F450882

General Info

Members Datasets Scaffolds Average Seq Length
472 213 458 269

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0161495|Ga0495625_0161495_232_1155
Length 307
Sequence MLIKWKLNSTFQLYNEFPNTKKNNLFLVSYGCAKIHPLLINLMIVFPNAKINIGINITGRRSDGYHNIETVFYPLPIYDALEALPGDELTFQSSGLDIPGRIEDNLCIKGYHLIKKDHDLPPVNIHLLKHIPIGAGLGGGSANAAFFIKLINNLFDLKLTTAEMLDYARQLGADCAFFIENKPLFAFEKGDQFESVNLDLSKYKIVLVMPPVHVSTSEAYRGVKPSSVKESLYELIAEPIQDWKHFVKNDFEDSVFKNHPVIRGVKAALYEAGAIYASMSGSGASVFGIFNKKPDLSELEKTNQVFY

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
3 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
4 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
5 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
6 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
7 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
8 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
9 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
10 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
11 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
12 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
13 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
14 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
150 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
164 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 0.21
Isolates 2.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.39
Nodule 0
Rhizoplane 0.42
Rhizosphere 92.58
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013045 3300001989 Bacteria 3040
2 JGI24737J22298_10066271 3300001990 Bacteria 1081
3 JGI25162J39368_1000017 3300002737 Bacteria 281385
4 JGI25164J39214_1001290 3300002772 Bacteria 6390
5 JGI25165J46597_1000615 3300003214 Bacteria 30104
6 rootH1_10126354 3300003316 Bacteria 5552
7 rootH2_10002594 3300003320 Bacteria 27151
8 rootH2_10078540 3300003320 Bacteria 6578
9 rootH2_10117586 3300003320 Bacteria 2892
10 rootH2_10278086 3300003320 Bacteria 1102
11 rootL2_10001050 3300003322 Bacteria 4640
12 rootL2_10202744 3300003322 Bacteria 1789
13 rootL2_10206086 3300003322 Bacteria 2131
14 Ga0058863_11417909 3300004799 Bacteria 1556
15 Ga0065714_10064842 3300005288 Bacteria 17197
16 Ga0065715_10006394 3300005293 Unclassified 4572
17 Ga0070658_10000018 3300005327 Bacteria 200558
18 Ga0070658_10000620 3300005327 Bacteria 30623
19 Ga0070658_10202834 3300005327 Bacteria 1674
20 Ga0070658_10334585 3300005327 Bacteria 1294
21 Ga0070658_10341186 3300005327 Bacteria 1281
22 Ga0070676_10002491 3300005328 Bacteria 9450
23 Ga0070676_10073867 3300005328 Bacteria 2052
24 Ga0070670_100056012 3300005331 Bacteria 3384
25 Ga0068869_100084645 3300005334 Bacteria 2374
26 Ga0068869_100227362 3300005334 Bacteria 1481
27 Ga0070666_10000432 3300005335 Bacteria 25632
28 Ga0070666_10000687 3300005335 Bacteria 20542
29 Ga0070680_100012502 3300005336 Bacteria 6598
30 Ga0070680_100125629 3300005336 Bacteria 2143
31 Ga0070680_100127658 3300005336 Bacteria 2125
32 Ga0070680_100133709 3300005336 Bacteria 2076
33 Ga0068868_100001018 3300005338 Bacteria 19149
34 Ga0068868_100035833 3300005338 Unclassified 3837
35 Ga0068868_100048161 3300005338 Bacteria 3343
36 Ga0068868_100114669 3300005338 Unclassified 2193
37 Ga0068868_100299236 3300005338 Bacteria 1366
38 Ga0070660_100007659 3300005339 Bacteria 7525
39 Ga0070660_100015151 3300005339 Bacteria 5562
40 Ga0070660_100016366 3300005339 Bacteria 5382
41 Ga0070660_100045970 3300005339 Bacteria 3345
42 Ga0070660_100053026 3300005339 Bacteria 3128
43 Ga0070660_100344150 3300005339 Bacteria 1227
44 Ga0070668_100000116 3300005347 Bacteria 49265
45 Ga0070671_100048269 3300005355 Bacteria 3540
46 Ga0070671_100072580 3300005355 Bacteria 2874
47 Ga0070671_100362103 3300005355 Bacteria 1238
48 Ga0070674_100621990 3300005356 Bacteria 915
49 Ga0070673_100000521 3300005364 Bacteria 20630
50 Ga0070673_100173969 3300005364 Bacteria 1839
51 Ga0070688_100053002 3300005365 Bacteria 2536
52 Ga0070659_100000605 3300005366 Bacteria 26382
53 Ga0070659_100059004 3300005366 Bacteria 3029
54 Ga0070659_100093582 3300005366 Bacteria 2412
55 Ga0070659_100239734 3300005366 Bacteria 1500
56 Ga0070667_100000652 3300005367 Bacteria 33714
57 Ga0070667_100002688 3300005367 Bacteria 15391
58 Ga0070667_100049875 3300005367 Bacteria 3527
59 Ga0070667_100528122 3300005367 Unclassified 1083
60 Ga0070714_100766808 3300005435 Bacteria 933
61 Ga0070700_100517119 3300005441 Unclassified 921
62 Ga0070663_100008175 3300005455 Bacteria 6419
63 Ga0070663_100017345 3300005455 Bacteria 4699
64 Ga0070662_100000343 3300005457 Bacteria 27936
65 Ga0070662_100001029 3300005457 Bacteria 17060
66 Ga0070681_10188421 3300005458 Bacteria 1983
67 Ga0070681_10210553 3300005458 Bacteria 1860
68 Ga0070681_10264767 3300005458 Bacteria 1631
69 Ga0068867_100250910 3300005459 Bacteria 1439
70 Ga0070698_100015800 3300005471 Bacteria 7974
71 Ga0070679_100052457 3300005530 Bacteria 4061
72 Ga0070679_100079153 3300005530 Bacteria 3276
73 Ga0070679_100168905 3300005530 Bacteria 2160
74 Ga0070679_100206977 3300005530 Bacteria 1926
75 Ga0070679_100460418 3300005530 Bacteria 1216
76 Ga0070684_100184385 3300005535 Bacteria 1898
77 Ga0068853_100014673 3300005539 Bacteria 6426
78 Ga0068853_100297457 3300005539 Unclassified 1491
79 Ga0068853_100867391 3300005539 Bacteria 866
80 Ga0070672_100000038 3300005543 Bacteria 57709
81 Ga0070672_100024600 3300005543 Bacteria 4454
82 Ga0070672_100034725 3300005543 Bacteria 3829
83 Ga0070665_100000072 3300005548 Bacteria 198575
84 Ga0070665_100000504 3300005548 Bacteria 55959
85 Ga0070665_100005715 3300005548 Bacteria 12766
86 Ga0068855_100011186 3300005563 Bacteria 10837
87 Ga0068855_100030149 3300005563 Bacteria 6488
88 Ga0068855_100037908 3300005563 Bacteria 5729
89 Ga0068855_100055154 3300005563 Bacteria 4669
90 Ga0068855_100148192 3300005563 Bacteria 2670
91 Ga0068855_100154159 3300005563 Bacteria 2611
92 Ga0068855_100346290 3300005563 Bacteria 1638
93 Ga0068854_100104062 3300005578 Bacteria 2132
94 Ga0068852_100000143 3300005616 Bacteria 48192
95 Ga0068859_100000242 3300005617 Bacteria 53646
96 Ga0068859_100052085 3300005617 Bacteria 4115
97 Ga0068864_100000852 3300005618 Bacteria 25731
98 Ga0068864_100010677 3300005618 Bacteria 7590
99 Ga0068864_100040222 3300005618 Bacteria 4000
100 Ga0068866_10091962 3300005718 Bacteria 1654
101 Ga0068861_100057998 3300005719 Bacteria 2959
102 Ga0068861_100387796 3300005719 Bacteria 1236
103 Ga0068851_10023224 3300005834 Bacteria 3029
104 Ga0068851_10085648 3300005834 Bacteria 1652
105 Ga0068870_10120032 3300005840 Bacteria 1513
106 Ga0068863_100003482 3300005841 Bacteria 15530
107 Ga0068863_100010182 3300005841 Bacteria 9144
108 Ga0068863_100141920 3300005841 Bacteria 2296
109 Ga0068858_100014819 3300005842 Bacteria 7335
110 Ga0068860_100000397 3300005843 Bacteria 57001
111 Ga0068860_100002540 3300005843 Bacteria 19099
112 Ga0068860_100025764 3300005843 Bacteria 5673
113 Ga0068862_100241447 3300005844 Unclassified 1643
114 Ga0068862_100313434 3300005844 Unclassified 1446
115 Ga0075366_10053047 3300006195 Bacteria 2408
116 Ga0075366_10089174 3300006195 Bacteria 1847
117 Ga0097621_100000028 3300006237 Bacteria 71678
118 Ga0097621_100025189 3300006237 Bacteria 4652
119 Ga0097621_100123390 3300006237 Bacteria 2199
120 Ga0097621_100286556 3300006237 Unclassified 1451
121 Ga0068871_100000066 3300006358 Bacteria 57980
122 Ga0068871_100179027 3300006358 Bacteria 1821
123 Ga0068871_100327300 3300006358 Bacteria 1351
124 Ga0068865_100000732 3300006881 Bacteria 18431
125 Ga0068865_100062354 3300006881 Bacteria 2617
126 Ga0097620_100000242 3300006931 Bacteria 53646
127 Ga0097620_100052085 3300006931 Bacteria 4115
128 Ga0105240_10000098 3300009093 Bacteria 178435
129 Ga0105240_10019601 3300009093 Bacteria 9034
130 Ga0105240_10037388 3300009093 Bacteria 6240
131 Ga0105240_10382431 3300009093 Bacteria 1589
132 Ga0105240_10384543 3300009093 Unclassified 1584
133 Ga0105240_10441433 3300009093 Unclassified 1458
134 Ga0105240_10615796 3300009093 Unclassified 1194
135 Ga0105243_10536412 3300009148 Bacteria 1115
136 Ga0105243_10615556 3300009148 Bacteria 1047
137 Ga0105241_10000711 3300009174 Bacteria 25180
138 Ga0105241_10002900 3300009174 Bacteria 12814
139 Ga0105241_10015480 3300009174 Bacteria 5588
140 Ga0105241_10175760 3300009174 Bacteria 1772
141 Ga0105242_10012355 3300009176 Bacteria 6572
142 Ga0105242_10245846 3300009176 Bacteria 1610
143 Ga0105242_10270819 3300009176 Unclassified 1538
144 Ga0105237_10008444 3300009545 Bacteria 11142
145 Ga0105237_10008464 3300009545 Bacteria 11132
146 Ga0105237_10035158 3300009545 Bacteria 5071
147 Ga0105238_10004976 3300009551 Bacteria 13140
148 Ga0105238_10509617 3300009551 Bacteria 1205
149 Ga0105249_10009424 3300009553 Bacteria 8545
150 Ga0105249_10030300 3300009553 Bacteria 4891
151 Ga0105239_10000039 3300010375 Bacteria 203537
152 Ga0105239_10000120 3300010375 Bacteria 110003
153 Ga0105239_10002256 3300010375 Bacteria 24634
154 Ga0105239_10002705 3300010375 Bacteria 22289
155 Ga0105239_10008149 3300010375 Bacteria 11956
156 Ga0105239_10043601 3300010375 Bacteria 4918
157 Ga0105239_10115754 3300010375 Bacteria 2974
158 Ga0105239_10184787 3300010375 Bacteria 2333
159 Ga0105239_10617878 3300010375 Bacteria 1237
160 Ga0105246_10079783 3300011119 Bacteria 2328
161 Ga0157373_10045760 3300013100 Bacteria 3123
162 Ga0157373_10110053 3300013100 Bacteria 1937
163 Ga0157371_10000903 3300013102 Bacteria 33458
164 Ga0157371_10003211 3300013102 Bacteria 15009
165 Ga0157371_10008340 3300013102 Bacteria 8268
166 Ga0157371_10010813 3300013102 Bacteria 7083
167 Ga0157371_10052412 3300013102 Bacteria 2898
168 Ga0157371_10075797 3300013102 Bacteria 2382
169 Ga0157371_10112045 3300013102 Bacteria 1937
170 Ga0157371_10150769 3300013102 Bacteria 1658
171 Ga0157371_10219008 3300013102 Bacteria 1367
172 Ga0157370_10004479 3300013104 Bacteria 16005
173 Ga0157370_10077083 3300013104 Bacteria 3141
174 Ga0157370_10258483 3300013104 Bacteria 1610
175 Ga0157369_10024604 3300013105 Bacteria 6695
176 Ga0157369_10154381 3300013105 Bacteria 2425
177 Ga0157369_10248933 3300013105 Bacteria 1855
178 Ga0157369_10446918 3300013105 Bacteria 1339
179 Ga0157374_10000174 3300013296 Bacteria 59597
180 Ga0157374_10000339 3300013296 Bacteria 43247
181 Ga0157374_10001861 3300013296 Bacteria 17768
182 Ga0157374_10063268 3300013296 Unclassified 3470
183 Ga0157374_10066629 3300013296 Bacteria 3384
184 Ga0157374_10154774 3300013296 Bacteria 2231
185 Ga0157378_10010668 3300013297 Bacteria 8028
186 Ga0157378_10093735 3300013297 Bacteria 2734
187 Ga0157378_10124893 3300013297 Bacteria 2376
188 Ga0157378_10414844 3300013297 Unclassified 1330
189 Ga0157378_10516580 3300013297 Bacteria 1195
190 Ga0163162_10000010 3300013306 Bacteria 302032
191 Ga0163162_10004724 3300013306 Bacteria 13139
192 Ga0163162_10010291 3300013306 Bacteria 9090
193 Ga0157372_10042740 3300013307 Bacteria 5014
194 Ga0157372_10045889 3300013307 Bacteria 4849
195 Ga0157372_10071119 3300013307 Bacteria 3917
196 Ga0157372_10120870 3300013307 Bacteria 3008
197 Ga0157372_10274026 3300013307 Bacteria 1961
198 Ga0157372_10360738 3300013307 Bacteria 1693
199 Ga0157375_10000548 3300013308 Bacteria 33804
200 Ga0157375_10030316 3300013308 Bacteria 5099
201 Ga0157375_10059853 3300013308 Bacteria 3775
202 Ga0157375_10112274 3300013308 Unclassified 2825
203 Ga0157375_10202899 3300013308 Bacteria 2139
204 Ga0157375_10296676 3300013308 Bacteria 1780
205 Ga0163163_10000046 3300014325 Bacteria 133543
206 Ga0163163_10527192 3300014325 Bacteria 1244
207 Ga0157380_10364272 3300014326 Bacteria 1358
208 Ga0182008_10123670 3300014497 Unclassified 1287
209 Ga0157377_10044175 3300014745 Bacteria 2483
210 Ga0157379_10000020 3300014968 Bacteria 92868
211 Ga0157379_10034975 3300014968 Bacteria 4478
212 Ga0157376_10000297 3300014969 Bacteria 33467
213 Ga0157376_10117075 3300014969 Bacteria 2355
214 Ga0182006_1002573 3300015261 Bacteria 9833
215 Ga0182007_10002352 3300015262 Bacteria 9470
216 Ga0182007_10043268 3300015262 Bacteria 1497
217 Ga0182007_10045251 3300015262 Bacteria 1459
218 Ga0163161_10012612 3300017792 Bacteria 5872
219 Ga0163161_10125178 3300017792 Bacteria 1934
220 Ga0207427_100172 3300025231 Bacteria 71550
221 Ga0209437_100024 3300025233 Bacteria 592878
222 Ga0209437_100034 3300025233 Bacteria 494007
223 Ga0209026_1000514 3300025250 Bacteria 27275
224 Ga0209233_1000038 3300025261 Bacteria 548972
225 Ga0209233_1011353 3300025261 Bacteria 2627
226 Ga0207642_10191743 3300025899 Bacteria 1122
227 Ga0207688_10182563 3300025901 Unclassified 1252
228 Ga0207680_10000268 3300025903 Bacteria 24842
229 Ga0207647_10000328 3300025904 Bacteria 38905
230 Ga0207647_10011231 3300025904 Bacteria 6289
231 Ga0207647_10024035 3300025904 Bacteria 4021
232 Ga0207645_10000190 3300025907 Bacteria 49657
233 Ga0207645_10000716 3300025907 Bacteria 27613
234 Ga0207643_10115909 3300025908 Bacteria 1582
235 Ga0207705_10000036 3300025909 Bacteria 200787
236 Ga0207705_10014189 3300025909 Bacteria 5739
237 Ga0207705_10044638 3300025909 Bacteria 3185
238 Ga0207705_10100121 3300025909 Bacteria 2132
239 Ga0207705_10345611 3300025909 Bacteria 1145
240 Ga0207654_10000978 3300025911 Bacteria 15688
241 Ga0207654_10003816 3300025911 Bacteria 7598
242 Ga0207707_10078576 3300025912 Bacteria 2881
243 Ga0207707_10234908 3300025912 Bacteria 1595
244 Ga0207707_10261642 3300025912 Bacteria 1501
245 Ga0207695_10002721 3300025913 Bacteria 25814
246 Ga0207695_10008101 3300025913 Bacteria 13214
247 Ga0207695_10020937 3300025913 Bacteria 7474
248 Ga0207695_10052336 3300025913 Bacteria 4279
249 Ga0207671_10001564 3300025914 Bacteria 26154
250 Ga0207671_10012136 3300025914 Bacteria 6955
251 Ga0207671_10016579 3300025914 Bacteria 5721
252 Ga0207671_10021503 3300025914 Bacteria 4892
253 Ga0207660_10008529 3300025917 Bacteria 6629
254 Ga0207660_10012940 3300025917 Bacteria 5465
255 Ga0207660_10069583 3300025917 Unclassified 2556
256 Ga0207660_10088655 3300025917 Bacteria 2288
257 Ga0207657_10043030 3300025919 Unclassified 3981
258 Ga0207657_10046886 3300025919 Bacteria 3784
259 Ga0207657_10057459 3300025919 Bacteria 3353
260 Ga0207657_10062067 3300025919 Bacteria 3201
261 Ga0207652_10000093 3300025921 Bacteria 98248
262 Ga0207652_10011605 3300025921 Bacteria 7108
263 Ga0207652_10078449 3300025921 Bacteria 2883
264 Ga0207652_10195323 3300025921 Bacteria 1820
265 Ga0207694_10045340 3300025924 Bacteria 3396
266 Ga0207650_10045190 3300025925 Bacteria 3240
267 Ga0207644_10273285 3300025931 Bacteria 1355
268 Ga0207690_10000594 3300025932 Bacteria 23425
269 Ga0207706_10000778 3300025933 Bacteria 33033
270 Ga0207706_10002658 3300025933 Bacteria 17397
271 Ga0207686_10168668 3300025934 Unclassified 1542
272 Ga0207686_10258932 3300025934 Bacteria 1275
273 Ga0207709_10116928 3300025935 Unclassified 1793
274 Ga0207704_10000044 3300025938 Bacteria 86753
275 Ga0207704_10008628 3300025938 Bacteria 4884
276 Ga0207704_10473626 3300025938 Bacteria 1004
277 Ga0207691_10000013 3300025940 Bacteria 147349
278 Ga0207691_10086789 3300025940 Bacteria 2807
279 Ga0207691_10129638 3300025940 Unclassified 2228
280 Ga0207689_10012013 3300025942 Bacteria 7422
281 Ga0207689_10305817 3300025942 Unclassified 1318
282 Ga0207661_10143645 3300025944 Bacteria 2056
283 Ga0207667_10020490 3300025949 Bacteria 7353
284 Ga0207667_10074858 3300025949 Bacteria 3516
285 Ga0207667_10081192 3300025949 Bacteria 3359
286 Ga0207651_10000984 3300025960 Bacteria 12587
287 Ga0207651_10037053 3300025960 Bacteria 3191
288 Ga0207668_10000295 3300025972 Bacteria 32756
289 Ga0207668_10066816 3300025972 Bacteria 2550
290 Ga0207658_10000910 3300025986 Bacteria 24517
291 Ga0207658_10080121 3300025986 Bacteria 2500
292 Ga0207677_10002248 3300026023 Bacteria 10134
293 Ga0207677_10031213 3300026023 Bacteria 3411
294 Ga0207677_10070131 3300026023 Bacteria 2468
295 Ga0207703_10001005 3300026035 Bacteria 27079
296 Ga0207703_10088106 3300026035 Bacteria 2604
297 Ga0207639_10044708 3300026041 Bacteria 3332
298 Ga0207639_10269384 3300026041 Bacteria 1493
299 Ga0207678_10033664 3300026067 Bacteria 4463
300 Ga0207702_10401781 3300026078 Bacteria 1321
301 Ga0207641_10000053 3300026088 Bacteria 173468
302 Ga0207641_10001809 3300026088 Bacteria 20561
303 Ga0207648_10000529 3300026089 Bacteria 42805
304 Ga0207648_10193057 3300026089 Bacteria 1805
305 Ga0207676_10008386 3300026095 Bacteria 7346
306 Ga0207674_10102273 3300026116 Bacteria 2845
307 Ga0207675_100075835 3300026118 Bacteria 3148
308 Ga0207675_100171158 3300026118 Bacteria 2076
309 Ga0207698_10039257 3300026142 Bacteria 3505
310 Ga0268266_10000089 3300028379 Bacteria 198566
311 Ga0268266_10005536 3300028379 Bacteria 11754
312 Ga0268266_10005697 3300028379 Bacteria 11550
313 Ga0268264_10002659 3300028381 Bacteria 15607
314 Ga0268264_10007366 3300028381 Bacteria 9193
315 Ga0268264_10014423 3300028381 Bacteria 6493
316 Ga0268264_10017988 3300028381 Bacteria 5780
317 Ga0265334_10018853 3300028573 Bacteria 2845
318 Ga0265334_10031919 3300028573 Bacteria 2103
319 Ga0265318_10004061 3300028577 Bacteria 7181
320 Ga0307517_10013529 3300028786 Bacteria 11068
321 Ga0307515_10013247 3300028794 Bacteria 15423
322 Ga0265338_10168017 3300028800 Bacteria 1686
323 Ga0316183_1043120 3300030742 Bacteria 33823
324 Ga0316181_1026561 3300030744 Bacteria 4125
325 Ga0265330_10011434 3300031235 Unclassified 4164
326 Ga0265332_10006528 3300031238 Bacteria 5289
327 Ga0265320_10014486 3300031240 Unclassified 4485
328 Ga0265339_10032906 3300031249 Bacteria 2923
329 Ga0265331_10003485 3300031250 Bacteria 10145
330 Ga0265327_10018645 3300031251 Bacteria 4293
331 Ga0265316_10020415 3300031344 Bacteria 5637
332 Ga0265316_10152967 3300031344 Unclassified 1728
333 Ga0307513_10237877 3300031456 Bacteria 1628
334 Ga0316579_10063861 3300031691 Unclassified 1736
335 Ga0265342_10005549 3300031712 Bacteria 9576
336 Ga0265342_10067374 3300031712 Bacteria 2095
337 Ga0316577_10032826 3300031733 Bacteria 2901
338 Ga0307414_10070065 3300032004 Bacteria 2524
339 Ga0316583_10018067 3300032133 Bacteria 2532
340 Ga0316585_10027027 3300032137 Unclassified 1788
341 Ga0307507_10000052 3300033179 Bacteria 168303
342 Ga0307510_10001230 3300033180 Bacteria 27766
343 Ga0316574_0135953 3300035398 Bacteria 1583
344 Ga0373927_0028828 3300035695 Bacteria 3620
345 Ga0316584_0029091 3300036712 Bacteria 4078
346 Ga0395899_0000254 3300037312 Bacteria 70643
347 Ga0395899_0000592 3300037312 Bacteria 38093
348 Ga0395899_0015965 3300037312 Bacteria 5726
349 Ga0395899_0075105 3300037312 Bacteria 2468
350 Ga0395900_0000277 3300037418 Bacteria 77256
351 Ga0395900_0134610 3300037418 Unclassified 2531
352 Ga0395900_0135149 3300037418 Bacteria 2526
353 Ga0395898_0013985 3300037466 Bacteria 8246
354 Ga0395898_0014807 3300037466 Bacteria 8006
355 Ga0395898_0119423 3300037466 Unclassified 2525
356 Ga0395905_0000068 3300037471 Bacteria 177163
357 Ga0395905_0000350 3300037471 Bacteria 65548
358 Ga0395905_0030221 3300037471 Bacteria 5107
359 Ga0395905_0153271 3300037471 Bacteria 2168
360 Ga0395901_0000199 3300038443 Bacteria 76415
361 Ga0395901_0044834 3300038443 Bacteria 4587
362 Ga0395901_0048429 3300038443 Bacteria 4413
363 Ga0436361_0399615 3300039447 Bacteria 11828
364 Ga0439460_0076361 3300042461 Bacteria 1045
365 Ga0451577_0000048 3300042876 Bacteria 309377
366 Ga0451577_0000317 3300042876 Bacteria 91191
367 Ga0451577_0011328 3300042876 Bacteria 8443
368 Ga0451577_0041194 3300042876 Bacteria 4146
369 Ga0451577_0075065 3300042876 Bacteria 3015
370 Ga0451577_0170733 3300042876 Bacteria 1960
371 Ga0451577_0373014 3300042876 Bacteria 1295
372 Ga0451577_0388601 3300042876 Bacteria 1266
373 Ga0453683_0000010 3300044673 Bacteria 470890
374 Ga0453683_0000078 3300044673 Bacteria 147056
375 Ga0453683_0000384 3300044673 Bacteria 52667
376 Ga0453683_0001166 3300044673 Bacteria 23750
377 Ga0453683_0017717 3300044673 Bacteria 4582
378 Ga0453683_0064450 3300044673 Bacteria 2290
379 Ga0453683_0143488 3300044673 Bacteria 1507
380 Ga0453683_0284435 3300044673 Bacteria 1056
381 Ga0453684_0000161 3300044712 Bacteria 298175
382 Ga0453684_0000167 3300044712 Bacteria 290200
383 Ga0453684_0000919 3300044712 Bacteria 97826
384 Ga0453684_0001032 3300044712 Bacteria 89042
385 Ga0453684_0001634 3300044712 Bacteria 61013
386 Ga0453684_0002301 3300044712 Bacteria 46943
387 Ga0453684_0011833 3300044712 Bacteria 14543
388 Ga0453684_0013015 3300044712 Bacteria 13590
389 Ga0453684_0016606 3300044712 Bacteria 11489
390 Ga0453684_0017897 3300044712 Bacteria 10934
391 Ga0453684_0018146 3300044712 Bacteria 10830
392 Ga0453684_0109235 3300044712 Bacteria 3365
393 Ga0453684_0234775 3300044712 Bacteria 2115
394 Ga0453684_0253875 3300044712 Bacteria 2018
395 Ga0453684_0279064 3300044712 Bacteria 1906
396 Ga0453684_0321178 3300044712 Bacteria 1753
397 Ga0453684_0392771 3300044712 Bacteria 1555
398 Ga0453684_0560691 3300044712 Bacteria 1257
399 Ga0453684_0696126 3300044712 Bacteria 1105
400 Ga0451576_0000059 3300045051 Bacteria 296795
401 Ga0451576_0000830 3300045051 Bacteria 60243
402 Ga0451576_0000987 3300045051 Bacteria 52668
403 Ga0451576_0001214 3300045051 Bacteria 45916
404 Ga0451576_0020780 3300045051 Bacteria 7146
405 Ga0451576_0040015 3300045051 Bacteria 4963
406 Ga0451576_0042296 3300045051 Bacteria 4811
407 Ga0451576_0107883 3300045051 Unclassified 2897
408 Ga0451576_0289656 3300045051 Bacteria 1712
409 Ga0451576_0502983 3300045051 Bacteria 1273
410 Ga0495592_0015914 3300046454 Bacteria 5706
411 Ga0495650_0000087 3300046471 Bacteria 234870
412 Ga0495662_0096277 3300046476 Unclassified 1447
413 Ga0495585_0000167 3300046492 Bacteria 70874
414 Ga0495585_0003388 3300046492 Bacteria 10792
415 Ga0495583_0009915 3300046506 Bacteria 5633
416 Ga0495583_0032515 3300046506 Bacteria 2518
417 Ga0495606_0040906 3300046507 Bacteria 3111
418 Ga0495606_0051376 3300046507 Bacteria 2689
419 Ga0495606_0089992 3300046507 Bacteria 1890
420 Ga0495616_0002385 3300046513 Bacteria 12503
421 Ga0495616_0015653 3300046513 Bacteria 4214
422 Ga0495631_0003046 3300046518 Bacteria 9261
423 Ga0495632_0046274 3300046519 Bacteria 2163
424 Ga0495648_0005217 3300046524 Bacteria 10870
425 Ga0495648_0121880 3300046524 Bacteria 1400
426 Ga0495648_0134764 3300046524 Bacteria 1308
427 Ga0495609_0010171 3300046538 Bacteria 4523
428 Ga0495633_0000029 3300046558 Bacteria 200381
429 Ga0495668_0000070 3300046616 Bacteria 174051
430 Ga0495634_0018500 3300046642 Bacteria 4961
431 Ga0495625_0000008 3300046660 Bacteria 536165
432 Ga0495625_0001373 3300046660 Bacteria 29924
433 Ga0495625_0004000 3300046660 Bacteria 14117
434 Ga0495625_0011379 3300046660 Bacteria 7260
435 Ga0495625_0087965 3300046660 Bacteria 2153
436 Ga0495625_0161495 3300046660 Bacteria 1501
437 Ga0495661_0001581 3300046665 Bacteria 18761
438 Ga0495661_0002168 3300046665 Bacteria 15344
439 Ga0495658_0227872 3300046683 Bacteria 1168
440 Ga0495670_0160168 3300046691 Bacteria 1182
441 Ga0495649_0000018 3300046694 Bacteria 220586
442 Ga0495660_0055936 3300046810 Bacteria 2134
443 Ga0495687_000484 3300047443 Bacteria 48242
444 Ga0495687_022506 3300047443 Bacteria 3024
445 Ga0495593_0151465 3300047673 Bacteria 1173
446 Ga0495614_0055623 3300048089 Bacteria 1697
447 Ga0496106_0660423 3300048909 Unclassified 835
448 Ga0495678_029384 3300049459 Bacteria 2308
449 Ga0501032_0191459 3300049569 Bacteria 1337
450 Ga0501034_0146862 3300049571 Bacteria 2335
451 Ga0501035_0024002 3300049822 Bacteria 5596
452 Ga0501044_0451035 3300049823 Bacteria 1193
453 nmdc:mga0k408_778_c1 3300050493 Bacteria 17529
454 nmdc:mga0k408_9619_c1 3300050493 Bacteria 5216
455 Ga0500608_001591 3300053122 Bacteria 8154
456 Ga0500608_005898 3300053122 Bacteria 4923
457 Ga0500618_000037 3300053125 Bacteria 117320
458 Ga0500624_000134 3300053157 Bacteria 31729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100056012 Ga0070670_1000560123 222
2 3300005338 Ga0068868_100035833 Ga0068868_1000358335 222
3 3300006358 Ga0068871_100327300 Ga0068871_1003273002 222
4 3300025925 Ga0207650_10045190 Ga0207650_100451903 222
5 3300044712 Ga0453684_0279064 Ga0453684_0279064_18_791 229
6 3300048909 Ga0496106_0660423 Ga0496106_0660423_36_803 229
7 3300042876 Ga0451577_0075065 Ga0451577_0075065_1715_2527 232
8 3300044712 Ga0453684_0001634 Ga0453684_0001634_25147_25959 232
9 iso_pu_bacteria 2890804823 2890806872 234
10 3300028577 Ga0265318_10004061 Ga0265318_100040615 235
11 3300031235 Ga0265330_10011434 Ga0265330_100114342 235
12 3300031238 Ga0265332_10006528 Ga0265332_100065285 235
13 3300031240 Ga0265320_10014486 Ga0265320_100144862 235
14 3300031249 Ga0265339_10032906 Ga0265339_100329062 235
15 3300031250 Ga0265331_10003485 Ga0265331_100034855 235
16 3300031344 Ga0265316_10020415 Ga0265316_100204154 235
17 3300031712 Ga0265342_10005549 Ga0265342_100055495 235
18 3300005327 Ga0070658_10202834 Ga0070658_102028342 236
19 3300005335 Ga0070666_10000432 Ga0070666_1000043213 236
20 3300005339 Ga0070660_100016366 Ga0070660_1000163664 236
21 3300005355 Ga0070671_100072580 Ga0070671_1000725802 236
22 3300005365 Ga0070688_100053002 Ga0070688_1000530023 236
23 3300005367 Ga0070667_100002688 Ga0070667_1000026885 236
24 3300005367 Ga0070667_100049875 Ga0070667_1000498753 236
25 3300005458 Ga0070681_10210553 Ga0070681_102105532 236
26 3300005543 Ga0070672_100024600 Ga0070672_1000246005 236
27 3300005617 Ga0068859_100000242 Ga0068859_10000024221 236
28 3300005617 Ga0068859_100052085 Ga0068859_1000520854 236
29 3300005618 Ga0068864_100010677 Ga0068864_1000106773 236
30 3300005834 Ga0068851_10023224 Ga0068851_100232245 236
31 3300005834 Ga0068851_10085648 Ga0068851_100856482 236
32 3300005841 Ga0068863_100003482 Ga0068863_10000348210 236
33 3300005842 Ga0068858_100014819 Ga0068858_1000148193 236
34 3300005843 Ga0068860_100002540 Ga0068860_10000254013 236
35 3300006237 Ga0097621_100123390 Ga0097621_1001233902 236
36 3300006237 Ga0097621_100286556 Ga0097621_1002865561 236
37 3300006931 Ga0097620_100000242 Ga0097620_10000024238 236
38 3300006931 Ga0097620_100052085 Ga0097620_1000520854 236
39 3300009174 Ga0105241_10015480 Ga0105241_100154806 236
40 3300009551 Ga0105238_10509617 Ga0105238_105096171 236
41 3300009553 Ga0105249_10009424 Ga0105249_100094242 236
42 3300013102 Ga0157371_10003211 Ga0157371_100032113 236
43 3300013102 Ga0157371_10008340 Ga0157371_100083403 236
44 3300013105 Ga0157369_10446918 Ga0157369_104469182 236
45 3300013296 Ga0157374_10063268 Ga0157374_100632683 236
46 3300013296 Ga0157374_10066629 Ga0157374_100666292 236
47 3300013297 Ga0157378_10010668 Ga0157378_1001066810 236
48 3300013306 Ga0163162_10010291 Ga0163162_100102917 236
49 3300013307 Ga0157372_10045889 Ga0157372_100458896 236
50 3300013308 Ga0157375_10296676 Ga0157375_102966762 236
51 3300014968 Ga0157379_10034975 Ga0157379_100349754 236
52 3300025903 Ga0207680_10000268 Ga0207680_1000026813 236
53 3300025909 Ga0207705_10100121 Ga0207705_101001212 236
54 3300025911 Ga0207654_10003816 Ga0207654_100038166 236
55 3300025912 Ga0207707_10234908 Ga0207707_102349082 236
56 3300025914 Ga0207671_10016579 Ga0207671_100165792 236
57 3300025931 Ga0207644_10273285 Ga0207644_102732852 236
58 3300025942 Ga0207689_10012013 Ga0207689_100120139 236
59 3300025972 Ga0207668_10066816 Ga0207668_100668161 236
60 3300025986 Ga0207658_10080121 Ga0207658_100801213 236
61 3300026088 Ga0207641_10000053 Ga0207641_1000005351 236
62 3300026095 Ga0207676_10008386 Ga0207676_100083866 236
63 3300028381 Ga0268264_10007366 Ga0268264_100073668 236
64 3300028381 Ga0268264_10014423 Ga0268264_100144232 236
65 3300037312 Ga0395899_0015965 Ga0395899_0015965_2732_3544 236
66 3300037312 Ga0395899_0075105 Ga0395899_0075105_1445_2254 236
67 3300037466 Ga0395898_0013985 Ga0395898_0013985_4724_5536 236
68 3300037471 Ga0395905_0030221 Ga0395905_0030221_2900_3709 236
69 3300038443 Ga0395901_0048429 Ga0395901_0048429_529_1341 236
70 3300005327 Ga0070658_10341186 Ga0070658_103411861 237
71 3300005336 Ga0070680_100133709 Ga0070680_1001337092 237
72 3300005339 Ga0070660_100053026 Ga0070660_1000530262 237
73 3300005366 Ga0070659_100239734 Ga0070659_1002397341 237
74 3300005435 Ga0070714_100766808 Ga0070714_1007668081 237
75 3300005455 Ga0070663_100008175 Ga0070663_1000081753 237
76 3300005455 Ga0070663_100017345 Ga0070663_1000173453 237
77 3300005458 Ga0070681_10264767 Ga0070681_102647672 237
78 3300005530 Ga0070679_100079153 Ga0070679_1000791532 237
79 3300005535 Ga0070684_100184385 Ga0070684_1001843852 237
80 3300005563 Ga0068855_100030149 Ga0068855_1000301494 237
81 3300005563 Ga0068855_100154159 Ga0068855_1001541592 237
82 3300005578 Ga0068854_100104062 Ga0068854_1001040621 237
83 3300013100 Ga0157373_10045760 Ga0157373_100457603 237
84 3300013102 Ga0157371_10000903 Ga0157371_1000090322 237
85 3300013102 Ga0157371_10150769 Ga0157371_101507692 237
86 3300013102 Ga0157371_10219008 Ga0157371_102190082 237
87 3300013104 Ga0157370_10004479 Ga0157370_100044799 237
88 3300013104 Ga0157370_10077083 Ga0157370_100770832 237
89 3300013105 Ga0157369_10154381 Ga0157369_101543812 237
90 3300013307 Ga0157372_10042740 Ga0157372_100427401 237
91 3300025904 Ga0207647_10024035 Ga0207647_100240352 237
92 3300025909 Ga0207705_10044638 Ga0207705_100446383 237
93 3300025912 Ga0207707_10078576 Ga0207707_100785761 237
94 3300025917 Ga0207660_10069583 Ga0207660_100695833 237
95 3300025919 Ga0207657_10057459 Ga0207657_100574593 237
96 3300025921 Ga0207652_10000093 Ga0207652_1000009377 237
97 3300025944 Ga0207661_10143645 Ga0207661_101436452 237
98 3300025949 Ga0207667_10020490 Ga0207667_100204906 237
99 3300026067 Ga0207678_10033664 Ga0207678_100336643 237
100 3300026078 Ga0207702_10401781 Ga0207702_104017811 237
101 3300032133 Ga0316583_10018067 Ga0316583_100180672 237
102 3300037418 Ga0395900_0134610 Ga0395900_0134610_1199_2014 237
103 3300037466 Ga0395898_0119423 Ga0395898_0119423_381_1196 237
104 iso_pu_bacteria 2911138879 2911139794 237
105 3300005327 Ga0070658_10334585 Ga0070658_103345851 238
106 3300005334 Ga0068869_100084645 Ga0068869_1000846452 238
107 3300005336 Ga0070680_100127658 Ga0070680_1001276583 238
108 3300005338 Ga0068868_100114669 Ga0068868_1001146692 238
109 3300005339 Ga0070660_100045970 Ga0070660_1000459704 238
110 3300005366 Ga0070659_100059004 Ga0070659_1000590042 238
111 3300005367 Ga0070667_100528122 Ga0070667_1005281221 238
112 3300005458 Ga0070681_10188421 Ga0070681_101884213 238
113 3300005530 Ga0070679_100206977 Ga0070679_1002069772 238
114 3300005530 Ga0070679_100460418 Ga0070679_1004604181 238
115 3300005618 Ga0068864_100040222 Ga0068864_1000402223 238
116 3300005844 Ga0068862_100241447 Ga0068862_1002414472 238
117 3300013100 Ga0157373_10110053 Ga0157373_101100532 238
118 3300013102 Ga0157371_10052412 Ga0157371_100524122 238
119 3300013105 Ga0157369_10024604 Ga0157369_100246043 238
120 3300013307 Ga0157372_10274026 Ga0157372_102740261 238
121 3300013307 Ga0157372_10360738 Ga0157372_103607382 238
122 3300025909 Ga0207705_10345611 Ga0207705_103456111 238
123 3300025912 Ga0207707_10261642 Ga0207707_102616422 238
124 3300025917 Ga0207660_10012940 Ga0207660_100129406 238
125 3300025917 Ga0207660_10088655 Ga0207660_100886552 238
126 3300025919 Ga0207657_10062067 Ga0207657_100620672 238
127 3300025921 Ga0207652_10011605 Ga0207652_100116052 238
128 3300025949 Ga0207667_10074858 Ga0207667_100748583 238
129 3300026116 Ga0207674_10102273 Ga0207674_101022732 238
130 3300013102 Ga0157371_10075797 Ga0157371_100757972 239
131 3300013102 Ga0157371_10112045 Ga0157371_101120452 239
132 3300013307 Ga0157372_10120870 Ga0157372_101208703 239
133 3300035398 Ga0316574_0135953 Ga0316574_0135953_754_1557 239
134 3300037471 Ga0395905_0000350 Ga0395905_0000350_52644_53447 239
135 3300049569 Ga0501032_0191459 Ga0501032_0191459_339_1160 239
136 3300049571 Ga0501034_0146862 Ga0501034_0146862_221_1042 239
137 3300049822 Ga0501035_0024002 Ga0501035_0024002_4273_5094 239
138 3300049823 Ga0501044_0451035 Ga0501044_0451035_237_1058 239
139 3300005459 Ga0068867_100250910 Ga0068867_1002509101 240
140 3300005719 Ga0068861_100387796 Ga0068861_1003877961 240
141 3300005843 Ga0068860_100025764 Ga0068860_1000257643 240
142 3300026089 Ga0207648_10193057 Ga0207648_101930572 240
143 3300026118 Ga0207675_100171158 Ga0207675_1001711582 240
144 3300028381 Ga0268264_10017988 Ga0268264_100179885 240
145 3300031456 Ga0307513_10237877 Ga0307513_102378772 240
146 3300005471 Ga0070698_100015800 Ga0070698_1000158007 241
147 3300013308 Ga0157375_10112274 Ga0157375_101122742 241
148 3300025938 Ga0207704_10473626 Ga0207704_104736261 241
149 3300025940 Ga0207691_10129638 Ga0207691_101296384 241
150 3300028800 Ga0265338_10168017 Ga0265338_101680171 241
151 3300037418 Ga0395900_0135149 Ga0395900_0135149_706_1527 241
152 3300042461 Ga0439460_0076361 Ga0439460_0076361_157_969 241
153 3300003320 rootH2_10117586 rootH2_101175863 242
154 3300003322 rootL2_10202744 rootL2_102027442 242
155 3300005355 Ga0070671_100362103 Ga0070671_1003621031 242
156 3300005441 Ga0070700_100517119 Ga0070700_1005171191 242
157 3300009148 Ga0105243_10615556 Ga0105243_106155561 242
158 3300013297 Ga0157378_10516580 Ga0157378_105165801 242
159 3300014326 Ga0157380_10364272 Ga0157380_103642722 242
160 3300028573 Ga0265334_10018853 Ga0265334_100188532 242
161 3300031251 Ga0265327_10018645 Ga0265327_100186452 242
162 3300031712 Ga0265342_10067374 Ga0265342_100673742 242
163 3300037312 Ga0395899_0000254 Ga0395899_0000254_17109_17942 242
164 3300038443 Ga0395901_0044834 Ga0395901_0044834_391_1191 242
165 3300042876 Ga0451577_0000048 Ga0451577_0000048_308402_309214 242
166 3300042876 Ga0451577_0011328 Ga0451577_0011328_3674_4498 242
167 3300042876 Ga0451577_0041194 Ga0451577_0041194_323_1135 242
168 3300042876 Ga0451577_0170733 Ga0451577_0170733_95_907 242
169 3300042876 Ga0451577_0388601 Ga0451577_0388601_373_1191 242
170 3300044673 Ga0453683_0000010 Ga0453683_0000010_118935_119747 242
171 3300044673 Ga0453683_0000078 Ga0453683_0000078_164_976 242
172 3300044673 Ga0453683_0000384 Ga0453683_0000384_44476_45294 242
173 3300044673 Ga0453683_0001166 Ga0453683_0001166_5731_6549 242
174 3300044673 Ga0453683_0017717 Ga0453683_0017717_3009_3827 242
175 3300044673 Ga0453683_0064450 Ga0453683_0064450_419_1231 242
176 3300044673 Ga0453683_0143488 Ga0453683_0143488_673_1485 242
177 3300044673 Ga0453683_0284435 Ga0453683_0284435_59_877 242
178 3300044712 Ga0453684_0000161 Ga0453684_0000161_297200_298012 242
179 3300044712 Ga0453684_0000919 Ga0453684_0000919_27127_27951 242
180 3300044712 Ga0453684_0011833 Ga0453684_0011833_8178_8996 242
181 3300044712 Ga0453684_0013015 Ga0453684_0013015_9600_10412 242
182 3300044712 Ga0453684_0016606 Ga0453684_0016606_2990_3805 242
183 3300044712 Ga0453684_0018146 Ga0453684_0018146_7400_8215 242
184 3300044712 Ga0453684_0109235 Ga0453684_0109235_1570_2388 242
185 3300044712 Ga0453684_0234775 Ga0453684_0234775_403_1224 242
186 3300044712 Ga0453684_0253875 Ga0453684_0253875_716_1534 242
187 3300044712 Ga0453684_0560691 Ga0453684_0560691_139_954 242
188 3300044712 Ga0453684_0696126 Ga0453684_0696126_68_880 242
189 3300045051 Ga0451576_0000059 Ga0451576_0000059_164_976 242
190 3300045051 Ga0451576_0000987 Ga0451576_0000987_7374_8192 242
191 3300045051 Ga0451576_0001214 Ga0451576_0001214_25996_26814 242
192 3300045051 Ga0451576_0020780 Ga0451576_0020780_4069_4929 242
193 3300045051 Ga0451576_0040015 Ga0451576_0040015_1559_2383 242
194 3300045051 Ga0451576_0042296 Ga0451576_0042296_3007_3822 242
195 3300045051 Ga0451576_0107883 Ga0451576_0107883_1023_1835 242
196 3300045051 Ga0451576_0502983 Ga0451576_0502983_68_880 242
197 3300005293 Ga0065715_10006394 Ga0065715_100063943 243
198 3300005841 Ga0068863_100141920 Ga0068863_1001419202 243
199 3300006358 Ga0068871_100179027 Ga0068871_1001790272 243
200 3300009176 Ga0105242_10012355 Ga0105242_100123556 243
201 3300013306 Ga0163162_10004724 Ga0163162_1000472410 243
202 3300013308 Ga0157375_10202899 Ga0157375_102028992 243
203 3300014325 Ga0163163_10527192 Ga0163163_105271922 243
204 3300017792 Ga0163161_10012612 Ga0163161_100126124 243
205 3300028573 Ga0265334_10031919 Ga0265334_100319191 243
206 3300031691 Ga0316579_10063861 Ga0316579_100638612 243
207 3300031733 Ga0316577_10032826 Ga0316577_100328262 243
208 3300032137 Ga0316585_10027027 Ga0316585_100270272 243
209 3300035695 Ga0373927_0028828 Ga0373927_0028828_342_1151 243
210 3300036712 Ga0316584_0029091 Ga0316584_0029091_906_1730 243
211 3300042876 Ga0451577_0000317 Ga0451577_0000317_34554_35375 243
212 3300042876 Ga0451577_0373014 Ga0451577_0373014_421_1248 243
213 3300044712 Ga0453684_0000167 Ga0453684_0000167_3220_4041 243
214 3300044712 Ga0453684_0001032 Ga0453684_0001032_53673_54494 243
215 3300044712 Ga0453684_0002301 Ga0453684_0002301_1972_2799 243
216 3300044712 Ga0453684_0321178 Ga0453684_0321178_880_1707 243
217 3300045051 Ga0451576_0000830 Ga0451576_0000830_18577_19398 243
218 3300046454 Ga0495592_0015914 Ga0495592_0015914_74_904 243
219 3300046476 Ga0495662_0096277 Ga0495662_0096277_590_1420 243
220 3300046642 Ga0495634_0018500 Ga0495634_0018500_539_1369 243
221 3300005327 Ga0070658_10000620 Ga0070658_1000062023 244
222 3300005328 Ga0070676_10002491 Ga0070676_1000249111 244
223 3300005334 Ga0068869_100227362 Ga0068869_1002273622 244
224 3300005335 Ga0070666_10000687 Ga0070666_1000068718 244
225 3300005338 Ga0068868_100001018 Ga0068868_10000101815 244
226 3300005347 Ga0070668_100000116 Ga0070668_10000011625 244
227 3300005356 Ga0070674_100621990 Ga0070674_1006219901 244
228 3300005364 Ga0070673_100000521 Ga0070673_1000005212 244
229 3300005367 Ga0070667_100000652 Ga0070667_10000065222 244
230 3300005457 Ga0070662_100001029 Ga0070662_1000010292 244
231 3300005539 Ga0068853_100297457 Ga0068853_1002974572 244
232 3300005543 Ga0070672_100000038 Ga0070672_10000003836 244
233 3300005548 Ga0070665_100000504 Ga0070665_10000050443 244
234 3300005563 Ga0068855_100055154 Ga0068855_1000551545 244
235 3300005618 Ga0068864_100000852 Ga0068864_1000008528 244
236 3300005719 Ga0068861_100057998 Ga0068861_1000579983 244
237 3300005841 Ga0068863_100010182 Ga0068863_1000101824 244
238 3300005843 Ga0068860_100000397 Ga0068860_10000039747 244
239 3300005844 Ga0068862_100313434 Ga0068862_1003134342 244
240 3300006237 Ga0097621_100025189 Ga0097621_1000251892 244
241 3300006881 Ga0068865_100062354 Ga0068865_1000623542 244
242 3300009174 Ga0105241_10175760 Ga0105241_101757601 244
243 3300009176 Ga0105242_10270819 Ga0105242_102708192 244
244 3300009553 Ga0105249_10030300 Ga0105249_100303003 244
245 3300010375 Ga0105239_10184787 Ga0105239_101847872 244
246 3300013296 Ga0157374_10000339 Ga0157374_1000033924 244
247 3300013297 Ga0157378_10093735 Ga0157378_100937352 244
248 3300013307 Ga0157372_10071119 Ga0157372_100711193 244
249 3300013308 Ga0157375_10000548 Ga0157375_1000054822 244
250 3300014325 Ga0163163_10000046 Ga0163163_10000046115 244
251 3300014968 Ga0157379_10000020 Ga0157379_1000002017 244
252 3300014969 Ga0157376_10000297 Ga0157376_1000029722 244
253 3300017792 Ga0163161_10125178 Ga0163161_101251783 244
254 3300025901 Ga0207688_10182563 Ga0207688_101825632 244
255 3300025907 Ga0207645_10000716 Ga0207645_1000071626 244
256 3300025909 Ga0207705_10014189 Ga0207705_100141895 244
257 3300025933 Ga0207706_10002658 Ga0207706_100026583 244
258 3300025934 Ga0207686_10168668 Ga0207686_101686682 244
259 3300025935 Ga0207709_10116928 Ga0207709_101169282 244
260 3300025938 Ga0207704_10008628 Ga0207704_100086286 244
261 3300025940 Ga0207691_10000013 Ga0207691_1000001388 244
262 3300025942 Ga0207689_10305817 Ga0207689_103058172 244
263 3300025949 Ga0207667_10081192 Ga0207667_100811922 244
264 3300025960 Ga0207651_10000984 Ga0207651_1000098415 244
265 3300025972 Ga0207668_10000295 Ga0207668_1000029521 244
266 3300025986 Ga0207658_10000910 Ga0207658_1000091017 244
267 3300026023 Ga0207677_10002248 Ga0207677_100022489 244
268 3300026035 Ga0207703_10001005 Ga0207703_1000100522 244
269 3300026041 Ga0207639_10269384 Ga0207639_102693842 244
270 3300026088 Ga0207641_10001809 Ga0207641_1000180917 244
271 3300026118 Ga0207675_100075835 Ga0207675_1000758354 244
272 3300028379 Ga0268266_10005536 Ga0268266_100055362 244
273 3300028381 Ga0268264_10002659 Ga0268264_100026597 244
274 3300002772 JGI25164J39214_1001290 JGI25164J39214_10012902 245
275 3300003214 JGI25165J46597_1000615 JGI25165J46597_100061525 245
276 3300005563 Ga0068855_100148192 Ga0068855_1001481921 245
277 3300025231 Ga0207427_100172 Ga0207427_10017236 245
278 3300025233 Ga0209437_100034 Ga0209437_100034141 245
279 3300025261 Ga0209233_1000038 Ga0209233_1000038141 245
280 3300005327 Ga0070658_10000018 Ga0070658_1000001876 246
281 3300005339 Ga0070660_100007659 Ga0070660_1000076596 246
282 3300005366 Ga0070659_100000605 Ga0070659_1000006052 246
283 3300013104 Ga0157370_10258483 Ga0157370_102584831 246
284 3300013297 Ga0157378_10414844 Ga0157378_104148441 246
285 3300025909 Ga0207705_10000036 Ga0207705_10000036119 246
286 3300025919 Ga0207657_10046886 Ga0207657_100468864 246
287 3300025932 Ga0207690_10000594 Ga0207690_100005943 246
288 3300026035 Ga0207703_10088106 Ga0207703_100881063 246
289 iso_pu_bacteria 2890737413 2890739435 246
290 iso_pu_bacteria 2896344016 2896345010 246
291 iso_pu_bacteria 2898713307 2898715496 246
292 3300003320 rootH2_10278086 rootH2_102780861 247
293 3300004799 Ga0058863_11417909 Ga0058863_114179092 247
294 3300005336 Ga0070680_100012502 Ga0070680_1000125023 247
295 3300005336 Ga0070680_100125629 Ga0070680_1001256291 247
296 3300005530 Ga0070679_100052457 Ga0070679_1000524575 247
297 3300005530 Ga0070679_100168905 Ga0070679_1001689052 247
298 3300005563 Ga0068855_100011186 Ga0068855_1000111866 247
299 3300006195 Ga0075366_10053047 Ga0075366_100530473 247
300 3300009093 Ga0105240_10037388 Ga0105240_100373889 247
301 3300009545 Ga0105237_10035158 Ga0105237_100351582 247
302 3300013297 Ga0157378_10124893 Ga0157378_101248932 247
303 3300013308 Ga0157375_10030316 Ga0157375_100303161 247
304 3300025250 Ga0209026_1000514 Ga0209026_100051414 247
305 3300025917 Ga0207660_10008529 Ga0207660_100085298 247
306 3300025921 Ga0207652_10078449 Ga0207652_100784494 247
307 3300025921 Ga0207652_10195323 Ga0207652_101953232 247
308 3300031344 Ga0265316_10152967 Ga0265316_101529672 247
309 3300044712 Ga0453684_0017897 Ga0453684_0017897_6307_7131 247
310 3300044712 Ga0453684_0392771 Ga0453684_0392771_133_957 247
311 3300045051 Ga0451576_0289656 Ga0451576_0289656_203_1027 247
312 3300050493 nmdc:mga0k408_9619_c1 nmdc:mga0k408_9619_c1_134_937 247
313 iso_pu_bacteria 2599185184 2599478298 247
314 iso_pu_bacteria 2842903701 2842903953 247
315 iso_pu_bacteria 2852627209 2852627728 247
316 iso_pu_bacteria 2919186247 2919187905 247
317 iso_pu_bacteria 2928078545 2928080652 247
318 iso_pu_bacteria 2928147474 2928150876 247
319 iso_pu_bacteria 2932082852 2932082963 247
320 iso_pu_bacteria 2939664404 2939664828 247
321 3300005339 Ga0070660_100015151 Ga0070660_1000151512 248
322 3300025919 Ga0207657_10043030 Ga0207657_100430304 248
323 3300003316 rootH1_10126354 rootH1_101263547 249
324 3300037471 Ga0395905_0153271 Ga0395905_0153271_309_1112 249
325 3300001990 JGI24737J22298_10066271 JGI24737J22298_100662711 250
326 3300003320 rootH2_10002594 rootH2_1000259425 250
327 3300005328 Ga0070676_10073867 Ga0070676_100738671 250
328 3300005338 Ga0068868_100048161 Ga0068868_1000481612 250
329 3300005338 Ga0068868_100299236 Ga0068868_1002992361 250
330 3300005339 Ga0070660_100344150 Ga0070660_1003441502 250
331 3300005355 Ga0070671_100048269 Ga0070671_1000482694 250
332 3300005364 Ga0070673_100173969 Ga0070673_1001739692 250
333 3300005366 Ga0070659_100093582 Ga0070659_1000935823 250
334 3300005457 Ga0070662_100000343 Ga0070662_1000003432 250
335 3300005539 Ga0068853_100014673 Ga0068853_1000146737 250
336 3300005539 Ga0068853_100867391 Ga0068853_1008673911 250
337 3300005543 Ga0070672_100034725 Ga0070672_1000347254 250
338 3300005548 Ga0070665_100000072 Ga0070665_10000007239 250
339 3300005548 Ga0070665_100005715 Ga0070665_10000571511 250
340 3300005563 Ga0068855_100037908 Ga0068855_1000379081 250
341 3300005563 Ga0068855_100346290 Ga0068855_1003462902 250
342 3300005616 Ga0068852_100000143 Ga0068852_10000014328 250
343 3300005718 Ga0068866_10091962 Ga0068866_100919621 250
344 3300005840 Ga0068870_10120032 Ga0068870_101200321 250
345 3300006237 Ga0097621_100000028 Ga0097621_10000002845 250
346 3300006358 Ga0068871_100000066 Ga0068871_10000006642 250
347 3300006881 Ga0068865_100000732 Ga0068865_10000073222 250
348 3300009093 Ga0105240_10000098 Ga0105240_1000009881 250
349 3300009093 Ga0105240_10019601 Ga0105240_100196014 250
350 3300009093 Ga0105240_10384543 Ga0105240_103845431 250
351 3300009093 Ga0105240_10441433 Ga0105240_104414332 250
352 3300009148 Ga0105243_10536412 Ga0105243_105364122 250
353 3300009174 Ga0105241_10000711 Ga0105241_1000071125 250
354 3300009174 Ga0105241_10002900 Ga0105241_100029005 250
355 3300009176 Ga0105242_10245846 Ga0105242_102458461 250
356 3300009545 Ga0105237_10008444 Ga0105237_100084442 250
357 3300009545 Ga0105237_10008464 Ga0105237_1000846412 250
358 3300009551 Ga0105238_10004976 Ga0105238_100049764 250
359 3300010375 Ga0105239_10002705 Ga0105239_1000270520 250
360 3300010375 Ga0105239_10008149 Ga0105239_100081492 250
361 3300010375 Ga0105239_10115754 Ga0105239_101157541 250
362 3300010375 Ga0105239_10617878 Ga0105239_106178782 250
363 3300011119 Ga0105246_10079783 Ga0105246_100797832 250
364 3300013105 Ga0157369_10248933 Ga0157369_102489333 250
365 3300013296 Ga0157374_10000174 Ga0157374_1000017443 250
366 3300013296 Ga0157374_10001861 Ga0157374_100018615 250
367 3300013306 Ga0163162_10000010 Ga0163162_1000001089 250
368 3300013308 Ga0157375_10059853 Ga0157375_100598535 250
369 3300014745 Ga0157377_10044175 Ga0157377_100441752 250
370 3300014969 Ga0157376_10117075 Ga0157376_101170753 250
371 3300025899 Ga0207642_10191743 Ga0207642_101917432 250
372 3300025904 Ga0207647_10000328 Ga0207647_1000032831 250
373 3300025904 Ga0207647_10011231 Ga0207647_100112314 250
374 3300025907 Ga0207645_10000190 Ga0207645_1000019056 250
375 3300025908 Ga0207643_10115909 Ga0207643_101159092 250
376 3300025911 Ga0207654_10000978 Ga0207654_100009783 250
377 3300025913 Ga0207695_10002721 Ga0207695_100027215 250
378 3300025913 Ga0207695_10008101 Ga0207695_100081014 250
379 3300025913 Ga0207695_10020937 Ga0207695_100209377 250
380 3300025914 Ga0207671_10001564 Ga0207671_100015648 250
381 3300025914 Ga0207671_10021503 Ga0207671_100215035 250
382 3300025924 Ga0207694_10045340 Ga0207694_100453405 250
383 3300025933 Ga0207706_10000778 Ga0207706_100007783 250
384 3300025934 Ga0207686_10258932 Ga0207686_102589322 250
385 3300025938 Ga0207704_10000044 Ga0207704_1000004476 250
386 3300025940 Ga0207691_10086789 Ga0207691_100867892 250
387 3300025960 Ga0207651_10037053 Ga0207651_100370532 250
388 3300026023 Ga0207677_10031213 Ga0207677_100312132 250
389 3300026023 Ga0207677_10070131 Ga0207677_100701313 250
390 3300026041 Ga0207639_10044708 Ga0207639_100447082 250
391 3300026089 Ga0207648_10000529 Ga0207648_1000052943 250
392 3300026142 Ga0207698_10039257 Ga0207698_100392572 250
393 3300028379 Ga0268266_10000089 Ga0268266_1000008939 250
394 3300028379 Ga0268266_10005697 Ga0268266_1000569710 250
395 3300028786 Ga0307517_10013529 Ga0307517_100135296 250
396 3300032004 Ga0307414_10070065 Ga0307414_100700651 250
397 3300033180 Ga0307510_10001230 Ga0307510_1000123028 250
398 3300037312 Ga0395899_0000592 Ga0395899_0000592_31491_32288 250
399 3300037418 Ga0395900_0000277 Ga0395900_0000277_57775_58572 250
400 3300037466 Ga0395898_0014807 Ga0395898_0014807_3965_4762 250
401 3300037471 Ga0395905_0000068 Ga0395905_0000068_32694_33491 250
402 3300038443 Ga0395901_0000199 Ga0395901_0000199_35454_36251 250
403 3300039447 Ga0436361_0399615 Ga0436361_0399615_2327_3124 250
404 3300046518 Ga0495631_0003046 Ga0495631_0003046_5330_6127 250
405 3300046519 Ga0495632_0046274 Ga0495632_0046274_1228_2025 250
406 3300046660 Ga0495625_0161495 Ga0495625_0161495_232_1155 250
407 3300047443 Ga0495687_000484 Ga0495687_000484_29766_30563 250
408 3300053122 Ga0500608_001591 Ga0500608_001591_6998_7795 250
409 3300001989 JGI24739J22299_10013045 JGI24739J22299_100130453 251
410 3300002737 JGI25162J39368_1000017 JGI25162J39368_100001749 251
411 3300003320 rootH2_10078540 rootH2_100785401 251
412 3300003322 rootL2_10001050 rootL2_100010506 251
413 3300003322 rootL2_10206086 rootL2_102060862 251
414 3300005288 Ga0065714_10064842 Ga0065714_1006484211 251
415 3300006195 Ga0075366_10089174 Ga0075366_100891741 251
416 3300009093 Ga0105240_10382431 Ga0105240_103824312 251
417 3300009093 Ga0105240_10615796 Ga0105240_106157962 251
418 3300010375 Ga0105239_10000039 Ga0105239_10000039111 251
419 3300010375 Ga0105239_10000120 Ga0105239_1000012048 251
420 3300010375 Ga0105239_10002256 Ga0105239_100022565 251
421 3300010375 Ga0105239_10043601 Ga0105239_100436015 251
422 3300013102 Ga0157371_10010813 Ga0157371_100108136 251
423 3300013296 Ga0157374_10154774 Ga0157374_101547742 251
424 3300014497 Ga0182008_10123670 Ga0182008_101236702 251
425 3300015261 Ga0182006_1002573 Ga0182006_10025734 251
426 3300015262 Ga0182007_10002352 Ga0182007_100023524 251
427 3300015262 Ga0182007_10043268 Ga0182007_100432682 251
428 3300015262 Ga0182007_10045251 Ga0182007_100452512 251
429 3300025233 Ga0209437_100024 Ga0209437_100024266 251
430 3300025261 Ga0209233_1011353 Ga0209233_10113533 251
431 3300025913 Ga0207695_10052336 Ga0207695_100523363 251
432 3300025914 Ga0207671_10012136 Ga0207671_100121366 251
433 3300028794 Ga0307515_10013247 Ga0307515_1001324714 251
434 3300030742 Ga0316183_1043120 Ga0316183_104312010 251
435 3300030744 Ga0316181_1026561 Ga0316181_10265614 251
436 3300033179 Ga0307507_10000052 Ga0307507_1000005248 251
437 3300046471 Ga0495650_0000087 Ga0495650_0000087_59089_59889 251
438 3300046492 Ga0495585_0000167 Ga0495585_0000167_3639_4439 251
439 3300046492 Ga0495585_0003388 Ga0495585_0003388_2980_3780 251
440 3300046506 Ga0495583_0009915 Ga0495583_0009915_3414_4214 251
441 3300046506 Ga0495583_0032515 Ga0495583_0032515_1443_2246 251
442 3300046507 Ga0495606_0040906 Ga0495606_0040906_1132_1935 251
443 3300046507 Ga0495606_0051376 Ga0495606_0051376_589_1389 251
444 3300046507 Ga0495606_0089992 Ga0495606_0089992_307_1110 251
445 3300046513 Ga0495616_0002385 Ga0495616_0002385_5397_6197 251
446 3300046513 Ga0495616_0015653 Ga0495616_0015653_1117_1917 251
447 3300046524 Ga0495648_0005217 Ga0495648_0005217_8554_9354 251
448 3300046524 Ga0495648_0121880 Ga0495648_0121880_140_940 251
449 3300046524 Ga0495648_0134764 Ga0495648_0134764_473_1273 251
450 3300046538 Ga0495609_0010171 Ga0495609_0010171_1900_2700 251
451 3300046558 Ga0495633_0000029 Ga0495633_0000029_183381_184181 251
452 3300046616 Ga0495668_0000070 Ga0495668_0000070_50219_51019 251
453 3300046660 Ga0495625_0000008 Ga0495625_0000008_500851_501651 251
454 3300046660 Ga0495625_0001373 Ga0495625_0001373_19034_19834 251
455 3300046660 Ga0495625_0004000 Ga0495625_0004000_10653_11453 251
456 3300046660 Ga0495625_0011379 Ga0495625_0011379_4391_5194 251
457 3300046660 Ga0495625_0087965 Ga0495625_0087965_747_1547 251
458 3300046665 Ga0495661_0001581 Ga0495661_0001581_3780_4583 251
459 3300046665 Ga0495661_0002168 Ga0495661_0002168_11795_12595 251
460 3300046683 Ga0495658_0227872 Ga0495658_0227872_229_1029 251
461 3300046691 Ga0495670_0160168 Ga0495670_0160168_49_849 251
462 3300046694 Ga0495649_0000018 Ga0495649_0000018_34515_35315 251
463 3300046810 Ga0495660_0055936 Ga0495660_0055936_1199_1999 251
464 3300047443 Ga0495687_022506 Ga0495687_022506_2135_2938 251
465 3300047673 Ga0495593_0151465 Ga0495593_0151465_117_917 251
466 3300048089 Ga0495614_0055623 Ga0495614_0055623_658_1458 251
467 3300049459 Ga0495678_029384 Ga0495678_029384_816_1616 251
468 3300050493 nmdc:mga0k408_778_c1 nmdc:mga0k408_778_c1_8138_9013 251
469 3300053122 Ga0500608_005898 Ga0500608_005898_855_1655 251
470 3300053125 Ga0500618_000037 Ga0500618_000037_56008_56808 251
471 3300053157 Ga0500624_000134 Ga0500624_000134_1799_2602 251
472 iso_pu_bacteria 2919437846 2919438983 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

105

182

0.91

PF08544

GHMP_kinases_C

GHMP kinases C terminal

226

303

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4emd-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 0.8603 2 235
4ed4-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp 0.8404 2 236
3pyf-assembly1.cif.gz_A mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp 0.8185 2 235
2ww4-assembly1.cif.gz_B a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase 0.8074 1 250
2v2q-assembly1.cif.gz_A ispe in complex with ligand 0.8032 1 251
ID Description Score Start End Superfamily
4dxlA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8796 1 140 3.30.230.10
af_Q2G0S8_1_157_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.872 1 139 3.30.230.10
af_Q8S2G0_72_245_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8641 1 140 3.30.230.10
2v2qB01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8402 1 140 3.30.230.10
1oj4B01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8387 1 140 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A4Q5LN79-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9815 1 250 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A520C2E2-F1-model_v4 GHMP kinase C-terminal domain-containing protein 0.9785 119 250 GO:0050515
AF-A0A5M9HLL6-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9782 1 250 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A4Q5LN79-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9738 1 250 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A7X7C471-F1-model_v4 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC 2.7.1.148) 0.9726 108 251 GO:0050515

Feature Viewer

pLDDT pTM Quality
93.14 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map