F450774

General Info

Members Datasets Scaffolds Average Seq Length
472 207 472 57

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101584707|Ga0075428_1015847072
Length 63
Sequence MEINRMERKPETDGQGNEQETRKPYHKPEVIVYGNIREITRNAGPKGNLDGGGGAAAGPKTGV

Samples

Sample ID Description Type Environment
1 2088090001 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
162 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
171 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
172 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
173 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
174 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
175 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
176 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
177 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
178 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
179 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
180 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
181 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
182 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
183 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
184 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
185 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
186 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
189 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
190 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
191 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
192 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
193 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
194 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
195 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
196 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
197 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
198 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.27
Rhizosphere 98.52
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNB_F6ESG4R02I7Z3E 2088090001 Bacteria 515
2 CNBas_1005257 3300000531 Bacteria 739
3 rootL2_10354441 3300003322 Unclassified 1104
4 Ga0065714_10019362 3300005288 Bacteria 1845
5 Ga0065704_10611339 3300005289 Bacteria 602
6 Ga0065712_10000114 3300005290 Bacteria 191810
7 Ga0065712_10152222 3300005290 Unclassified 1337
8 Ga0065712_10198895 3300005290 Unclassified 1101
9 Ga0065715_10089469 3300005293 Bacteria 9986
10 Ga0065715_10118509 3300005293 Bacteria 2308
11 Ga0065715_10259159 3300005293 Unclassified 1096
12 Ga0065715_10622624 3300005293 Unclassified 694
13 Ga0065707_10289847 3300005295 Bacteria 1028
14 Ga0065707_10811535 3300005295 Unclassified 595
15 Ga0070690_100313983 3300005330 Bacteria 1127
16 Ga0070670_100121124 3300005331 Bacteria 2257
17 Ga0070670_100643436 3300005331 Bacteria 951
18 Ga0070670_100968846 3300005331 Unclassified 773
19 Ga0070666_10721202 3300005335 Unclassified 732
20 Ga0070680_102010311 3300005336 Unclassified 501
21 Ga0070682_100201951 3300005337 Bacteria 1403
22 Ga0068868_101922104 3300005338 Unclassified 561
23 Ga0070660_100358342 3300005339 Bacteria 1202
24 Ga0070689_101917092 3300005340 Unclassified 541
25 Ga0070687_100063881 3300005343 Bacteria 1954
26 Ga0070687_100655311 3300005343 Bacteria 728
27 Ga0070661_100394042 3300005344 Bacteria 1094
28 Ga0070692_10065809 3300005345 Unclassified 1920
29 Ga0070692_10412901 3300005345 Bacteria 855
30 Ga0070692_10428565 3300005345 Bacteria 841
31 Ga0070692_10543953 3300005345 Unclassified 760
32 Ga0070668_100790480 3300005347 Unclassified 842
33 Ga0070669_100059021 3300005353 Bacteria 2817
34 Ga0070669_100307052 3300005353 Bacteria 1277
35 Ga0070675_101665019 3300005354 Unclassified 589
36 Ga0070671_100424220 3300005355 Bacteria 1139
37 Ga0070673_100225598 3300005364 Bacteria 1623
38 Ga0070673_100404858 3300005364 Bacteria 1221
39 Ga0070673_100469992 3300005364 Bacteria 1134
40 Ga0070673_100634505 3300005364 Unclassified 977
41 Ga0070673_101939482 3300005364 Unclassified 559
42 Ga0070688_101429731 3300005365 Unclassified 561
43 Ga0070688_101711500 3300005365 Unclassified 515
44 Ga0070659_100495658 3300005366 Bacteria 1041
45 Ga0070659_101798186 3300005366 Bacteria 549
46 Ga0070703_10100286 3300005406 Bacteria 1019
47 Ga0070701_11394909 3300005438 Unclassified 504
48 Ga0070705_100004907 3300005440 Bacteria 6515
49 Ga0070705_100025772 3300005440 Bacteria 3192
50 Ga0070705_100218135 3300005440 Unclassified 1319
51 Ga0070705_100690184 3300005440 Unclassified 801
52 Ga0070705_100816595 3300005440 Bacteria 743
53 Ga0070705_101461147 3300005440 Unclassified 572
54 Ga0070700_100098694 3300005441 Bacteria 1920
55 Ga0070700_100217669 3300005441 Unclassified 1351
56 Ga0070700_100324270 3300005441 Bacteria 1133
57 Ga0070700_101046135 3300005441 Bacteria 674
58 Ga0070694_100016973 3300005444 Bacteria 4593
59 Ga0070694_100036020 3300005444 Bacteria 3275
60 Ga0070694_100115943 3300005444 Bacteria 1915
61 Ga0070694_100253267 3300005444 Bacteria 1333
62 Ga0070694_100329185 3300005444 Unclassified 1178
63 Ga0070694_100665773 3300005444 Unclassified 844
64 Ga0070708_100820756 3300005445 Bacteria 874
65 Ga0070681_10001543 3300005458 Bacteria 20396
66 Ga0068867_100222575 3300005459 Unclassified 1522
67 Ga0068867_101480139 3300005459 Unclassified 632
68 Ga0070685_10176365 3300005466 Bacteria 1373
69 Ga0070685_10492036 3300005466 Bacteria 866
70 Ga0070706_101701688 3300005467 Unclassified 574
71 Ga0070707_100446757 3300005468 Unclassified 1253
72 Ga0070698_100032273 3300005471 Bacteria 5425
73 Ga0070699_100012727 3300005518 Bacteria 7251
74 Ga0070699_100803048 3300005518 Unclassified 861
75 Ga0070697_101518221 3300005536 Unclassified 599
76 Ga0068853_100226522 3300005539 Bacteria 1709
77 Ga0068853_100463808 3300005539 Bacteria 1192
78 Ga0068853_100908588 3300005539 Unclassified 846
79 Ga0068853_101794568 3300005539 Bacteria 595
80 Ga0070695_100057571 3300005545 Unclassified 2512
81 Ga0070695_100190572 3300005545 Bacteria 1459
82 Ga0070695_100350479 3300005545 Bacteria 1106
83 Ga0070695_100370132 3300005545 Bacteria 1079
84 Ga0070695_100597438 3300005545 Unclassified 866
85 Ga0070695_101663833 3300005545 Unclassified 534
86 Ga0070696_100033670 3300005546 Bacteria 3522
87 Ga0070696_100034083 3300005546 Bacteria 3502
88 Ga0070696_100201385 3300005546 Unclassified 1486
89 Ga0070696_100275059 3300005546 Bacteria 1282
90 Ga0070696_100892943 3300005546 Unclassified 737
91 Ga0070696_101282953 3300005546 Unclassified 621
92 Ga0070696_101904117 3300005546 Unclassified 515
93 Ga0070693_100007410 3300005547 Bacteria 5363
94 Ga0070693_100027514 3300005547 Bacteria 3083
95 Ga0070693_100054346 3300005547 Bacteria 2303
96 Ga0070693_100097104 3300005547 Bacteria 1787
97 Ga0070693_100105942 3300005547 Unclassified 1721
98 Ga0070693_100152755 3300005547 Bacteria 1464
99 Ga0070693_100403363 3300005547 Bacteria 948
100 Ga0070704_100172989 3300005549 Bacteria 1719
101 Ga0070704_100298859 3300005549 Unclassified 1340
102 Ga0070704_100403492 3300005549 Bacteria 1167
103 Ga0070704_101331521 3300005549 Bacteria 657
104 Ga0068855_101574196 3300005563 Bacteria 673
105 Ga0070664_100516102 3300005564 Bacteria 1103
106 Ga0070664_100659928 3300005564 Bacteria 972
107 Ga0070664_100665875 3300005564 Unclassified 968
108 Ga0070664_101633468 3300005564 Unclassified 611
109 Ga0070664_102228052 3300005564 Bacteria 520
110 Ga0068857_100296321 3300005577 Bacteria 1490
111 Ga0068857_100304099 3300005577 Unclassified 1471
112 Ga0068857_100434855 3300005577 Bacteria 1225
113 Ga0068857_101942837 3300005577 Unclassified 577
114 Ga0068857_102019145 3300005577 Unclassified 565
115 Ga0068854_100495762 3300005578 Bacteria 1028
116 Ga0068854_100550455 3300005578 Bacteria 978
117 Ga0068854_100864088 3300005578 Unclassified 793
118 Ga0068854_101405615 3300005578 Unclassified 631
119 Ga0068856_100179967 3300005614 Bacteria 2127
120 Ga0068856_101070322 3300005614 Unclassified 824
121 Ga0068856_101385156 3300005614 Unclassified 718
122 Ga0070702_100054395 3300005615 Bacteria 2303
123 Ga0070702_100069647 3300005615 Bacteria 2074
124 Ga0070702_100166822 3300005615 Bacteria 1429
125 Ga0070702_100279726 3300005615 Bacteria 1145
126 Ga0068852_101196300 3300005616 Bacteria 781
127 Ga0068859_100003377 3300005617 Bacteria 16230
128 Ga0068859_100142007 3300005617 Bacteria 2475
129 Ga0068859_100167043 3300005617 Bacteria 2280
130 Ga0068859_100182093 3300005617 Bacteria 2184
131 Ga0068859_100221117 3300005617 Unclassified 1981
132 Ga0068859_100584362 3300005617 Unclassified 1210
133 Ga0068859_101047816 3300005617 Bacteria 896
134 Ga0068859_102827181 3300005617 Unclassified 532
135 Ga0068859_103007311 3300005617 Bacteria 515
136 Ga0068859_103024347 3300005617 Unclassified 513
137 Ga0068859_103171285 3300005617 Unclassified 501
138 Ga0068864_100259377 3300005618 Bacteria 1616
139 Ga0068864_100365476 3300005618 Bacteria 1364
140 Ga0068864_100394309 3300005618 Unclassified 1314
141 Ga0068864_100604316 3300005618 Bacteria 1065
142 Ga0068864_100947671 3300005618 Unclassified 852
143 Ga0068864_102127057 3300005618 Unclassified 568
144 Ga0068861_100008175 3300005719 Bacteria 7200
145 Ga0068861_101115810 3300005719 Unclassified 759
146 Ga0068861_101765330 3300005719 Unclassified 613
147 Ga0068851_10037454 3300005834 Bacteria 2431
148 Ga0068870_10140525 3300005840 Unclassified 1412
149 Ga0068870_10153139 3300005840 Bacteria 1360
150 Ga0068870_11151300 3300005840 Unclassified 560
151 Ga0068863_100153135 3300005841 Bacteria 2207
152 Ga0068863_100470826 3300005841 Bacteria 1235
153 Ga0068863_100980285 3300005841 Bacteria 847
154 Ga0068858_100124924 3300005842 Bacteria 2408
155 Ga0068858_100255034 3300005842 Unclassified 1666
156 Ga0068858_100454617 3300005842 Unclassified 1234
157 Ga0068858_100539205 3300005842 Bacteria 1129
158 Ga0068858_101397173 3300005842 Unclassified 690
159 Ga0068858_101476752 3300005842 Bacteria 670
160 Ga0068860_100632901 3300005843 Bacteria 1077
161 Ga0068860_100866292 3300005843 Unclassified 918
162 Ga0068860_101447030 3300005843 Unclassified 709
163 Ga0068860_102109258 3300005843 Bacteria 585
164 Ga0068860_102746494 3300005843 Unclassified 511
165 Ga0068862_100347665 3300005844 Bacteria 1375
166 Ga0068862_100399859 3300005844 Unclassified 1285
167 Ga0068862_100925003 3300005844 Unclassified 859
168 Ga0070716_100306972 3300006173 Unclassified 1106
169 Ga0070716_101106888 3300006173 Unclassified 632
170 Ga0070716_101480422 3300006173 Bacteria 554
171 Ga0097621_100028361 3300006237 Bacteria 4412
172 Ga0068871_100010327 3300006358 Bacteria 6806
173 Ga0068871_100833600 3300006358 Bacteria 852
174 Ga0068871_101509251 3300006358 Unclassified 635
175 Ga0075428_100099551 3300006844 Plasmid 3170
176 Ga0075428_101584707 3300006844 Unclassified 685
177 Ga0075430_100035553 3300006846 Unclassified 4226
178 Ga0075430_101181334 3300006846 Unclassified 630
179 Ga0075431_100740134 3300006847 Unclassified 959
180 Ga0075431_100766317 3300006847 Unclassified 940
181 Ga0075431_101024871 3300006847 Unclassified 792
182 Ga0075433_10113712 3300006852 Bacteria 2401
183 Ga0075433_10130514 3300006852 Unclassified 2232
184 Ga0075433_10217519 3300006852 Bacteria 1697
185 Ga0075433_10481840 3300006852 Unclassified 1093
186 Ga0075433_10616567 3300006852 Bacteria 952
187 Ga0075433_10668015 3300006852 Bacteria 911
188 Ga0075434_100323148 3300006871 Bacteria 1563
189 Ga0075429_100454266 3300006880 Unclassified 1123
190 Ga0075429_100810149 3300006880 Bacteria 820
191 Ga0075429_101222654 3300006880 Unclassified 656
192 Ga0068865_100768115 3300006881 Unclassified 829
193 Ga0075436_100266603 3300006914 Bacteria 1222
194 Ga0075436_100904964 3300006914 Unclassified 660
195 Ga0097620_100003377 3300006931 Bacteria 16230
196 Ga0097620_100142004 3300006931 Bacteria 2475
197 Ga0097620_100167037 3300006931 Bacteria 2280
198 Ga0097620_100182083 3300006931 Bacteria 2184
199 Ga0097620_100184520 3300006931 Bacteria 2170
200 Ga0097620_100221127 3300006931 Unclassified 1981
201 Ga0097620_100584371 3300006931 Unclassified 1210
202 Ga0097620_101047831 3300006931 Bacteria 896
203 Ga0097620_102827154 3300006931 Unclassified 532
204 Ga0097620_103008585 3300006931 Bacteria 515
205 Ga0097620_103024321 3300006931 Unclassified 513
206 Ga0097620_103171503 3300006931 Unclassified 501
207 Ga0075435_100142206 3300007076 Bacteria 2013
208 Ga0105240_10084831 3300009093 Bacteria 3882
209 Ga0105240_10690583 3300009093 Bacteria 1115
210 Ga0105240_10710607 3300009093 Unclassified 1096
211 Ga0111539_10188092 3300009094 Bacteria 2410
212 Ga0111539_10275990 3300009094 Unclassified 1956
213 Ga0111539_11504350 3300009094 Unclassified 781
214 Ga0111539_12028718 3300009094 Unclassified 667
215 Ga0105245_11195952 3300009098 Unclassified 808
216 Ga0105245_11418010 3300009098 Unclassified 745
217 Ga0105245_12184723 3300009098 Unclassified 607
218 Ga0105245_12881005 3300009098 Unclassified 533
219 Ga0105247_10154849 3300009101 Bacteria 1513
220 Ga0105247_10479139 3300009101 Bacteria 903
221 Ga0105247_10634561 3300009101 Bacteria 796
222 Ga0105247_10652047 3300009101 Bacteria 787
223 Ga0105247_10880810 3300009101 Unclassified 690
224 Ga0114129_10141403 3300009147 Bacteria 3298
225 Ga0114129_10146321 3300009147 Bacteria 3237
226 Ga0114129_10822841 3300009147 Bacteria 1183
227 Ga0114129_11089821 3300009147 Unclassified 1001
228 Ga0114129_11111848 3300009147 Unclassified 989
229 Ga0114129_11136469 3300009147 Bacteria 976
230 Ga0105243_11014017 3300009148 Unclassified 833
231 Ga0105243_11054669 3300009148 Unclassified 819
232 Ga0105243_11645107 3300009148 Unclassified 670
233 Ga0105241_10053864 3300009174 Bacteria 3078
234 Ga0105241_10280874 3300009174 Unclassified 1422
235 Ga0105241_10335875 3300009174 Unclassified 1307
236 Ga0105241_10456207 3300009174 Bacteria 1131
237 Ga0105241_10595971 3300009174 Bacteria 998
238 Ga0105241_10734280 3300009174 Unclassified 904
239 Ga0105241_10858994 3300009174 Unclassified 840
240 Ga0105241_11263036 3300009174 Unclassified 702
241 Ga0105241_11364264 3300009174 Unclassified 677
242 Ga0105242_10113235 3300009176 Bacteria 2316
243 Ga0105242_12157744 3300009176 Bacteria 602
244 Ga0105242_12543649 3300009176 Bacteria 560
245 Ga0105248_10008530 3300009177 Bacteria 11252
246 Ga0105248_10113935 3300009177 Bacteria 3050
247 Ga0105248_10153739 3300009177 Bacteria 2596
248 Ga0105248_10159931 3300009177 Unclassified 2541
249 Ga0105248_10301654 3300009177 Bacteria 1804
250 Ga0105248_10702193 3300009177 Bacteria 1141
251 Ga0105248_11522367 3300009177 Unclassified 757
252 Ga0105237_10002156 3300009545 Bacteria 24760
253 Ga0105237_10030313 3300009545 Bacteria 5496
254 Ga0105237_11549969 3300009545 Unclassified 669
255 Ga0105238_10007972 3300009551 Bacteria 10598
256 Ga0105238_10437047 3300009551 Bacteria 1305
257 Ga0105238_10890952 3300009551 Unclassified 908
258 Ga0105238_12124593 3300009551 Unclassified 596
259 Ga0105249_11674618 3300009553 Unclassified 709
260 Ga0105239_10328149 3300010375 Unclassified 1726
261 Ga0105239_10612946 3300010375 Bacteria 1242
262 Ga0105239_10623476 3300010375 Bacteria 1231
263 Ga0105239_11686540 3300010375 Unclassified 733
264 Ga0105239_12229668 3300010375 Unclassified 637
265 Ga0105246_10163564 3300011119 Unclassified 1698
266 Ga0105246_10241592 3300011119 Bacteria 1428
267 Ga0105246_10326776 3300011119 Bacteria 1249
268 Ga0105246_11299053 3300011119 Unclassified 674
269 Ga0157373_10029813 3300013100 Bacteria 3927
270 Ga0157373_10044781 3300013100 Bacteria 3159
271 Ga0157373_11011339 3300013100 Unclassified 621
272 Ga0157371_10695314 3300013102 Unclassified 761
273 Ga0157378_10667826 3300013297 Bacteria 1056
274 Ga0163162_10018622 3300013306 Bacteria 6803
275 Ga0163162_11050670 3300013306 Unclassified 922
276 Ga0157372_10004937 3300013307 Bacteria 14164
277 Ga0157372_11236077 3300013307 Unclassified 863
278 Ga0157375_10484170 3300013308 Bacteria 1402
279 Ga0157375_10603639 3300013308 Unclassified 1256
280 Ga0157375_12652896 3300013308 Unclassified 599
281 Ga0157375_12886535 3300013308 Unclassified 574
282 Ga0163163_10016445 3300014325 Bacteria 6877
283 Ga0163163_10119367 3300014325 Bacteria 2670
284 Ga0163163_10157832 3300014325 Unclassified 2313
285 Ga0163163_11402604 3300014325 Unclassified 760
286 Ga0163163_11544160 3300014325 Unclassified 725
287 Ga0157380_10108829 3300014326 Bacteria 2324
288 Ga0157380_10227287 3300014326 Bacteria 1673
289 Ga0157380_10612887 3300014326 Bacteria 1079
290 Ga0157380_13417409 3300014326 Bacteria 508
291 Ga0157377_10251233 3300014745 Bacteria 1146
292 Ga0157377_10314422 3300014745 Bacteria 1038
293 Ga0157377_11383214 3300014745 Unclassified 554
294 Ga0157379_10076207 3300014968 Bacteria 3003
295 Ga0157379_10306308 3300014968 Unclassified 1448
296 Ga0157379_10384692 3300014968 Unclassified 1288
297 Ga0157376_10145804 3300014969 Bacteria 2129
298 Ga0182007_10141161 3300015262 Unclassified 815
299 Ga0207656_10002801 3300025321 Bacteria 5929
300 Ga0207653_10002457 3300025885 Bacteria 5887
301 Ga0207692_10901482 3300025898 Unclassified 582
302 Ga0207710_10180742 3300025900 Bacteria 1035
303 Ga0207710_10240923 3300025900 Bacteria 902
304 Ga0207710_10536062 3300025900 Unclassified 609
305 Ga0207647_10056875 3300025904 Bacteria 2399
306 Ga0207647_10080441 3300025904 Archaea 1954
307 Ga0207643_10040024 3300025908 Bacteria 2638
308 Ga0207684_10000030 3300025910 Bacteria 300037
309 Ga0207684_10927249 3300025910 Bacteria 731
310 Ga0207654_10032187 3300025911 Bacteria 2895
311 Ga0207707_10003076 3300025912 Bacteria 14812
312 Ga0207695_10216770 3300025913 Unclassified 1822
313 Ga0207695_11061719 3300025913 Unclassified 690
314 Ga0207671_10008447 3300025914 Bacteria 8729
315 Ga0207671_10644414 3300025914 Unclassified 844
316 Ga0207660_11442719 3300025917 Unclassified 557
317 Ga0207662_10022673 3300025918 Bacteria 3602
318 Ga0207662_10814369 3300025918 Bacteria 659
319 Ga0207649_10685091 3300025920 Unclassified 794
320 Ga0207646_10710395 3300025922 Bacteria 898
321 Ga0207681_10120012 3300025923 Bacteria 1927
322 Ga0207681_10831614 3300025923 Bacteria 772
323 Ga0207694_10009517 3300025924 Bacteria 7328
324 Ga0207694_11431536 3300025924 Bacteria 584
325 Ga0207650_10337102 3300025925 Unclassified 1238
326 Ga0207650_10759552 3300025925 Unclassified 821
327 Ga0207650_10965012 3300025925 Unclassified 725
328 Ga0207650_11033474 3300025925 Unclassified 699
329 Ga0207659_11342487 3300025926 Unclassified 613
330 Ga0207644_10176698 3300025931 Bacteria 1671
331 Ga0207706_10080996 3300025933 Bacteria 2853
332 Ga0207665_10144716 3300025939 Unclassified 1698
333 Ga0207665_10353281 3300025939 Unclassified 1110
334 Ga0207711_10044279 3300025941 Unclassified 3799
335 Ga0207711_10068996 3300025941 Bacteria 3063
336 Ga0207711_10109901 3300025941 Bacteria 2450
337 Ga0207711_10115313 3300025941 Bacteria 2394
338 Ga0207711_10271464 3300025941 Bacteria 1560
339 Ga0207711_10422193 3300025941 Bacteria 1240
340 Ga0207689_10062769 3300025942 Bacteria 3056
341 Ga0207689_10307345 3300025942 Unclassified 1315
342 Ga0207689_10340283 3300025942 Bacteria 1246
343 Ga0207689_10431575 3300025942 Unclassified 1100
344 Ga0207689_11133583 3300025942 Bacteria 659
345 Ga0207679_10504433 3300025945 Bacteria 1080
346 Ga0207679_10632488 3300025945 Unclassified 967
347 Ga0207679_10779703 3300025945 Unclassified 871
348 Ga0207651_10223792 3300025960 Bacteria 1523
349 Ga0207651_10262832 3300025960 Bacteria 1418
350 Ga0207640_10638908 3300025981 Bacteria 905
351 Ga0207640_12158784 3300025981 Bacteria 505
352 Ga0207677_11360636 3300026023 Unclassified 653
353 Ga0207703_10103264 3300026035 Bacteria 2420
354 Ga0207703_10453544 3300026035 Unclassified 1198
355 Ga0207703_10594685 3300026035 Unclassified 1046
356 Ga0207703_11188561 3300026035 Unclassified 733
357 Ga0207639_10389517 3300026041 Bacteria 1253
358 Ga0207639_10569414 3300026041 Bacteria 1042
359 Ga0207639_10853693 3300026041 Unclassified 850
360 Ga0207639_11067230 3300026041 Unclassified 757
361 Ga0207708_10000224 3300026075 Bacteria 44906
362 Ga0207708_10002850 3300026075 Bacteria 12721
363 Ga0207708_10238015 3300026075 Unclassified 1463
364 Ga0207708_10239554 3300026075 Unclassified 1459
365 Ga0207702_10276040 3300026078 Bacteria 1587
366 Ga0207641_10233193 3300026088 Bacteria 1711
367 Ga0207648_10796386 3300026089 Unclassified 879
368 Ga0207676_10416811 3300026095 Unclassified 1258
369 Ga0207676_10524919 3300026095 Bacteria 1127
370 Ga0207676_11268269 3300026095 Bacteria 731
371 Ga0207674_10096966 3300026116 Bacteria 2933
372 Ga0207674_10159073 3300026116 Unclassified 2214
373 Ga0207674_10436731 3300026116 Unclassified 1265
374 Ga0207674_11891097 3300026116 Unclassified 563
375 Ga0207675_100013986 3300026118 Bacteria 7482
376 Ga0207698_10771095 3300026142 Bacteria 962
377 Ga0207428_10688010 3300027907 Bacteria 732
378 Ga0207428_11048585 3300027907 Unclassified 571
379 Ga0268265_10319454 3300028380 Bacteria 1405
380 Ga0268265_12627125 3300028380 Unclassified 509
381 Ga0268264_10703060 3300028381 Bacteria 1004
382 Ga0268264_10712067 3300028381 Bacteria 998
383 Ga0268264_11558213 3300028381 Bacteria 671
384 Ga0268264_11805938 3300028381 Unclassified 621
385 Ga0326468_10108654 3300031889 Bacteria 523
386 Ga0307406_11414721 3300031901 Unclassified 610
387 Ga0307416_101340556 3300032002 Unclassified 821
388 Ga0307414_11417698 3300032004 Unclassified 646
389 Ga0307411_10694086 3300032005 Unclassified 886
390 Ga0373930_0055817 3300034816 Bacteria 872
391 Ga0373940_0066237 3300035088 Bacteria 1043
392 Ga0373949_0050069 3300035090 Bacteria 1050
393 Ga0373951_0000629 3300035091 Bacteria 9723
394 Ga0373951_0083066 3300035091 Unclassified 831
395 Ga0373952_0199476 3300035092 Unclassified 586
396 Ga0373932_0131839 3300035112 Unclassified 843
397 Ga0373932_0293252 3300035112 Unclassified 605
398 Ga0373939_0203795 3300035114 Unclassified 749
399 Ga0373941_0194783 3300035115 Unclassified 767
400 Ga0373960_0282684 3300035121 Unclassified 612
401 Ga0373942_0141572 3300035207 Unclassified 766
402 Ga0373961_0091184 3300035241 Unclassified 974
403 Ga0373931_0972175 3300035691 Unclassified 573
404 Ga0395900_0394783 3300037418 Bacteria 1349
405 Ga0395898_1263412 3300037466 Bacteria 668
406 Ga0439461_0073619 3300041410 Unclassified 795
407 Ga0450905_068293 3300042142 Unclassified 603
408 Ga0439446_0112318 3300042156 Unclassified 870
409 Ga0453683_0490395 3300044673 Unclassified 797
410 Ga0451576_0123846 3300045051 Unclassified 2693
411 Ga0451576_0687285 3300045051 Unclassified 1075
412 Ga0451576_0822889 3300045051 Unclassified 975
413 Ga0496102_1556425 3300048905 Unclassified 580
414 Ga0496112_0042721 3300048915 Bacteria 4436
415 Ga0496112_0301807 3300048915 Unclassified 1547
416 Ga0496112_0885297 3300048915 Bacteria 815
417 Ga0496112_0955646 3300048915 Unclassified 778
418 Ga0496113_0095663 3300048916 Bacteria 2296
419 Ga0501308_023957 3300049128 Unclassified 782
420 Ga0501292_085107 3300049515 Unclassified 607
421 Ga0501293_014287 3300049516 Unclassified 720
422 Ga0501296_014429 3300049519 Bacteria 969
423 Ga0501299_019351 3300049522 Bacteria 1231
424 Ga0501299_046893 3300049522 Unclassified 883
425 Ga0501202_134574 3300049652 Unclassified 633
426 Ga0501207_058534 3300049654 Unclassified 702
427 Ga0501217_011531 3300049661 Bacteria 1957
428 Ga0501217_024627 3300049661 Unclassified 1441
429 Ga0501223_014288 3300049663 Unclassified 1576
430 Ga0501223_031304 3300049663 Unclassified 1035
431 Ga0501224_073008 3300049664 Unclassified 543
432 Ga0501227_052122 3300049665 Unclassified 1035
433 Ga0501227_086811 3300049665 Unclassified 823
434 Ga0501233_042224 3300049668 Unclassified 1076
435 Ga0501239_078438 3300049672 Unclassified 525
436 Ga0501240_091598 3300049673 Unclassified 575
437 Ga0501247_037311 3300049677 Unclassified 684
438 Ga0501259_059461 3300049688 Unclassified 795
439 Ga0501261_022610 3300049690 Unclassified 911
440 Ga0501221_029312 3300049704 Unclassified 1138
441 Ga0501225_0299755 3300049705 Unclassified 543
442 Ga0501225_0301086 3300049705 Unclassified 542
443 Ga0501234_008279 3300049707 Bacteria 1623
444 Ga0501245_024120 3300049708 Unclassified 970
445 Ga0501241_011281 3300049758 Unclassified 1623
446 Ga0501262_011536 3300049759 Unclassified 1120
447 Ga0501264_039524 3300049761 Unclassified 574
448 Ga0501265_011645 3300049762 Unclassified 1087
449 Ga0501268_020286 3300049765 Unclassified 1131
450 Ga0501272_070886 3300049769 Unclassified 510
451 Ga0501273_015492 3300049770 Unclassified 990
452 Ga0501279_003319 3300049775 Bacteria 2097
453 Ga0501212_029879 3300049851 Unclassified 875
454 nmdc:mga05p37_1177488_c1 3300050507 Unclassified 794
455 nmdc:mga05p37_1186285_c1 3300050507 Unclassified 790
456 nmdc:mga05p37_415548_c1 3300050507 Bacteria 1567
457 nmdc:mga09592_486073_c1 3300050508 Unclassified 1063
458 nmdc:mga0qj67_32261_c1 3300050509 Unclassified 4084
459 nmdc:mga06r32_1712384_c1 3300050510 Unclassified 565
460 nmdc:mga06r32_750302_c1 3300050510 Unclassified 939
461 nmdc:mga06r32_812820_c1 3300050510 Unclassified 895
462 nmdc:mga08y16_2018616_c1 3300050511 Unclassified 526
463 nmdc:mga08y16_250114_c1 3300050511 Unclassified 1832
464 nmdc:mga08y16_651576_c1 3300050511 Unclassified 1057
465 nmdc:mga08y16_821378_c1 3300050511 Bacteria 921
466 nmdc:mga0n895_894556_c1 3300050512 Bacteria 874
467 nmdc:mga0rr50_288283_c1 3300050513 Bacteria 1371
468 nmdc:mga08x19_254343_c1 3300050514 Bacteria 1213
469 nmdc:mga0a205_1014767_c1 3300050515 Unclassified 677
470 nmdc:mga0a205_107036_c1 3300050515 Bacteria 2694
471 nmdc:mga0a205_344445_c1 3300050515 Bacteria 1359
472 nmdc:mga0a205_67592_c1 3300050515 Bacteria 3452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10354441 rootL2_103544412 48
2 3300005617 Ga0068859_100003377 Ga0068859_1000033774 52
3 3300006852 Ga0075433_10130514 Ga0075433_101305141 52
4 3300006914 Ga0075436_100266603 Ga0075436_1002666032 52
5 3300006931 Ga0097620_100003377 Ga0097620_10000337713 52
6 3300009101 Ga0105247_10634561 Ga0105247_106345612 52
7 3300009177 Ga0105248_10153739 Ga0105248_101537393 52
8 3300025900 Ga0207710_10240923 Ga0207710_102409232 52
9 3300025941 Ga0207711_10109901 Ga0207711_101099013 52
10 3300050515 nmdc:mga0a205_1014767_c1 nmdc:mga0a205_1014767_c1_260_436 52
11 3300005295 Ga0065707_10811535 Ga0065707_108115352 53
12 3300006852 Ga0075433_10668015 Ga0075433_106680152 53
13 3300050514 nmdc:mga08x19_254343_c1 nmdc:mga08x19_254343_c1_740_916 53
14 3300005539 Ga0068853_100463808 Ga0068853_1004638082 54
15 3300005564 Ga0070664_100659928 Ga0070664_1006599282 54
16 3300005577 Ga0068857_101942837 Ga0068857_1019428371 54
17 3300006931 Ga0097620_100184520 Ga0097620_1001845201 54
18 3300009098 Ga0105245_11418010 Ga0105245_114180101 54
19 3300009545 Ga0105237_11549969 Ga0105237_115499692 54
20 3300009551 Ga0105238_10007972 Ga0105238_100079728 54
21 3300009551 Ga0105238_10890952 Ga0105238_108909522 54
22 3300013308 Ga0157375_12652896 Ga0157375_126528962 54
23 3300025920 Ga0207649_10685091 Ga0207649_106850911 54
24 3300025924 Ga0207694_10009517 Ga0207694_100095173 54
25 3300025933 Ga0207706_10080996 Ga0207706_100809963 54
26 3300025945 Ga0207679_10504433 Ga0207679_105044332 54
27 3300026041 Ga0207639_10389517 Ga0207639_103895172 54
28 3300048915 Ga0496112_0885297 Ga0496112_0885297_12_176 54
29 3300005467 Ga0070706_101701688 Ga0070706_1017016881 55
30 3300005468 Ga0070707_100446757 Ga0070707_1004467571 55
31 3300005518 Ga0070699_100803048 Ga0070699_1008030481 55
32 3300005546 Ga0070696_100033670 Ga0070696_1000336703 55
33 3300006852 Ga0075433_10113712 Ga0075433_101137122 55
34 3300006914 Ga0075436_100904964 Ga0075436_1009049641 55
35 3300007076 Ga0075435_100142206 Ga0075435_1001422061 55
36 3300009174 Ga0105241_10595971 Ga0105241_105959711 55
37 3300050513 nmdc:mga0rr50_288283_c1 nmdc:mga0rr50_288283_c1_254_421 55
38 3300050515 nmdc:mga0a205_67592_c1 nmdc:mga0a205_67592_c1_3004_3171 55
39 3300005337 Ga0070682_100201951 Ga0070682_1002019512 56
40 3300005339 Ga0070660_100358342 Ga0070660_1003583422 56
41 3300005344 Ga0070661_100394042 Ga0070661_1003940422 56
42 3300005345 Ga0070692_10412901 Ga0070692_104129012 56
43 3300005345 Ga0070692_10543953 Ga0070692_105439532 56
44 3300005353 Ga0070669_100307052 Ga0070669_1003070522 56
45 3300005355 Ga0070671_100424220 Ga0070671_1004242201 56
46 3300005364 Ga0070673_100469992 Ga0070673_1004699922 56
47 3300005365 Ga0070688_101711500 Ga0070688_1017115001 56
48 3300005366 Ga0070659_100495658 Ga0070659_1004956582 56
49 3300005366 Ga0070659_101798186 Ga0070659_1017981861 56
50 3300005406 Ga0070703_10100286 Ga0070703_101002862 56
51 3300005438 Ga0070701_11394909 Ga0070701_113949092 56
52 3300005440 Ga0070705_100004907 Ga0070705_1000049075 56
53 3300005440 Ga0070705_101461147 Ga0070705_1014611472 56
54 3300005441 Ga0070700_100098694 Ga0070700_1000986942 56
55 3300005441 Ga0070700_100217669 Ga0070700_1002176691 56
56 3300005444 Ga0070694_100036020 Ga0070694_1000360202 56
57 3300005444 Ga0070694_100329185 Ga0070694_1003291852 56
58 3300005445 Ga0070708_100820756 Ga0070708_1008207562 56
59 3300005545 Ga0070695_100370132 Ga0070695_1003701322 56
60 3300005546 Ga0070696_100275059 Ga0070696_1002750592 56
61 3300005546 Ga0070696_101904117 Ga0070696_1019041172 56
62 3300005547 Ga0070693_100007410 Ga0070693_1000074104 56
63 3300005547 Ga0070693_100097104 Ga0070693_1000971041 56
64 3300005547 Ga0070693_100152755 Ga0070693_1001527552 56
65 3300005547 Ga0070693_100403363 Ga0070693_1004033631 56
66 3300005549 Ga0070704_100403492 Ga0070704_1004034922 56
67 3300005563 Ga0068855_101574196 Ga0068855_1015741962 56
68 3300005564 Ga0070664_100665875 Ga0070664_1006658752 56
69 3300005564 Ga0070664_101633468 Ga0070664_1016334681 56
70 3300005564 Ga0070664_102228052 Ga0070664_1022280522 56
71 3300005577 Ga0068857_100296321 Ga0068857_1002963212 56
72 3300005577 Ga0068857_100304099 Ga0068857_1003040992 56
73 3300005577 Ga0068857_102019145 Ga0068857_1020191452 56
74 3300005578 Ga0068854_100495762 Ga0068854_1004957622 56
75 3300005614 Ga0068856_101385156 Ga0068856_1013851561 56
76 3300005615 Ga0070702_100054395 Ga0070702_1000543954 56
77 3300005615 Ga0070702_100069647 Ga0070702_1000696473 56
78 3300005615 Ga0070702_100166822 Ga0070702_1001668222 56
79 3300005616 Ga0068852_101196300 Ga0068852_1011963001 56
80 3300005617 Ga0068859_100142007 Ga0068859_1001420073 56
81 3300005617 Ga0068859_100221117 Ga0068859_1002211173 56
82 3300005617 Ga0068859_101047816 Ga0068859_1010478162 56
83 3300005617 Ga0068859_102827181 Ga0068859_1028271811 56
84 3300005617 Ga0068859_103024347 Ga0068859_1030243471 56
85 3300005617 Ga0068859_103171285 Ga0068859_1031712851 56
86 3300005618 Ga0068864_100365476 Ga0068864_1003654762 56
87 3300005719 Ga0068861_101115810 Ga0068861_1011158102 56
88 3300005834 Ga0068851_10037454 Ga0068851_100374542 56
89 3300005841 Ga0068863_100470826 Ga0068863_1004708262 56
90 3300005842 Ga0068858_100255034 Ga0068858_1002550342 56
91 3300005842 Ga0068858_100539205 Ga0068858_1005392052 56
92 3300005842 Ga0068858_101397173 Ga0068858_1013971732 56
93 3300005843 Ga0068860_100866292 Ga0068860_1008662922 56
94 3300005843 Ga0068860_102109258 Ga0068860_1021092581 56
95 3300006237 Ga0097621_100028361 Ga0097621_1000283614 56
96 3300006358 Ga0068871_100010327 Ga0068871_1000103274 56
97 3300006844 Ga0075428_100099551 Ga0075428_1000995512 56
98 3300006880 Ga0075429_100810149 Ga0075429_1008101492 56
99 3300006880 Ga0075429_101222654 Ga0075429_1012226542 56
100 3300006931 Ga0097620_100142004 Ga0097620_1001420043 56
101 3300006931 Ga0097620_100221127 Ga0097620_1002211272 56
102 3300006931 Ga0097620_101047831 Ga0097620_1010478312 56
103 3300006931 Ga0097620_102827154 Ga0097620_1028271541 56
104 3300006931 Ga0097620_103024321 Ga0097620_1030243211 56
105 3300006931 Ga0097620_103171503 Ga0097620_1031715031 56
106 3300009093 Ga0105240_10084831 Ga0105240_100848314 56
107 3300009094 Ga0111539_10188092 Ga0111539_101880922 56
108 3300009101 Ga0105247_10479139 Ga0105247_104791392 56
109 3300009147 Ga0114129_10141403 Ga0114129_101414032 56
110 3300009148 Ga0105243_11645107 Ga0105243_116451072 56
111 3300009174 Ga0105241_10053864 Ga0105241_100538644 56
112 3300009174 Ga0105241_10456207 Ga0105241_104562072 56
113 3300009176 Ga0105242_10113235 Ga0105242_101132353 56
114 3300009177 Ga0105248_10113935 Ga0105248_101139354 56
115 3300009177 Ga0105248_11522367 Ga0105248_115223671 56
116 3300009545 Ga0105237_10002156 Ga0105237_100021564 56
117 3300009553 Ga0105249_11674618 Ga0105249_116746182 56
118 3300010375 Ga0105239_10328149 Ga0105239_103281492 56
119 3300011119 Ga0105246_10241592 Ga0105246_102415922 56
120 3300011119 Ga0105246_10326776 Ga0105246_103267762 56
121 3300013100 Ga0157373_11011339 Ga0157373_110113392 56
122 3300013307 Ga0157372_10004937 Ga0157372_100049374 56
123 3300014325 Ga0163163_10119367 Ga0163163_101193672 56
124 3300014325 Ga0163163_11402604 Ga0163163_114026042 56
125 3300014325 Ga0163163_11544160 Ga0163163_115441602 56
126 3300014326 Ga0157380_10108829 Ga0157380_101088293 56
127 3300014326 Ga0157380_10227287 Ga0157380_102272872 56
128 3300014326 Ga0157380_13417409 Ga0157380_134174091 56
129 3300014969 Ga0157376_10145804 Ga0157376_101458042 56
130 3300015262 Ga0182007_10141161 Ga0182007_101411612 56
131 3300025321 Ga0207656_10002801 Ga0207656_100028012 56
132 3300025885 Ga0207653_10002457 Ga0207653_100024572 56
133 3300025900 Ga0207710_10536062 Ga0207710_105360622 56
134 3300025904 Ga0207647_10080441 Ga0207647_100804413 56
135 3300025911 Ga0207654_10032187 Ga0207654_100321873 56
136 3300025913 Ga0207695_10216770 Ga0207695_102167702 56
137 3300025914 Ga0207671_10008447 Ga0207671_100084475 56
138 3300025918 Ga0207662_10814369 Ga0207662_108143691 56
139 3300025923 Ga0207681_10831614 Ga0207681_108316142 56
140 3300025925 Ga0207650_10759552 Ga0207650_107595522 56
141 3300025931 Ga0207644_10176698 Ga0207644_101766981 56
142 3300025941 Ga0207711_10044279 Ga0207711_100442792 56
143 3300025942 Ga0207689_11133583 Ga0207689_111335832 56
144 3300025945 Ga0207679_10632488 Ga0207679_106324882 56
145 3300025945 Ga0207679_10779703 Ga0207679_107797032 56
146 3300025981 Ga0207640_10638908 Ga0207640_106389082 56
147 3300026035 Ga0207703_10453544 Ga0207703_104535442 56
148 3300026075 Ga0207708_10002850 Ga0207708_100028509 56
149 3300026075 Ga0207708_10239554 Ga0207708_102395542 56
150 3300026088 Ga0207641_10233193 Ga0207641_102331932 56
151 3300026095 Ga0207676_10524919 Ga0207676_105249192 56
152 3300026116 Ga0207674_10096966 Ga0207674_100969662 56
153 3300026116 Ga0207674_10159073 Ga0207674_101590733 56
154 3300026116 Ga0207674_11891097 Ga0207674_118910971 56
155 3300026142 Ga0207698_10771095 Ga0207698_107710952 56
156 3300028381 Ga0268264_11805938 Ga0268264_118059382 56
157 3300035090 Ga0373949_0050069 Ga0373949_0050069_557_727 56
158 3300048905 Ga0496102_1556425 Ga0496102_1556425_214_387 56
159 3300049128 Ga0501308_023957 Ga0501308_023957_214_384 56
160 3300049515 Ga0501292_085107 Ga0501292_085107_86_256 56
161 3300049519 Ga0501296_014429 Ga0501296_014429_753_923 56
162 3300049522 Ga0501299_019351 Ga0501299_019351_196_366 56
163 3300049654 Ga0501207_058534 Ga0501207_058534_100_270 56
164 3300049661 Ga0501217_011531 Ga0501217_011531_1029_1199 56
165 3300049663 Ga0501223_014288 Ga0501223_014288_790_960 56
166 3300049664 Ga0501224_073008 Ga0501224_073008_341_511 56
167 3300049665 Ga0501227_086811 Ga0501227_086811_172_342 56
168 3300049672 Ga0501239_078438 Ga0501239_078438_303_473 56
169 3300049673 Ga0501240_091598 Ga0501240_091598_313_483 56
170 3300049677 Ga0501247_037311 Ga0501247_037311_60_230 56
171 3300049688 Ga0501259_059461 Ga0501259_059461_85_255 56
172 3300049690 Ga0501261_022610 Ga0501261_022610_560_730 56
173 3300049704 Ga0501221_029312 Ga0501221_029312_878_1048 56
174 3300049705 Ga0501225_0299755 Ga0501225_0299755_13_183 56
175 3300049707 Ga0501234_008279 Ga0501234_008279_32_202 56
176 3300049758 Ga0501241_011281 Ga0501241_011281_539_709 56
177 3300049759 Ga0501262_011536 Ga0501262_011536_387_557 56
178 3300049761 Ga0501264_039524 Ga0501264_039524_147_317 56
179 3300049762 Ga0501265_011645 Ga0501265_011645_341_511 56
180 3300049769 Ga0501272_070886 Ga0501272_070886_165_335 56
181 3300049775 Ga0501279_003319 Ga0501279_003319_84_254 56
182 3300050507 nmdc:mga05p37_415548_c1 nmdc:mga05p37_415548_c1_1138_1308 56
183 3300050508 nmdc:mga09592_486073_c1 nmdc:mga09592_486073_c1_391_561 56
184 3300050511 nmdc:mga08y16_821378_c1 nmdc:mga08y16_821378_c1_739_909 56
185 3300005330 Ga0070690_100313983 Ga0070690_1003139831 57
186 3300005347 Ga0070668_100790480 Ga0070668_1007904802 57
187 3300005539 Ga0068853_100226522 Ga0068853_1002265222 57
188 3300005546 Ga0070696_101282953 Ga0070696_1012829531 57
189 3300005842 Ga0068858_100124924 Ga0068858_1001249242 57
190 3300005843 Ga0068860_100632901 Ga0068860_1006329012 57
191 3300006846 Ga0075430_101181334 Ga0075430_1011813342 57
192 3300009147 Ga0114129_11136469 Ga0114129_111364691 57
193 3300009177 Ga0105248_10702193 Ga0105248_107021932 57
194 3300013306 Ga0163162_11050670 Ga0163162_110506702 57
195 3300014325 Ga0163163_10016445 Ga0163163_100164452 57
196 3300014968 Ga0157379_10384692 Ga0157379_103846922 57
197 3300025904 Ga0207647_10056875 Ga0207647_100568751 57
198 3300025941 Ga0207711_10271464 Ga0207711_102714642 57
199 3300025942 Ga0207689_10340283 Ga0207689_103402832 57
200 3300026035 Ga0207703_10103264 Ga0207703_101032642 57
201 3300026041 Ga0207639_10569414 Ga0207639_105694143 57
202 3300028381 Ga0268264_11558213 Ga0268264_115582132 57
203 3300031901 Ga0307406_11414721 Ga0307406_114147212 57
204 3300032002 Ga0307416_101340556 Ga0307416_1013405562 57
205 3300032004 Ga0307414_11417698 Ga0307414_114176982 57
206 3300032005 Ga0307411_10694086 Ga0307411_106940862 57
207 3300041410 Ga0439461_0073619 Ga0439461_0073619_49_222 57
208 3300042156 Ga0439446_0112318 Ga0439446_0112318_147_320 57
209 3300049516 Ga0501293_014287 Ga0501293_014287_516_689 57
210 3300049522 Ga0501299_046893 Ga0501299_046893_643_816 57
211 3300049652 Ga0501202_134574 Ga0501202_134574_154_327 57
212 3300049661 Ga0501217_024627 Ga0501217_024627_787_960 57
213 3300049663 Ga0501223_031304 Ga0501223_031304_112_285 57
214 3300049665 Ga0501227_052122 Ga0501227_052122_579_752 57
215 3300049668 Ga0501233_042224 Ga0501233_042224_753_926 57
216 3300049705 Ga0501225_0301086 Ga0501225_0301086_172_345 57
217 3300049708 Ga0501245_024120 Ga0501245_024120_776_949 57
218 3300049765 Ga0501268_020286 Ga0501268_020286_731_904 57
219 3300049770 Ga0501273_015492 Ga0501273_015492_336_509 57
220 3300049851 Ga0501212_029879 Ga0501212_029879_549_722 57
221 3300050510 nmdc:mga06r32_1712384_c1 nmdc:mga06r32_1712384_c1_85_258 57
222 2088090001 CNB_F6ESG4R02I7Z3E CNB_02087850 58
223 3300000531 CNBas_1005257 CNBas_10052572 58
224 3300005288 Ga0065714_10019362 Ga0065714_100193622 58
225 3300005289 Ga0065704_10611339 Ga0065704_106113391 58
226 3300005290 Ga0065712_10000114 Ga0065712_100001147 58
227 3300005290 Ga0065712_10152222 Ga0065712_101522222 58
228 3300005290 Ga0065712_10198895 Ga0065712_101988952 58
229 3300005293 Ga0065715_10089469 Ga0065715_100894694 58
230 3300005293 Ga0065715_10118509 Ga0065715_101185092 58
231 3300005293 Ga0065715_10259159 Ga0065715_102591592 58
232 3300005293 Ga0065715_10622624 Ga0065715_106226241 58
233 3300005295 Ga0065707_10289847 Ga0065707_102898472 58
234 3300005331 Ga0070670_100121124 Ga0070670_1001211242 58
235 3300005331 Ga0070670_100643436 Ga0070670_1006434362 58
236 3300005331 Ga0070670_100968846 Ga0070670_1009688462 58
237 3300005335 Ga0070666_10721202 Ga0070666_107212022 58
238 3300005336 Ga0070680_102010311 Ga0070680_1020103112 58
239 3300005338 Ga0068868_101922104 Ga0068868_1019221042 58
240 3300005340 Ga0070689_101917092 Ga0070689_1019170922 58
241 3300005343 Ga0070687_100063881 Ga0070687_1000638812 58
242 3300005343 Ga0070687_100655311 Ga0070687_1006553111 58
243 3300005345 Ga0070692_10065809 Ga0070692_100658093 58
244 3300005345 Ga0070692_10428565 Ga0070692_104285652 58
245 3300005353 Ga0070669_100059021 Ga0070669_1000590214 58
246 3300005354 Ga0070675_101665019 Ga0070675_1016650192 58
247 3300005364 Ga0070673_100225598 Ga0070673_1002255982 58
248 3300005364 Ga0070673_100404858 Ga0070673_1004048582 58
249 3300005364 Ga0070673_100634505 Ga0070673_1006345052 58
250 3300005364 Ga0070673_101939482 Ga0070673_1019394822 58
251 3300005365 Ga0070688_101429731 Ga0070688_1014297312 58
252 3300005440 Ga0070705_100025772 Ga0070705_1000257723 58
253 3300005440 Ga0070705_100218135 Ga0070705_1002181352 58
254 3300005440 Ga0070705_100690184 Ga0070705_1006901841 58
255 3300005440 Ga0070705_100816595 Ga0070705_1008165952 58
256 3300005441 Ga0070700_100324270 Ga0070700_1003242702 58
257 3300005441 Ga0070700_101046135 Ga0070700_1010461351 58
258 3300005444 Ga0070694_100016973 Ga0070694_1000169734 58
259 3300005444 Ga0070694_100115943 Ga0070694_1001159432 58
260 3300005444 Ga0070694_100253267 Ga0070694_1002532672 58
261 3300005444 Ga0070694_100665773 Ga0070694_1006657732 58
262 3300005458 Ga0070681_10001543 Ga0070681_100015435 58
263 3300005459 Ga0068867_100222575 Ga0068867_1002225752 58
264 3300005459 Ga0068867_101480139 Ga0068867_1014801392 58
265 3300005466 Ga0070685_10176365 Ga0070685_101763652 58
266 3300005466 Ga0070685_10492036 Ga0070685_104920362 58
267 3300005471 Ga0070698_100032273 Ga0070698_1000322732 58
268 3300005518 Ga0070699_100012727 Ga0070699_1000127274 58
269 3300005536 Ga0070697_101518221 Ga0070697_1015182211 58
270 3300005539 Ga0068853_100908588 Ga0068853_1009085882 58
271 3300005539 Ga0068853_101794568 Ga0068853_1017945681 58
272 3300005545 Ga0070695_100057571 Ga0070695_1000575713 58
273 3300005545 Ga0070695_100190572 Ga0070695_1001905722 58
274 3300005545 Ga0070695_100350479 Ga0070695_1003504792 58
275 3300005545 Ga0070695_100597438 Ga0070695_1005974382 58
276 3300005545 Ga0070695_101663833 Ga0070695_1016638331 58
277 3300005546 Ga0070696_100034083 Ga0070696_1000340834 58
278 3300005546 Ga0070696_100201385 Ga0070696_1002013853 58
279 3300005546 Ga0070696_100892943 Ga0070696_1008929431 58
280 3300005547 Ga0070693_100027514 Ga0070693_1000275143 58
281 3300005547 Ga0070693_100054346 Ga0070693_1000543461 58
282 3300005547 Ga0070693_100105942 Ga0070693_1001059423 58
283 3300005549 Ga0070704_100172989 Ga0070704_1001729892 58
284 3300005549 Ga0070704_100298859 Ga0070704_1002988591 58
285 3300005549 Ga0070704_101331521 Ga0070704_1013315212 58
286 3300005564 Ga0070664_100516102 Ga0070664_1005161022 58
287 3300005577 Ga0068857_100434855 Ga0068857_1004348552 58
288 3300005578 Ga0068854_100550455 Ga0068854_1005504551 58
289 3300005578 Ga0068854_100864088 Ga0068854_1008640882 58
290 3300005578 Ga0068854_101405615 Ga0068854_1014056152 58
291 3300005614 Ga0068856_100179967 Ga0068856_1001799672 58
292 3300005614 Ga0068856_101070322 Ga0068856_1010703222 58
293 3300005615 Ga0070702_100279726 Ga0070702_1002797261 58
294 3300005617 Ga0068859_100167043 Ga0068859_1001670432 58
295 3300005617 Ga0068859_100182093 Ga0068859_1001820932 58
296 3300005617 Ga0068859_100584362 Ga0068859_1005843622 58
297 3300005617 Ga0068859_103007311 Ga0068859_1030073112 58
298 3300005618 Ga0068864_100259377 Ga0068864_1002593772 58
299 3300005618 Ga0068864_100394309 Ga0068864_1003943092 58
300 3300005618 Ga0068864_100604316 Ga0068864_1006043162 58
301 3300005618 Ga0068864_100947671 Ga0068864_1009476711 58
302 3300005618 Ga0068864_102127057 Ga0068864_1021270572 58
303 3300005719 Ga0068861_100008175 Ga0068861_1000081756 58
304 3300005719 Ga0068861_101765330 Ga0068861_1017653302 58
305 3300005840 Ga0068870_10140525 Ga0068870_101405252 58
306 3300005840 Ga0068870_10153139 Ga0068870_101531392 58
307 3300005840 Ga0068870_11151300 Ga0068870_111513001 58
308 3300005841 Ga0068863_100153135 Ga0068863_1001531354 58
309 3300005841 Ga0068863_100980285 Ga0068863_1009802851 58
310 3300005842 Ga0068858_100454617 Ga0068858_1004546172 58
311 3300005842 Ga0068858_101476752 Ga0068858_1014767522 58
312 3300005843 Ga0068860_101447030 Ga0068860_1014470302 58
313 3300005843 Ga0068860_102746494 Ga0068860_1027464942 58
314 3300005844 Ga0068862_100347665 Ga0068862_1003476652 58
315 3300005844 Ga0068862_100399859 Ga0068862_1003998592 58
316 3300005844 Ga0068862_100925003 Ga0068862_1009250032 58
317 3300006173 Ga0070716_100306972 Ga0070716_1003069722 58
318 3300006173 Ga0070716_101106888 Ga0070716_1011068881 58
319 3300006173 Ga0070716_101480422 Ga0070716_1014804222 58
320 3300006358 Ga0068871_100833600 Ga0068871_1008336002 58
321 3300006358 Ga0068871_101509251 Ga0068871_1015092512 58
322 3300006844 Ga0075428_101584707 Ga0075428_1015847072 58
323 3300006846 Ga0075430_100035553 Ga0075430_1000355534 58
324 3300006847 Ga0075431_100740134 Ga0075431_1007401342 58
325 3300006847 Ga0075431_100766317 Ga0075431_1007663172 58
326 3300006847 Ga0075431_101024871 Ga0075431_1010248712 58
327 3300006852 Ga0075433_10217519 Ga0075433_102175192 58
328 3300006852 Ga0075433_10481840 Ga0075433_104818402 58
329 3300006852 Ga0075433_10616567 Ga0075433_106165671 58
330 3300006871 Ga0075434_100323148 Ga0075434_1003231482 58
331 3300006880 Ga0075429_100454266 Ga0075429_1004542662 58
332 3300006881 Ga0068865_100768115 Ga0068865_1007681152 58
333 3300006931 Ga0097620_100167037 Ga0097620_1001670372 58
334 3300006931 Ga0097620_100182083 Ga0097620_1001820833 58
335 3300006931 Ga0097620_100584371 Ga0097620_1005843712 58
336 3300006931 Ga0097620_103008585 Ga0097620_1030085852 58
337 3300009093 Ga0105240_10690583 Ga0105240_106905832 58
338 3300009093 Ga0105240_10710607 Ga0105240_107106072 58
339 3300009094 Ga0111539_10275990 Ga0111539_102759902 58
340 3300009094 Ga0111539_11504350 Ga0111539_115043501 58
341 3300009094 Ga0111539_12028718 Ga0111539_120287181 58
342 3300009098 Ga0105245_11195952 Ga0105245_111959522 58
343 3300009098 Ga0105245_12184723 Ga0105245_121847232 58
344 3300009098 Ga0105245_12881005 Ga0105245_128810051 58
345 3300009101 Ga0105247_10154849 Ga0105247_101548492 58
346 3300009101 Ga0105247_10652047 Ga0105247_106520472 58
347 3300009101 Ga0105247_10880810 Ga0105247_108808101 58
348 3300009147 Ga0114129_10146321 Ga0114129_101463212 58
349 3300009147 Ga0114129_10822841 Ga0114129_108228412 58
350 3300009147 Ga0114129_11089821 Ga0114129_110898212 58
351 3300009147 Ga0114129_11111848 Ga0114129_111118482 58
352 3300009148 Ga0105243_11014017 Ga0105243_110140171 58
353 3300009148 Ga0105243_11054669 Ga0105243_110546691 58
354 3300009174 Ga0105241_10280874 Ga0105241_102808742 58
355 3300009174 Ga0105241_10335875 Ga0105241_103358752 58
356 3300009174 Ga0105241_10734280 Ga0105241_107342802 58
357 3300009174 Ga0105241_10858994 Ga0105241_108589942 58
358 3300009174 Ga0105241_11263036 Ga0105241_112630362 58
359 3300009174 Ga0105241_11364264 Ga0105241_113642642 58
360 3300009176 Ga0105242_12157744 Ga0105242_121577442 58
361 3300009176 Ga0105242_12543649 Ga0105242_125436492 58
362 3300009177 Ga0105248_10008530 Ga0105248_100085309 58
363 3300009177 Ga0105248_10159931 Ga0105248_101599314 58
364 3300009177 Ga0105248_10301654 Ga0105248_103016542 58
365 3300009545 Ga0105237_10030313 Ga0105237_100303134 58
366 3300009551 Ga0105238_10437047 Ga0105238_104370471 58
367 3300009551 Ga0105238_12124593 Ga0105238_121245931 58
368 3300010375 Ga0105239_10612946 Ga0105239_106129462 58
369 3300010375 Ga0105239_10623476 Ga0105239_106234762 58
370 3300010375 Ga0105239_11686540 Ga0105239_116865402 58
371 3300010375 Ga0105239_12229668 Ga0105239_122296682 58
372 3300011119 Ga0105246_10163564 Ga0105246_101635642 58
373 3300011119 Ga0105246_11299053 Ga0105246_112990531 58
374 3300013100 Ga0157373_10029813 Ga0157373_100298132 58
375 3300013100 Ga0157373_10044781 Ga0157373_100447812 58
376 3300013102 Ga0157371_10695314 Ga0157371_106953142 58
377 3300013297 Ga0157378_10667826 Ga0157378_106678261 58
378 3300013306 Ga0163162_10018622 Ga0163162_100186224 58
379 3300013307 Ga0157372_11236077 Ga0157372_112360772 58
380 3300013308 Ga0157375_10484170 Ga0157375_104841702 58
381 3300013308 Ga0157375_10603639 Ga0157375_106036392 58
382 3300013308 Ga0157375_12886535 Ga0157375_128865352 58
383 3300014325 Ga0163163_10157832 Ga0163163_101578323 58
384 3300014326 Ga0157380_10612887 Ga0157380_106128872 58
385 3300014745 Ga0157377_10251233 Ga0157377_102512331 58
386 3300014745 Ga0157377_10314422 Ga0157377_103144222 58
387 3300014745 Ga0157377_11383214 Ga0157377_113832142 58
388 3300014968 Ga0157379_10076207 Ga0157379_100762074 58
389 3300014968 Ga0157379_10306308 Ga0157379_103063082 58
390 3300025898 Ga0207692_10901482 Ga0207692_109014822 58
391 3300025900 Ga0207710_10180742 Ga0207710_101807421 58
392 3300025908 Ga0207643_10040024 Ga0207643_100400242 58
393 3300025910 Ga0207684_10000030 Ga0207684_10000030201 58
394 3300025910 Ga0207684_10927249 Ga0207684_109272492 58
395 3300025912 Ga0207707_10003076 Ga0207707_100030769 58
396 3300025913 Ga0207695_11061719 Ga0207695_110617192 58
397 3300025914 Ga0207671_10644414 Ga0207671_106444142 58
398 3300025917 Ga0207660_11442719 Ga0207660_114427191 58
399 3300025918 Ga0207662_10022673 Ga0207662_100226733 58
400 3300025922 Ga0207646_10710395 Ga0207646_107103952 58
401 3300025923 Ga0207681_10120012 Ga0207681_101200122 58
402 3300025924 Ga0207694_11431536 Ga0207694_114315361 58
403 3300025925 Ga0207650_10337102 Ga0207650_103371022 58
404 3300025925 Ga0207650_10965012 Ga0207650_109650122 58
405 3300025925 Ga0207650_11033474 Ga0207650_110334742 58
406 3300025926 Ga0207659_11342487 Ga0207659_113424872 58
407 3300025939 Ga0207665_10144716 Ga0207665_101447162 58
408 3300025939 Ga0207665_10353281 Ga0207665_103532812 58
409 3300025941 Ga0207711_10068996 Ga0207711_100689963 58
410 3300025941 Ga0207711_10115313 Ga0207711_101153134 58
411 3300025941 Ga0207711_10422193 Ga0207711_104221932 58
412 3300025942 Ga0207689_10062769 Ga0207689_100627693 58
413 3300025942 Ga0207689_10307345 Ga0207689_103073452 58
414 3300025942 Ga0207689_10431575 Ga0207689_104315751 58
415 3300025960 Ga0207651_10223792 Ga0207651_102237921 58
416 3300025960 Ga0207651_10262832 Ga0207651_102628323 58
417 3300025981 Ga0207640_12158784 Ga0207640_121587841 58
418 3300026023 Ga0207677_11360636 Ga0207677_113606362 58
419 3300026035 Ga0207703_10594685 Ga0207703_105946852 58
420 3300026035 Ga0207703_11188561 Ga0207703_111885612 58
421 3300026041 Ga0207639_10853693 Ga0207639_108536932 58
422 3300026041 Ga0207639_11067230 Ga0207639_110672302 58
423 3300026075 Ga0207708_10000224 Ga0207708_1000022412 58
424 3300026075 Ga0207708_10238015 Ga0207708_102380152 58
425 3300026078 Ga0207702_10276040 Ga0207702_102760402 58
426 3300026089 Ga0207648_10796386 Ga0207648_107963862 58
427 3300026095 Ga0207676_10416811 Ga0207676_104168112 58
428 3300026095 Ga0207676_11268269 Ga0207676_112682692 58
429 3300026116 Ga0207674_10436731 Ga0207674_104367312 58
430 3300026118 Ga0207675_100013986 Ga0207675_1000139863 58
431 3300027907 Ga0207428_10688010 Ga0207428_106880102 58
432 3300027907 Ga0207428_11048585 Ga0207428_110485851 58
433 3300028380 Ga0268265_10319454 Ga0268265_103194542 58
434 3300028380 Ga0268265_12627125 Ga0268265_126271251 58
435 3300028381 Ga0268264_10703060 Ga0268264_107030602 58
436 3300028381 Ga0268264_10712067 Ga0268264_107120671 58
437 3300031889 Ga0326468_10108654 Ga0326468_101086541 58
438 3300034816 Ga0373930_0055817 Ga0373930_0055817_616_792 58
439 3300035088 Ga0373940_0066237 Ga0373940_0066237_206_382 58
440 3300035091 Ga0373951_0000629 Ga0373951_0000629_3004_3180 58
441 3300035091 Ga0373951_0083066 Ga0373951_0083066_347_523 58
442 3300035092 Ga0373952_0199476 Ga0373952_0199476_278_454 58
443 3300035112 Ga0373932_0131839 Ga0373932_0131839_323_499 58
444 3300035112 Ga0373932_0293252 Ga0373932_0293252_55_231 58
445 3300035114 Ga0373939_0203795 Ga0373939_0203795_248_424 58
446 3300035115 Ga0373941_0194783 Ga0373941_0194783_354_530 58
447 3300035121 Ga0373960_0282684 Ga0373960_0282684_393_569 58
448 3300035207 Ga0373942_0141572 Ga0373942_0141572_193_369 58
449 3300035241 Ga0373961_0091184 Ga0373961_0091184_567_743 58
450 3300035691 Ga0373931_0972175 Ga0373931_0972175_349_525 58
451 3300037418 Ga0395900_0394783 Ga0395900_0394783_737_913 58
452 3300037466 Ga0395898_1263412 Ga0395898_1263412_157_333 58
453 3300042142 Ga0450905_068293 Ga0450905_068293_336_512 58
454 3300044673 Ga0453683_0490395 Ga0453683_0490395_60_236 58
455 3300045051 Ga0451576_0123846 Ga0451576_0123846_2190_2366 58
456 3300045051 Ga0451576_0687285 Ga0451576_0687285_250_426 58
457 3300045051 Ga0451576_0822889 Ga0451576_0822889_349_525 58
458 3300048915 Ga0496112_0042721 Ga0496112_0042721_1280_1456 58
459 3300048915 Ga0496112_0301807 Ga0496112_0301807_653_829 58
460 3300048915 Ga0496112_0955646 Ga0496112_0955646_268_444 58
461 3300048916 Ga0496113_0095663 Ga0496113_0095663_2044_2220 58
462 3300050507 nmdc:mga05p37_1177488_c1 nmdc:mga05p37_1177488_c1_81_257 58
463 3300050507 nmdc:mga05p37_1186285_c1 nmdc:mga05p37_1186285_c1_47_223 58
464 3300050509 nmdc:mga0qj67_32261_c1 nmdc:mga0qj67_32261_c1_2986_3177 58
465 3300050510 nmdc:mga06r32_750302_c1 nmdc:mga06r32_750302_c1_399_575 58
466 3300050510 nmdc:mga06r32_812820_c1 nmdc:mga06r32_812820_c1_602_793 58
467 3300050511 nmdc:mga08y16_2018616_c1 nmdc:mga08y16_2018616_c1_53_229 58
468 3300050511 nmdc:mga08y16_250114_c1 nmdc:mga08y16_250114_c1_633_809 58
469 3300050511 nmdc:mga08y16_651576_c1 nmdc:mga08y16_651576_c1_398_574 58
470 3300050512 nmdc:mga0n895_894556_c1 nmdc:mga0n895_894556_c1_505_681 58
471 3300050515 nmdc:mga0a205_107036_c1 nmdc:mga0a205_107036_c1_231_407 58
472 3300050515 nmdc:mga0a205_344445_c1 nmdc:mga0a205_344445_c1_599_775 58

Feature Viewer

pLDDT pTM Quality
64.82 0.2 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map