891
707 Ga0466971_0120847
708 Ga0466971_0136817
709 Ga0466968_0032185
710 Ga0466968_0136040
711 Ga0466968_0189160
712 Ga0466970_0005766
713 Ga0466970_0012365
714 Ga0466970_0013731
715 Ga0466970_0060465
716 Ga0466970_0297016
717 Ga0466970_0422067
718 Ga0466957_0029034
719 Ga0466957_0037034
720 Ga0466957_0043919
721 Ga0466957_0085881
722 Ga0466957_0144002
723 Ga0466957_0288369
724 Ga0466957_0674541
725 Ga0466960_0004782
726 Ga0466960_0007150
727 Ga0466960_0055925
728 Ga0466960_0083566
729 Ga0466960_0131749
730 Ga0466960_0220393
731 Ga0466960_0281226
732 Ga0466960_0351882
733 Ga0466959_0016728
734 Ga0466959_0114876
735 Ga0466958_0021395
736 Ga0466958_0023304
737 Ga0466958_0063214
738 Ga0466967_0016504
739 Ga0466967_0035548
740 Ga0466967_0036619
741 Ga0466967_0039643
742 Ga0466967_0067309
743 Ga0466967_0126508
744 Ga0466967_0195833
745 Ga0466967_0214444
746 Ga0466967_0222938
747 Ga0466967_0233146
748 Ga0466967_0430699
749 Ga0466967_0974915
750 Ga0495603_0127356
751 Ga0495629_0188465
752 Ga0495653_0115051
753 Ga0495580_0006222
754 Ga0495582_0019348
755 Ga0495664_0148149
756 Ga0495608_0527100
757 Ga0495635_0138942
758 Ga0495635_0375157
759 Ga0495658_0000143
760 Ga0495581_0043107
761 Ga0495581_0229709
762 Ga0495685_172564
763 Ga0495593_0248405
764 Ga0496101_0051023
765 Ga0496102_0092304
766 Ga0496102_0103563
767 Ga0496102_0332179
768 Ga0496102_0535593
769 Ga0496104_0266164
770 Ga0496106_0089453
771 Ga0496107_0063027
772 Ga0496108_0054952
773 Ga0496108_0212593
774 Ga0496108_0557140
775 Ga0496109_0183213
776 Ga0496109_0200570
777 Ga0496110_0064261
778 Ga0496110_0354586
779 Ga0496113_0009335
780 Ga0496113_0439334
781 Ga0496113_0823537
782 Ga0496114_0210424
783 Ga0496114_0448960
784 Ga0496115_0205882
785 Ga0501031_0055924
786 Ga0501031_0201477
787 Ga0501032_0020296
788 Ga0501032_0182107
789 Ga0501033_0000762
790 Ga0501034_0007108
791 Ga0501034_0095551
792 Ga0501034_0102082
793 Ga0501034_0489673
794 Ga0501036_0038620
795 Ga0501036_0119531
796 Ga0501036_0228320
797 Ga0501036_0280335
798 Ga0501036_0687128
799 Ga0501036_0836092
800 Ga0501037_0040161
801 Ga0501037_0048150
802 Ga0501037_0051072
803 Ga0501038_0006608
804 Ga0501038_0015841
805 Ga0501038_0052667
806 Ga0501038_0146109
807 Ga0501039_0043569
808 Ga0501039_0048433
809 Ga0501039_0056267
810 Ga0501039_0716196
811 Ga0501040_0158140
812 Ga0501041_0022811
813 Ga0501041_0317382
814 Ga0501041_0474080
815 Ga0501041_0532704
816 Ga0501042_0028214
817 Ga0501042_0046259
818 Ga0501042_0161119
819 Ga0501042_0419255
820 Ga0501042_0689001
821 Ga0501043_0260419
822 Ga0501046_0001888
823 Ga0501046_0006718
824 Ga0501047_0025156
825 Ga0501047_0036655
826 Ga0501047_0136219
827 Ga0501048_0005064
828 Ga0501048_0028273
829 Ga0501067_0001580
830 Ga0501067_0003346
831 Ga0501067_0016293
832 Ga0501067_0042401
833 Ga0501067_0071323
834 Ga0501067_0115711
835 Ga0501067_0128055
836 Ga0501067_0219673
837 Ga0501067_0336888
838 Ga0501068_0002796
839 Ga0501068_0008941
840 Ga0501068_0381766
841 Ga0501069_0014193
842 Ga0501069_0086362
843 Ga0501069_0125341
844 Ga0501069_0140163
845 Ga0501069_0335151
846 Ga0501070_0000628
847 Ga0501070_0015750
848 Ga0501070_0021212
849 Ga0501070_0251769
850 Ga0501070_0401966
851 Ga0501070_0402712
852 Ga0501070_0409888
853 Ga0501071_0005339
854 Ga0501071_0107148
855 Ga0501071_0934469
856 Ga0501072_0007764
857 Ga0501072_0020134
858 Ga0501072_0029303
859 Ga0501072_0237618
860 Ga0501072_0258776
861 Ga0501073_0010030
862 Ga0501073_0031343
863 Ga0501073_0135932
864 Ga0501073_0157015
865 Ga0501073_0274493
866 Ga0501074_0000472
867 Ga0501074_0015260
868 Ga0501074_0053875
869 Ga0501074_0111423
870 Ga0501075_0156762
871 Ga0501075_0312379
872 Ga0501075_0377397
873 Ga0501076_0193475
874 Ga0501077_0009390
875 Ga0501077_0152373
876 Ga0501079_0014802
877 Ga0501079_0140934
878 Ga0501080_0003999
879 Ga0501080_0049782
880 Ga0501080_0050280
881 Ga0501080_0361774
882 Ga0501080_0954075
883 Ga0501081_0011480
884 Ga0501083_0019945
885 Ga0501083_0022669
886 Ga0501035_0055958
887 Ga0501035_0092962
888 Ga0501035_0118226
889 Ga0501044_0104015
890 Ga0501044_0173563
891 Ga0501045_0271176
892 nmdc:mga03n38_18154_c1
893 nmdc:mga0yw44_23900_c1
894 nmdc:mga0yw44_491718_c1
895 nmdc:mga0yw44_50886_c1
896 nmdc:mga0yw44_74670_c1
897 nmdc:mga05p37_20433_c1
898 nmdc:mga05p37_371_c1
899 nmdc:mga09592_277_c1
900 nmdc:mga09592_95238_c1
901 nmdc:mga0qj67_10363_c1
902 nmdc:mga0qj67_35314_c1
903 nmdc:mga06r32_19018_c1
904 nmdc:mga06r32_35_c1
905 nmdc:mga06r32_91143_c1
906 nmdc:mga08y16_3166_c1
907 nmdc:mga0n895_417653_c1
908 Ga0495601_0060854
909 Ga0495595_0067229
910 Ga0500559_0005902
911 Ga0500568_0086691
912 Ga0500620_036277
913 Ga0501084_0035080
914 Ga0501084_0098330
915 Ga0501084_0180664
916 Ga0590074_036675
917 Ga0590077_034451
918 Ga0501082_0027243
919 Ga0501082_0048058
920 Ga0466962_0006751
921 Ga0466962_0015924
922 Ga0530510_0042022
923 Ga0530510_0295551
924 2643889791
925 2643958847
926 2644035197
927 2644099415
928 2644116391
929 2731908236
930 2738693598
931 2738867611
932 2739322991
933 2739607575
934 2760304535
935 2760621669
936 2774396590
937 2799185455
938 2809026458
939 2809198254
940 2812331859
941 2855389218
942 2857484973
943 2891969299
944 8056583381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01914

MarC

MarC family integral membrane protein

34

228

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvs-assembly1.cif.gz_A cryo-em structure of rat slc22a6 bound to tenofovir 0.516 5 184
7bp3-assembly1.cif.gz_B cryo-em structure of the human mct2 0.5083 1 189
8sc1-assembly1.cif.gz_A human oct1 (apo) in inward-open conformation 0.507 8 186
6ob6-assembly2.cif.gz_B human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4893 3 195
5oxp-assembly1.cif.gz_A peptst in occluded conformation with phosphate ion bound 0.4866 6 191
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5411 34 188 1.20.1250.20
af_O74902_81_490_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5394 5 188 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5299 34 188 1.20.1250.20
af_Q5A4J7_166_404_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5241 6 186 1.20.1250.20
af_A0A4V0IJT1_312_502_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5166 5 188 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A059W8V1-F1-model_v4 UPF0056 membrane protein 0.9407 5 199 GO:0005886
AF-S3ZD29-F1-model_v4 UPF0056 membrane protein 0.9311 1 199 GO:0005886
AF-A0A211YLC0-F1-model_v4 UPF0056 membrane protein 0.9247 5 196 GO:0005886
AF-A0A2J6H134-F1-model_v4 UPF0056 membrane protein 0.9229 5 194 GO:0005886
AF-Q59071-F1-model_v4 UPF0056 membrane protein MJ1677 0.921 1 197 GO:0005886

Map