F450736

General Info

Members Datasets Scaffolds Average Seq Length
472 245 944 95

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100005697|Ga0070671_1000056979
Length 99
Sequence VIVRLLGEGQFRVDDSLLAQLNELDDKVEQAVEAGDERALWDALQALADVVRANGEKLADEDLAPSDAVIPPEDLSLEEARELLQDEGFIPDVPAEQTS

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
116 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.65
Rhizosphere 87.71
Stem 0
Stem Tuber 0
Unclassified 6.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100005697 3300005355 Bacteria 9923
2 JGI25406J46586_10029581 3300003203 Bacteria 2070
3 Ga0070658_10180978 3300005327 Bacteria 1774
4 Ga0070658_11646777 3300005327 Bacteria 556
5 Ga0070676_11169971 3300005328 Bacteria 583
6 Ga0070683_100463964 3300005329 Bacteria 1209
7 Ga0070683_100937114 3300005329 Bacteria 831
8 Ga0070670_101236092 3300005331 Bacteria 683
9 Ga0070680_100114807 3300005336 Bacteria 2243
10 Ga0070682_100437887 3300005337 Unclassified 998
11 Ga0070660_100022868 3300005339 Bacteria 4628
12 Ga0070660_100199176 3300005339 Bacteria 1624
13 Ga0070659_101196312 3300005366 Unclassified 672
14 Ga0070667_100578088 3300005367 Bacteria 1034
15 Ga0070709_10000730 3300005434 Bacteria 18584
16 Ga0070709_10666617 3300005434 Bacteria 807
17 Ga0070714_100001418 3300005435 Bacteria 17401
18 Ga0070714_100440466 3300005435 Bacteria 1236
19 Ga0070714_100483018 3300005435 Bacteria 1180
20 Ga0070714_101723650 3300005435 Bacteria 612
21 Ga0070714_102473752 3300005435 Bacteria 504
22 Ga0070713_100001109 3300005436 Bacteria 17148
23 Ga0070713_100167720 3300005436 Bacteria 1964
24 Ga0070713_100205402 3300005436 Bacteria 1781
25 Ga0070713_100369121 3300005436 Bacteria 1335
26 Ga0070713_101084394 3300005436 Bacteria 774
27 Ga0070713_101673775 3300005436 Bacteria 618
28 Ga0070710_10000747 3300005437 Bacteria 15479
29 Ga0070710_10811815 3300005437 Bacteria 669
30 Ga0070701_10486871 3300005438 Unclassified 798
31 Ga0070711_100000258 3300005439 Bacteria 27048
32 Ga0070711_100174575 3300005439 Bacteria 1641
33 Ga0070711_100704832 3300005439 Unclassified 850
34 Ga0070711_101900851 3300005439 Bacteria 523
35 Ga0070700_101102196 3300005441 Unclassified 658
36 Ga0070663_101493003 3300005455 Unclassified 601
37 Ga0070678_100541781 3300005456 Bacteria 1032
38 Ga0070678_101048033 3300005456 Bacteria 751
39 Ga0070662_101472740 3300005457 Unclassified 587
40 Ga0070681_10031343 3300005458 Bacteria 5337
41 Ga0070681_10079880 3300005458 Bacteria 3227
42 Ga0070681_11202211 3300005458 Bacteria 680
43 Ga0070681_11380124 3300005458 Bacteria 628
44 Ga0068867_100692594 3300005459 Unclassified 898
45 Ga0070685_10547914 3300005466 Unclassified 825
46 Ga0070706_100051618 3300005467 Bacteria 3796
47 Ga0070707_100103969 3300005468 Bacteria 2753
48 Ga0070698_100000873 3300005471 Bacteria 33116
49 Ga0070698_100329917 3300005471 Bacteria 1457
50 Ga0070679_100072182 3300005530 Bacteria 3443
51 Ga0070679_100217831 3300005530 Bacteria 1871
52 Ga0070679_100590543 3300005530 Bacteria 1054
53 Ga0070679_102075046 3300005530 Bacteria 518
54 Ga0070684_100219417 3300005535 Bacteria 1735
55 Ga0070684_101251991 3300005535 Bacteria 698
56 Ga0070684_101317161 3300005535 Bacteria 680
57 Ga0070684_102222082 3300005535 Bacteria 518
58 Ga0070693_100774490 3300005547 Bacteria 709
59 Ga0070665_100000608 3300005548 Bacteria 49343
60 Ga0068855_100353094 3300005563 Bacteria 1619
61 Ga0068855_100585479 3300005563 Bacteria 1205
62 Ga0068855_101422932 3300005563 Bacteria 714
63 Ga0070664_100632631 3300005564 Bacteria 994
64 Ga0068856_100244209 3300005614 Bacteria 1811
65 Ga0068856_100449017 3300005614 Bacteria 1310
66 Ga0068852_100428546 3300005616 Bacteria 1306
67 Ga0068852_101904177 3300005616 Unclassified 617
68 Ga0068851_10313719 3300005834 Bacteria 904
69 Ga0068862_102578889 3300005844 Unclassified 520
70 Ga0081538_10147722 3300005981 Bacteria 1071
71 Ga0081539_10000961 3300005985 Bacteria 53971
72 Ga0081539_10006728 3300005985 Bacteria 10821
73 Ga0081539_10143820 3300005985 Bacteria 1156
74 Ga0070717_10005146 3300006028 Bacteria 9534
75 Ga0070717_10088229 3300006028 Bacteria 2614
76 Ga0070717_10175102 3300006028 Bacteria 1867
77 Ga0070717_10884990 3300006028 Bacteria 813
78 Ga0070715_10070412 3300006163 Bacteria 1561
79 Ga0070716_100000222 3300006173 Bacteria 22754
80 Ga0070716_100154511 3300006173 Bacteria 1480
81 Ga0070712_100002878 3300006175 Bacteria 10665
82 Ga0070712_100013496 3300006175 Bacteria 5223
83 Ga0075428_100001903 3300006844 Bacteria 22395
84 Ga0075428_100262649 3300006844 Bacteria 1859
85 Ga0075431_100467046 3300006847 Bacteria 1256
86 Ga0075433_10230682 3300006852 Bacteria 1644
87 Ga0075434_100041755 3300006871 Bacteria 4544
88 Ga0075429_100216610 3300006880 Bacteria 1678
89 Ga0075429_100751269 3300006880 Unclassified 854
90 Ga0068865_100420137 3300006881 Bacteria 1099
91 Ga0075436_100471495 3300006914 Bacteria 916
92 Ga0075435_100000425 3300007076 Bacteria 25950
93 Ga0099795_10376285 3300007788 Bacteria 640
94 Ga0111539_10557257 3300009094 Bacteria 1335
95 Ga0111539_11000075 3300009094 Bacteria 972
96 Ga0105245_10441035 3300009098 Bacteria 1309
97 Ga0105245_10758016 3300009098 Bacteria 1007
98 Ga0105245_10918955 3300009098 Bacteria 917
99 Ga0105245_11380286 3300009098 Unclassified 754
100 Ga0114129_10070076 3300009147 Bacteria 4888
101 Ga0114129_10097559 3300009147 Bacteria 4069
102 Ga0114129_11390263 3300009147 Bacteria 866
103 Ga0105243_10126212 3300009148 Bacteria 2165
104 Ga0105243_10531138 3300009148 Bacteria 1120
105 Ga0105243_12796452 3300009148 Bacteria 528
106 Ga0105241_10194468 3300009174 Bacteria 1690
107 Ga0105242_10468329 3300009176 Bacteria 1191
108 Ga0105248_12980456 3300009177 Bacteria 539
109 Ga0105238_10668807 3300009551 Bacteria 1049
110 Ga0105238_12120982 3300009551 Bacteria 596
111 Ga0105239_11106905 3300010375 Bacteria 912
112 Ga0157369_10126524 3300013105 Bacteria 2709
113 Ga0157374_10179457 3300013296 Bacteria 2068
114 Ga0157374_12662375 3300013296 Bacteria 528
115 Ga0157378_10061002 3300013297 Bacteria 3365
116 Ga0157378_11320162 3300013297 Bacteria 763
117 Ga0157372_10648994 3300013307 Bacteria 1229
118 Ga0157375_11888149 3300013308 Bacteria 709
119 Ga0157376_10068360 3300014969 Bacteria 3008
120 Ga0157376_10600843 3300014969 Bacteria 1095
121 Ga0163161_12028023 3300017792 Bacteria 512
122 Ga0184600_133144 3300019190 Bacteria 544
123 Ga0197907_10440768 3300020069 Bacteria 511
124 Ga0206356_11773008 3300020070 Bacteria 1184
125 Ga0206351_10847156 3300020077 Bacteria 765
126 Ga0207653_10078998 3300025885 Bacteria 1136
127 Ga0207692_10001938 3300025898 Bacteria 7885
128 Ga0207692_10149362 3300025898 Bacteria 1337
129 Ga0207692_11183875 3300025898 Bacteria 507
130 Ga0207688_10657331 3300025901 Bacteria 662
131 Ga0207685_10076661 3300025905 Bacteria 1371
132 Ga0207699_10000105 3300025906 Bacteria 59026
133 Ga0207699_10340197 3300025906 Bacteria 1057
134 Ga0207705_10025832 3300025909 Bacteria 4191
135 Ga0207705_10750773 3300025909 Bacteria 758
136 Ga0207684_10042959 3300025910 Bacteria 3832
137 Ga0207654_10294671 3300025911 Bacteria 1101
138 Ga0207707_10100108 3300025912 Bacteria 2533
139 Ga0207707_10261615 3300025912 Bacteria 1501
140 Ga0207693_10001586 3300025915 Bacteria 20116
141 Ga0207693_10035715 3300025915 Bacteria 3918
142 Ga0207693_11295401 3300025915 Unclassified 545
143 Ga0207663_10079301 3300025916 Bacteria 2143
144 Ga0207663_10092401 3300025916 Bacteria 2011
145 Ga0207660_10402024 3300025917 Bacteria 1103
146 Ga0207657_10012680 3300025919 Bacteria 8307
147 Ga0207657_10232657 3300025919 Bacteria 1473
148 Ga0207649_11111875 3300025920 Bacteria 623
149 Ga0207652_10400670 3300025921 Bacteria 1238
150 Ga0207652_10786959 3300025921 Bacteria 845
151 Ga0207652_11507562 3300025921 Bacteria 576
152 Ga0207694_11500692 3300025924 Bacteria 569
153 Ga0207687_10170782 3300025927 Bacteria 1677
154 Ga0207700_10000050 3300025928 Bacteria 79672
155 Ga0207700_10438584 3300025928 Bacteria 1149
156 Ga0207700_10724827 3300025928 Bacteria 888
157 Ga0207700_11043175 3300025928 Bacteria 731
158 Ga0207700_11217886 3300025928 Bacteria 672
159 Ga0207700_11262450 3300025928 Unclassified 659
160 Ga0207664_10000101 3300025929 Bacteria 79541
161 Ga0207664_10642444 3300025929 Bacteria 954
162 Ga0207664_11645495 3300025929 Bacteria 564
163 Ga0207644_10168604 3300025931 Bacteria 1707
164 Ga0207706_11328362 3300025933 Unclassified 593
165 Ga0207686_10097123 3300025934 Bacteria 1959
166 Ga0207686_11272620 3300025934 Bacteria 603
167 Ga0207709_10077593 3300025935 Bacteria 2130
168 Ga0207709_10616193 3300025935 Bacteria 861
169 Ga0207709_11753852 3300025935 Bacteria 516
170 Ga0207704_10102896 3300025938 Bacteria 1909
171 Ga0207665_10000438 3300025939 Bacteria 28608
172 Ga0207665_10539680 3300025939 Bacteria 905
173 Ga0207691_11200936 3300025940 Unclassified 629
174 Ga0207711_11724826 3300025941 Bacteria 570
175 Ga0207661_10648565 3300025944 Bacteria 970
176 Ga0207679_10144955 3300025945 Bacteria 1925
177 Ga0207667_10086728 3300025949 Bacteria 3239
178 Ga0207667_10771672 3300025949 Bacteria 960
179 Ga0207651_10571969 3300025960 Bacteria 985
180 Ga0207668_10114664 3300025972 Bacteria 2029
181 Ga0207658_10429215 3300025986 Bacteria 1167
182 Ga0207678_10609107 3300026067 Bacteria 958
183 Ga0207702_10759370 3300026078 Bacteria 957
184 Ga0207702_10822725 3300026078 Bacteria 919
185 Ga0207683_10153996 3300026121 Bacteria 2076
186 Ga0268266_10033405 3300028379 Bacteria 4373
187 Ga0268265_11164190 3300028380 Bacteria 768
188 Ga0268265_11491406 3300028380 Unclassified 680
189 Ga0265334_10019241 3300028573 Bacteria 2812
190 Ga0265334_10182283 3300028573 Bacteria 733
191 Ga0265318_10014058 3300028577 Bacteria 3364
192 Ga0265318_10225131 3300028577 Bacteria 685
193 Ga0265322_10014015 3300028654 Bacteria 2319
194 Ga0265322_10030831 3300028654 Bacteria 1531
195 Ga0265338_10002043 3300028800 Bacteria 31202
196 Ga0265338_10034411 3300028800 Bacteria 4897
197 Ga0265324_10062155 3300029957 Bacteria 1276
198 Ga0265760_10059962 3300031090 Bacteria 1155
199 Ga0265330_10030902 3300031235 Bacteria 2402
200 Ga0265330_10387678 3300031235 Bacteria 591
201 Ga0265320_10205646 3300031240 Bacteria 878
202 Ga0265325_10030682 3300031241 Bacteria 2881
203 Ga0265340_10016490 3300031247 Bacteria 3824
204 Ga0265340_10039653 3300031247 Bacteria 2322
205 Ga0265340_10545691 3300031247 Bacteria 510
206 Ga0265331_10011550 3300031250 Bacteria 4832
207 Ga0265327_10016971 3300031251 Bacteria 4591
208 Ga0265327_10139826 3300031251 Bacteria 1132
209 Ga0265316_10059913 3300031344 Bacteria 2959
210 Ga0265316_10483046 3300031344 Bacteria 886
211 Ga0265316_10627663 3300031344 Bacteria 761
212 Ga0265313_10017031 3300031595 Bacteria 4151
213 Ga0265313_10051922 3300031595 Bacteria 1959
214 Ga0265313_10223632 3300031595 Bacteria 775
215 Ga0265314_10018779 3300031711 Bacteria 5374
216 Ga0265342_10029732 3300031712 Bacteria 3390
217 Ga0307406_11436290 3300031901 Bacteria 606
218 Ga0307409_102095276 3300031995 Unclassified 595
219 Ga0307416_100690921 3300032002 Bacteria 1109
220 Ga0373936_0046206 3300035113 Bacteria 1755
221 Ga0373936_0349294 3300035113 Bacteria 673
222 Ga0373945_0013965 3300035116 Bacteria 2686
223 Ga0373953_0348791 3300035117 Bacteria 648
224 Ga0373956_0315847 3300035119 Bacteria 744
225 Ga0373943_0911798 3300035170 Unclassified 525
226 Ga0373955_0008672 3300035172 Bacteria 4732
227 Ga0373955_0478523 3300035172 Bacteria 760
228 Ga0373924_0065394 3300035410 Bacteria 1527
229 Ga0373933_0081849 3300035724 Bacteria 1981
230 Ga0373947_0372102 3300035725 Bacteria 961
231 Ga0373947_0999971 3300035725 Unclassified 570
232 Ga0373937_0078184 3300036401 Bacteria 3057
233 Ga0373925_0066890 3300037068 Bacteria 2709
234 Ga0395899_0015774 3300037312 Bacteria 5761
235 Ga0395899_0029763 3300037312 Bacteria 4108
236 Ga0395899_0112774 3300037312 Bacteria 1953
237 Ga0395899_0192020 3300037312 Bacteria 1429
238 Ga0395899_0466728 3300037312 Unclassified 824
239 Ga0395900_0009649 3300037418 Bacteria 9900
240 Ga0395900_0062327 3300037418 Bacteria 3833
241 Ga0395900_0405337 3300037418 Bacteria 1327
242 Ga0395900_0458158 3300037418 Bacteria 1230
243 Ga0395900_1877255 3300037418 Bacteria 510
244 Ga0395898_0003414 3300037466 Bacteria 17792
245 Ga0395898_0008439 3300037466 Bacteria 10889
246 Ga0395898_0040605 3300037466 Bacteria 4600
247 Ga0395898_0494056 3300037466 Bacteria 1164
248 Ga0395898_0742804 3300037466 Bacteria 923
249 Ga0395898_1482850 3300037466 Bacteria 605
250 Ga0395905_0007451 3300037471 Bacteria 10885
251 Ga0395905_0045628 3300037471 Bacteria 4110
252 Ga0395905_0102788 3300037471 Bacteria 2683
253 Ga0395905_0186477 3300037471 Bacteria 1947
254 Ga0395905_1364572 3300037471 Bacteria 613
255 Ga0395901_0001816 3300038443 Bacteria 22049
256 Ga0395901_0002091 3300038443 Bacteria 20489
257 Ga0395901_0156957 3300038443 Bacteria 2390
258 Ga0395901_0527484 3300038443 Bacteria 1199
259 Ga0395901_0749694 3300038443 Bacteria 970
260 Ga0395901_0797705 3300038443 Bacteria 933
261 Ga0395901_0837773 3300038443 Unclassified 906
262 Ga0395901_1242273 3300038443 Bacteria 709
263 Ga0395901_1298694 3300038443 Unclassified 689
264 Ga0436365_0173716 3300039437 Bacteria 927
265 Ga0436365_0189622 3300039437 Bacteria 1198
266 Ga0436363_0115170 3300039450 Bacteria 1231
267 Ga0436362_0664310 3300039453 Bacteria 589
268 Ga0439450_218004 3300042008 Unclassified 513
269 Ga0466965_0319347 3300044683 Bacteria 846
270 Ga0466961_0014319 3300044693 Bacteria 5091
271 Ga0466963_0003969 3300044694 Bacteria 8558
272 Ga0466963_0056444 3300044694 Bacteria 2613
273 Ga0466963_0135930 3300044694 Bacteria 1701
274 Ga0466963_0575110 3300044694 Bacteria 796
275 Ga0466963_1038162 3300044694 Bacteria 577
276 Ga0466964_0013002 3300044706 Bacteria 3153
277 Ga0466964_0238899 3300044706 Bacteria 890
278 Ga0466970_0152636 3300044765 Bacteria 1275
279 Ga0466957_0014289 3300044842 Bacteria 4622
280 Ga0466957_0200638 3300044842 Bacteria 1310
281 Ga0466957_0324439 3300044842 Bacteria 1040
282 Ga0466960_0890412 3300044901 Bacteria 542
283 Ga0466959_0175342 3300045049 Bacteria 1502
284 Ga0466959_1076112 3300045049 Bacteria 535
285 Ga0466958_0024703 3300045836 Bacteria 3536
286 Ga0466958_1056495 3300045836 Bacteria 530
287 Ga0466967_0005446 3300045976 Bacteria 8825
288 Ga0466967_0055079 3300045976 Bacteria 3503
289 Ga0466967_0056893 3300045976 Bacteria 3450
290 Ga0466967_0172254 3300045976 Bacteria 2037
291 Ga0466967_0245365 3300045976 Bacteria 1709
292 Ga0466967_0286612 3300045976 Bacteria 1581
293 Ga0466967_0294620 3300045976 Bacteria 1559
294 Ga0466967_0972363 3300045976 Bacteria 845
295 Ga0495592_0156983 3300046454 Bacteria 1568
296 Ga0495592_0237146 3300046454 Bacteria 1212
297 Ga0495629_0039549 3300046459 Bacteria 3319
298 Ga0495641_0478803 3300046461 Unclassified 567
299 Ga0495651_0008707 3300046462 Bacteria 7788
300 Ga0495651_0073309 3300046462 Bacteria 2599
301 Ga0495653_0070630 3300046463 Bacteria 2613
302 Ga0495653_0141897 3300046463 Bacteria 1688
303 Ga0495662_0179584 3300046476 Bacteria 1043
304 Ga0495664_0553787 3300046477 Bacteria 685
305 Ga0495594_0344398 3300046499 Bacteria 849
306 Ga0495594_0853893 3300046499 Bacteria 512
307 Ga0495608_0012075 3300046511 Bacteria 6004
308 Ga0495608_0069399 3300046511 Bacteria 2302
309 Ga0495618_0083425 3300046514 Bacteria 2042
310 Ga0495628_0236161 3300046516 Bacteria 1369
311 Ga0495630_0004324 3300046517 Bacteria 9965
312 Ga0495630_0064360 3300046517 Bacteria 2755
313 Ga0495630_0661455 3300046517 Unclassified 800
314 Ga0495630_0725803 3300046517 Unclassified 760
315 Ga0495652_0170275 3300046529 Bacteria 1682
316 Ga0495652_0240437 3300046529 Bacteria 1347
317 Ga0495652_0279876 3300046529 Bacteria 1222
318 Ga0495640_0019540 3300046533 Bacteria 4998
319 Ga0495587_0009850 3300046536 Bacteria 6103
320 Ga0495645_0085453 3300046543 Bacteria 2258
321 Ga0495667_0007399 3300046559 Bacteria 7445
322 Ga0495667_0011282 3300046559 Bacteria 6046
323 Ga0495634_0190533 3300046642 Bacteria 1279
324 Ga0495635_0088702 3300046663 Bacteria 2116
325 Ga0495635_0966063 3300046663 Bacteria 543
326 Ga0495657_0023596 3300046675 Bacteria 4393
327 Ga0495657_0068399 3300046675 Bacteria 2327
328 Ga0495599_0019191 3300046678 Bacteria 4263
329 Ga0495599_0020264 3300046678 Bacteria 4142
330 Ga0495599_0046171 3300046678 Bacteria 2731
331 Ga0495623_0068448 3300046679 Bacteria 2214
332 Ga0495646_0305548 3300046680 Bacteria 840
333 Ga0495658_0121739 3300046683 Bacteria 1579
334 Ga0495613_0014577 3300046689 Bacteria 5830
335 Ga0495613_0238543 3300046689 Bacteria 1272
336 Ga0495624_0052241 3300046690 Bacteria 2583
337 Ga0495624_0246220 3300046690 Bacteria 1081
338 Ga0495600_0129255 3300046809 Bacteria 1642
339 Ga0495604_0050329 3300047317 Bacteria 3235
340 Ga0495604_0392844 3300047317 Bacteria 914
341 Ga0495674_0007424 3300047319 Bacteria 10474
342 Ga0495674_0042206 3300047319 Bacteria 4070
343 Ga0495680_0000502 3300047322 Bacteria 44236
344 Ga0495680_0043668 3300047322 Bacteria 3547
345 Ga0495680_0781347 3300047322 Unclassified 625
346 Ga0495675_0004653 3300047444 Bacteria 8337
347 Ga0495675_0285511 3300047444 Bacteria 983
348 Ga0495684_0054658 3300047471 Bacteria 3045
349 Ga0495684_0107778 3300047471 Bacteria 2104
350 Ga0495602_0049260 3300048088 Bacteria 3775
351 Ga0495602_0298246 3300048088 Bacteria 1180
352 Ga0495602_0817785 3300048088 Bacteria 625
353 Ga0496100_0032424 3300048903 Bacteria 3258
354 Ga0496100_0153992 3300048903 Bacteria 1642
355 Ga0496100_1540278 3300048903 Bacteria 525
356 Ga0496101_0007692 3300048904 Bacteria 7001
357 Ga0496101_0027148 3300048904 Bacteria 3985
358 Ga0496101_0050365 3300048904 Bacteria 2997
359 Ga0496101_0118889 3300048904 Bacteria 1996
360 Ga0496102_0011159 3300048905 Bacteria 7737
361 Ga0496102_0079129 3300048905 Bacteria 3027
362 Ga0496102_0167807 3300048905 Bacteria 2066
363 Ga0496102_0290683 3300048905 Bacteria 1540
364 Ga0496102_1042151 3300048905 Bacteria 738
365 Ga0496103_0059599 3300048906 Bacteria 2371
366 Ga0496103_0087922 3300048906 Bacteria 1959
367 Ga0496104_0008920 3300048907 Bacteria 8911
368 Ga0496104_1343324 3300048907 Bacteria 618
369 Ga0496105_0008156 3300048908 Bacteria 8141
370 Ga0496105_0199269 3300048908 Bacteria 1634
371 Ga0496106_0008219 3300048909 Bacteria 7715
372 Ga0496106_0031822 3300048909 Bacteria 3931
373 Ga0496106_0701505 3300048909 Bacteria 807
374 Ga0496107_0019343 3300048910 Bacteria 4805
375 Ga0496107_0021500 3300048910 Bacteria 4560
376 Ga0496107_0122676 3300048910 Bacteria 1914
377 Ga0496107_1063052 3300048910 Bacteria 586
378 Ga0496108_0198753 3300048911 Bacteria 1739
379 Ga0496108_0201580 3300048911 Bacteria 1727
380 Ga0496109_0042561 3300048912 Bacteria 4114
381 Ga0496109_0100857 3300048912 Bacteria 2679
382 Ga0496109_0325006 3300048912 Bacteria 1452
383 Ga0496109_0522914 3300048912 Unclassified 1120
384 Ga0496109_1341953 3300048912 Bacteria 651
385 Ga0496110_0045681 3300048913 Bacteria 3830
386 Ga0496110_0047116 3300048913 Bacteria 3773
387 Ga0496111_0010692 3300048914 Bacteria 6174
388 Ga0496111_0652461 3300048914 Bacteria 768
389 Ga0496112_0021867 3300048915 Bacteria 6087
390 Ga0496112_0031919 3300048915 Bacteria 5111
391 Ga0496112_0058132 3300048915 Bacteria 3808
392 Ga0496112_0277351 3300048915 Bacteria 1624
393 Ga0496112_0369672 3300048915 Bacteria 1375
394 Ga0496112_1668447 3300048915 Bacteria 550
395 Ga0496113_0323806 3300048916 Bacteria 1236
396 Ga0496113_0901061 3300048916 Bacteria 699
397 Ga0496114_0026120 3300048917 Bacteria 4778
398 Ga0496114_0037178 3300048917 Bacteria 4027
399 Ga0496114_0058212 3300048917 Bacteria 3226
400 Ga0496114_0620526 3300048917 Bacteria 952
401 Ga0496115_0011339 3300048918 Bacteria 6681
402 Ga0496115_0025919 3300048918 Bacteria 4569
403 Ga0496115_0076305 3300048918 Bacteria 2724
404 Ga0496115_0293882 3300048918 Bacteria 1332
405 Ga0496115_0296136 3300048918 Bacteria 1326
406 Ga0496115_0742828 3300048918 Bacteria 768
407 Ga0496115_1096500 3300048918 Bacteria 604
408 Ga0501036_0106026 3300049572 Bacteria 2377
409 Ga0501036_0146712 3300049572 Bacteria 1990
410 Ga0501036_0492105 3300049572 Bacteria 1021
411 Ga0501038_0506356 3300049574 Bacteria 923
412 Ga0501038_0556889 3300049574 Bacteria 871
413 Ga0501039_0086069 3300049575 Bacteria 2448
414 Ga0501040_0048089 3300049576 Bacteria 2915
415 Ga0501041_0104723 3300049577 Bacteria 1753
416 Ga0501042_0227490 3300049578 Bacteria 1345
417 Ga0501046_0076541 3300049580 Bacteria 2592
418 Ga0501046_0185850 3300049580 Bacteria 1552
419 Ga0501047_0052404 3300049581 Bacteria 3944
420 Ga0501047_0744878 3300049581 Bacteria 796
421 Ga0501069_0059710 3300049585 Bacteria 2128
422 Ga0501069_0094423 3300049585 Bacteria 1693
423 Ga0501069_0231212 3300049585 Bacteria 1076
424 Ga0501070_0096153 3300049586 Bacteria 2450
425 Ga0501070_0264918 3300049586 Bacteria 1404
426 Ga0501070_0324935 3300049586 Bacteria 1251
427 Ga0501070_0377164 3300049586 Bacteria 1149
428 Ga0501071_0078358 3300049587 Bacteria 2415
429 Ga0501072_0119491 3300049588 Bacteria 2100
430 Ga0501072_0160507 3300049588 Bacteria 1793
431 Ga0501073_0056562 3300049589 Bacteria 2744
432 Ga0501074_0014047 3300049590 Bacteria 5821
433 Ga0501074_0763143 3300049590 Bacteria 682
434 Ga0501076_0062250 3300049592 Bacteria 2971
435 Ga0501079_0133625 3300049741 Bacteria 1931
436 Ga0501079_0438822 3300049741 Bacteria 1025
437 Ga0501080_0011643 3300049742 Bacteria 8054
438 Ga0501080_0303008 3300049742 Bacteria 1449
439 Ga0501080_0951399 3300049742 Bacteria 747
440 Ga0501080_1580775 3300049742 Bacteria 556
441 Ga0501080_1625149 3300049742 Unclassified 547
442 Ga0501080_1774864 3300049742 Bacteria 519
443 Ga0501081_0071387 3300049743 Bacteria 2420
444 Ga0501035_0211786 3300049822 Bacteria 1658
445 Ga0501035_1462229 3300049822 Bacteria 522
446 Ga0501044_0241253 3300049823 Bacteria 1751
447 Ga0501044_0748871 3300049823 Bacteria 859
448 Ga0501045_0112607 3300049824 Bacteria 2018
449 nmdc:mga05p37_17360_c2 3300050507 Bacteria 3915
450 nmdc:mga05p37_60477_c1 3300050507 Bacteria 4664
451 nmdc:mga09592_189327_c1 3300050508 Bacteria 1781
452 nmdc:mga08y16_750506_c1 3300050511 Bacteria 972
453 nmdc:mga0n895_82181_c1 3300050512 Bacteria 3211
454 nmdc:mga0rr50_3922_c1 3300050513 Bacteria 8652
455 nmdc:mga08x19_149794_c1 3300050514 Bacteria 1579
456 nmdc:mga0a205_40569_c1 3300050515 Bacteria 2146
457 Ga0495601_0020741 3300053077 Bacteria 4017
458 Ga0495601_0730061 3300053077 Unclassified 631
459 Ga0495612_0068981 3300053078 Bacteria 1472
460 Ga0495655_0006471 3300053083 Bacteria 2130
461 Ga0495655_0040768 3300053083 Bacteria 1184
462 Ga0495595_0027690 3300053084 Bacteria 2526
463 Ga0495595_0081941 3300053084 Bacteria 1538
464 Ga0495619_0070315 3300053085 Bacteria 2340
465 Ga0495619_0516940 3300053085 Bacteria 820
466 Ga0501084_0367543 3300054114 Bacteria 1215
467 Ga0501082_0068194 3300060353 Bacteria 3063
468 Ga0501082_0653706 3300060353 Bacteria 920
469 Ga0466962_0079596 3300061719 Bacteria 1566
470 Ga0466962_0536588 3300061719 Bacteria 594
471 Ga0530510_0087706 3300061734 Bacteria 2267
472 Ga0530510_0680897 3300061734 Bacteria 783
473 Ga0070671_100005697
474 JGI25406J46586_10029581
475 Ga0070658_10180978
476 Ga0070658_11646777
477 Ga0070676_11169971
478 Ga0070683_100463964
479 Ga0070683_100937114
480 Ga0070670_101236092
481 Ga0070680_100114807
482 Ga0070682_100437887
483 Ga0070660_100022868
484 Ga0070660_100199176
485 Ga0070659_101196312
486 Ga0070667_100578088
487 Ga0070709_10000730
488 Ga0070709_10666617
489 Ga0070714_100001418
490 Ga0070714_100440466
491 Ga0070714_100483018
492 Ga0070714_101723650
493 Ga0070714_102473752
494 Ga0070713_100001109
495 Ga0070713_100167720
496 Ga0070713_100205402
497 Ga0070713_100369121
498 Ga0070713_101084394
499 Ga0070713_101673775
500 Ga0070710_10000747
501 Ga0070710_10811815
502 Ga0070701_10486871
503 Ga0070711_100000258
504 Ga0070711_100174575
505 Ga0070711_100704832
506 Ga0070711_101900851
507 Ga0070700_101102196
508 Ga0070663_101493003
509 Ga0070678_100541781
510 Ga0070678_101048033
511 Ga0070662_101472740
512 Ga0070681_10031343
513 Ga0070681_10079880
514 Ga0070681_11202211
515 Ga0070681_11380124
516 Ga0068867_100692594
517 Ga0070685_10547914
518 Ga0070706_100051618
519 Ga0070707_100103969
520 Ga0070698_100000873
521 Ga0070698_100329917
522 Ga0070679_100072182
523 Ga0070679_100217831
524 Ga0070679_100590543
525 Ga0070679_102075046
526 Ga0070684_100219417
527 Ga0070684_101251991
528 Ga0070684_101317161
529 Ga0070684_102222082
530 Ga0070693_100774490
531 Ga0070665_100000608
532 Ga0068855_100353094
533 Ga0068855_100585479
534 Ga0068855_101422932
535 Ga0070664_100632631
536 Ga0068856_100244209
537 Ga0068856_100449017
538 Ga0068852_100428546
539 Ga0068852_101904177
540 Ga0068851_10313719
541 Ga0068862_102578889
542 Ga0081538_10147722
543 Ga0081539_10000961
544 Ga0081539_10006728
545 Ga0081539_10143820
546 Ga0070717_10005146
547 Ga0070717_10088229
548 Ga0070717_10175102
549 Ga0070717_10884990
550 Ga0070715_10070412
551 Ga0070716_100000222
552 Ga0070716_100154511
553 Ga0070712_100002878
554 Ga0070712_100013496
555 Ga0075428_100001903
556 Ga0075428_100262649
557 Ga0075431_100467046
558 Ga0075433_10230682
559 Ga0075434_100041755
560 Ga0075429_100216610
561 Ga0075429_100751269
562 Ga0068865_100420137
563 Ga0075436_100471495
564 Ga0075435_100000425
565 Ga0099795_10376285
566 Ga0111539_10557257
567 Ga0111539_11000075
568 Ga0105245_10441035
569 Ga0105245_10758016
570 Ga0105245_10918955
571 Ga0105245_11380286
572 Ga0114129_10070076
573 Ga0114129_10097559
574 Ga0114129_11390263
575 Ga0105243_10126212
576 Ga0105243_10531138
577 Ga0105243_12796452
578 Ga0105241_10194468
579 Ga0105242_10468329
580 Ga0105248_12980456
581 Ga0105238_10668807
582 Ga0105238_12120982
583 Ga0105239_11106905
584 Ga0157369_10126524
585 Ga0157374_10179457
586 Ga0157374_12662375
587 Ga0157378_10061002
588 Ga0157378_11320162
589 Ga0157372_10648994
590 Ga0157375_11888149
591 Ga0157376_10068360
592 Ga0157376_10600843
593 Ga0163161_12028023
594 Ga0184600_133144
595 Ga0197907_10440768
596 Ga0206356_11773008
597 Ga0206351_10847156
598 Ga0207653_10078998
599 Ga0207692_10001938
600 Ga0207692_10149362
601 Ga0207692_11183875
602 Ga0207688_10657331
603 Ga0207685_10076661
604 Ga0207699_10000105
605 Ga0207699_10340197
606 Ga0207705_10025832
607 Ga0207705_10750773
608 Ga0207684_10042959
609 Ga0207654_10294671
610 Ga0207707_10100108
611 Ga0207707_10261615
612 Ga0207693_10001586
613 Ga0207693_10035715
614 Ga0207693_11295401
615 Ga0207663_10079301
616 Ga0207663_10092401
617 Ga0207660_10402024
618 Ga0207657_10012680
619 Ga0207657_10232657
620 Ga0207649_11111875
621 Ga0207652_10400670
622 Ga0207652_10786959
623 Ga0207652_11507562
624 Ga0207694_11500692
625 Ga0207687_10170782
626 Ga0207700_10000050
627 Ga0207700_10438584
628 Ga0207700_10724827
629 Ga0207700_11043175
630 Ga0207700_11217886
631 Ga0207700_11262450
632 Ga0207664_10000101
633 Ga0207664_10642444
634 Ga0207664_11645495
635 Ga0207644_10168604
636 Ga0207706_11328362
637 Ga0207686_10097123
638 Ga0207686_11272620
639 Ga0207709_10077593
640 Ga0207709_10616193
641 Ga0207709_11753852
642 Ga0207704_10102896
643 Ga0207665_10000438
644 Ga0207665_10539680
645 Ga0207691_11200936
646 Ga0207711_11724826
647 Ga0207661_10648565
648 Ga0207679_10144955
649 Ga0207667_10086728
650 Ga0207667_10771672
651 Ga0207651_10571969
652 Ga0207668_10114664
653 Ga0207658_10429215
654 Ga0207678_10609107
655 Ga0207702_10759370
656 Ga0207702_10822725
657 Ga0207683_10153996
658 Ga0268266_10033405
659 Ga0268265_11164190
660 Ga0268265_11491406
661 Ga0265334_10019241
662 Ga0265334_10182283
663 Ga0265318_10014058
664 Ga0265318_10225131
665 Ga0265322_10014015
666 Ga0265322_10030831
667 Ga0265338_10002043
668 Ga0265338_10034411
669 Ga0265324_10062155
670 Ga0265760_10059962
671 Ga0265330_10030902
672 Ga0265330_10387678
673 Ga0265320_10205646
674 Ga0265325_10030682
675 Ga0265340_10016490
676 Ga0265340_10039653
677 Ga0265340_10545691
678 Ga0265331_10011550
679 Ga0265327_10016971
680 Ga0265327_10139826
681 Ga0265316_10059913
682 Ga0265316_10483046
683 Ga0265316_10627663
684 Ga0265313_10017031
685 Ga0265313_10051922
686 Ga0265313_10223632
687 Ga0265314_10018779
688 Ga0265342_10029732
689 Ga0307406_11436290
690 Ga0307409_102095276
691 Ga0307416_100690921
692 Ga0373936_0046206
693 Ga0373936_0349294
694 Ga0373945_0013965
695 Ga0373953_0348791
696 Ga0373956_0315847
697 Ga0373943_0911798
698 Ga0373955_0008672
699 Ga0373955_0478523
700 Ga0373924_0065394
701 Ga0373933_0081849
702 Ga0373947_0372102
703 Ga0373947_0999971
704 Ga0373937_0078184
705 Ga0373925_0066890
706 Ga0395899_0015774
707 Ga0395899_0029763
708 Ga0395899_0112774
709 Ga0395899_0192020
710 Ga0395899_0466728
711 Ga0395900_0009649
712 Ga0395900_0062327
713 Ga0395900_0405337
714 Ga0395900_0458158
715 Ga0395900_1877255
716 Ga0395898_0003414
717 Ga0395898_0008439
718 Ga0395898_0040605
719 Ga0395898_0494056
720 Ga0395898_0742804
721 Ga0395898_1482850
722 Ga0395905_0007451
723 Ga0395905_0045628
724 Ga0395905_0102788
725 Ga0395905_0186477
726 Ga0395905_1364572
727 Ga0395901_0001816
728 Ga0395901_0002091
729 Ga0395901_0156957
730 Ga0395901_0527484
731 Ga0395901_0749694
732 Ga0395901_0797705
733 Ga0395901_0837773
734 Ga0395901_1242273
735 Ga0395901_1298694
736 Ga0436365_0173716
737 Ga0436365_0189622
738 Ga0436363_0115170
739 Ga0436362_0664310
740 Ga0439450_218004
741 Ga0466965_0319347
742 Ga0466961_0014319
743 Ga0466963_0003969
744 Ga0466963_0056444
745 Ga0466963_0135930
746 Ga0466963_0575110
747 Ga0466963_1038162
748 Ga0466964_0013002
749 Ga0466964_0238899
750 Ga0466970_0152636
751 Ga0466957_0014289
752 Ga0466957_0200638
753 Ga0466957_0324439
754 Ga0466960_0890412
755 Ga0466959_0175342
756 Ga0466959_1076112
757 Ga0466958_0024703
758 Ga0466958_1056495
759 Ga0466967_0005446
760 Ga0466967_0055079
761 Ga0466967_0056893
762 Ga0466967_0172254
763 Ga0466967_0245365
764 Ga0466967_0286612
765 Ga0466967_0294620
766 Ga0466967_0972363
767 Ga0495592_0156983
768 Ga0495592_0237146
769 Ga0495629_0039549
770 Ga0495641_0478803
771 Ga0495651_0008707
772 Ga0495651_0073309
773 Ga0495653_0070630
774 Ga0495653_0141897
775 Ga0495662_0179584
776 Ga0495664_0553787
777 Ga0495594_0344398
778 Ga0495594_0853893
779 Ga0495608_0012075
780 Ga0495608_0069399
781 Ga0495618_0083425
782 Ga0495628_0236161
783 Ga0495630_0004324
784 Ga0495630_0064360
785 Ga0495630_0661455
786 Ga0495630_0725803
787 Ga0495652_0170275
788 Ga0495652_0240437
789 Ga0495652_0279876
790 Ga0495640_0019540
791 Ga0495587_0009850
792 Ga0495645_0085453
793 Ga0495667_0007399
794 Ga0495667_0011282
795 Ga0495634_0190533
796 Ga0495635_0088702
797 Ga0495635_0966063
798 Ga0495657_0023596
799 Ga0495657_0068399
800 Ga0495599_0019191
801 Ga0495599_0020264
802 Ga0495599_0046171
803 Ga0495623_0068448
804 Ga0495646_0305548
805 Ga0495658_0121739
806 Ga0495613_0014577
807 Ga0495613_0238543
808 Ga0495624_0052241
809 Ga0495624_0246220
810 Ga0495600_0129255
811 Ga0495604_0050329
812 Ga0495604_0392844
813 Ga0495674_0007424
814 Ga0495674_0042206
815 Ga0495680_0000502
816 Ga0495680_0043668
817 Ga0495680_0781347
818 Ga0495675_0004653
819 Ga0495675_0285511
820 Ga0495684_0054658
821 Ga0495684_0107778
822 Ga0495602_0049260
823 Ga0495602_0298246
824 Ga0495602_0817785
825 Ga0496100_0032424
826 Ga0496100_0153992
827 Ga0496100_1540278
828 Ga0496101_0007692
829 Ga0496101_0027148
830 Ga0496101_0050365
831 Ga0496101_0118889
832 Ga0496102_0011159
833 Ga0496102_0079129
834 Ga0496102_0167807
835 Ga0496102_0290683
836 Ga0496102_1042151
837 Ga0496103_0059599
838 Ga0496103_0087922
839 Ga0496104_0008920
840 Ga0496104_1343324
841 Ga0496105_0008156
842 Ga0496105_0199269
843 Ga0496106_0008219
844 Ga0496106_0031822
845 Ga0496106_0701505
846 Ga0496107_0019343
847 Ga0496107_0021500
848 Ga0496107_0122676
849 Ga0496107_1063052
850 Ga0496108_0198753
851 Ga0496108_0201580
852 Ga0496109_0042561
853 Ga0496109_0100857
854 Ga0496109_0325006
855 Ga0496109_0522914
856 Ga0496109_1341953
857 Ga0496110_0045681
858 Ga0496110_0047116
859 Ga0496111_0010692
860 Ga0496111_0652461
861 Ga0496112_0021867
862 Ga0496112_0031919
863 Ga0496112_0058132
864 Ga0496112_0277351
865 Ga0496112_0369672
866 Ga0496112_1668447
867 Ga0496113_0323806
868 Ga0496113_0901061
869 Ga0496114_0026120
870 Ga0496114_0037178
871 Ga0496114_0058212
872 Ga0496114_0620526
873 Ga0496115_0011339
874 Ga0496115_0025919
875 Ga0496115_0076305
876 Ga0496115_0293882
877 Ga0496115_0296136
878 Ga0496115_0742828
879 Ga0496115_1096500
880 Ga0501036_0106026
881 Ga0501036_0146712
882 Ga0501036_0492105
883 Ga0501038_0506356
884 Ga0501038_0556889
885 Ga0501039_0086069
886 Ga0501040_0048089
887 Ga0501041_0104723
888 Ga0501042_0227490
889 Ga0501046_0076541
890 Ga0501046_0185850
891 Ga0501047_0052404
892 Ga0501047_0744878
893 Ga0501069_0059710
894 Ga0501069_0094423
895 Ga0501069_0231212
896 Ga0501070_0096153
897 Ga0501070_0264918
898 Ga0501070_0324935
899 Ga0501070_0377164
900 Ga0501071_0078358
901 Ga0501072_0119491
902 Ga0501072_0160507
903 Ga0501073_0056562
904 Ga0501074_0014047
905 Ga0501074_0763143
906 Ga0501076_0062250
907 Ga0501079_0133625
908 Ga0501079_0438822
909 Ga0501080_0011643
910 Ga0501080_0303008
911 Ga0501080_0951399
912 Ga0501080_1580775
913 Ga0501080_1625149
914 Ga0501080_1774864
915 Ga0501081_0071387
916 Ga0501035_0211786
917 Ga0501035_1462229
918 Ga0501044_0241253
919 Ga0501044_0748871
920 Ga0501045_0112607
921 nmdc:mga05p37_17360_c2
922 nmdc:mga05p37_60477_c1
923 nmdc:mga09592_189327_c1
924 nmdc:mga08y16_750506_c1
925 nmdc:mga0n895_82181_c1
926 nmdc:mga0rr50_3922_c1
927 nmdc:mga08x19_149794_c1
928 nmdc:mga0a205_40569_c1
929 Ga0495601_0020741
930 Ga0495601_0730061
931 Ga0495612_0068981
932 Ga0495655_0006471
933 Ga0495655_0040768
934 Ga0495595_0027690
935 Ga0495595_0081941
936 Ga0495619_0070315
937 Ga0495619_0516940
938 Ga0501084_0367543
939 Ga0501082_0068194
940 Ga0501082_0653706
941 Ga0466962_0079596
942 Ga0466962_0536588
943 Ga0530510_0087706
944 Ga0530510_0680897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22743

PspAA

PspA-Associated protein

1

92

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bge-assembly1.cif.gz_B crystal structure of the c-terminal fragment of aaa+atpase from haemophilus influenzae 0.9932 21 50
3bge-assembly1.cif.gz_A crystal structure of the c-terminal fragment of aaa+atpase from haemophilus influenzae 0.9717 19 50
3jza-assembly1.cif.gz_B crystal structure of human rab1b in complex with the gef domain of drra/sidm from legionella pneumophila 0.9709 16 53
3n6o-assembly2.cif.gz_B crystal structure of the gef and p4m domain of drra/sidm from legionella pneumophila 0.9701 16 53
5o74-assembly6.cif.gz_K crystal structure of human rab1b covalently bound to the gef domain of drra/sidm from legionella pneumophila in the presence of gdp 0.9694 16 53
ID Description Score Start End Superfamily
af_A0A1D8PTM6_487_626_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9671 20 50 1.25.40.10
af_F1QHY2_844_986_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9654 23 53 1.25.40.10
af_I1JLW3_383_491_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9642 19 50 1.25.40.10
af_Q7K7W5_337_480_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9641 20 50 1.25.40.10
5o74A00 Mainly Alpha;Up-down Bundle;Ferritin; 0.9636 16 53 1.20.1260.70
ID Description Score Start End GO Terms
AF-A0A6I4ZPE3-F1-model_v4 PspA-associated domain-containing protein 0.9767 1 92
AF-A0A5E4KY44-F1-model_v4 PspA-associated domain-containing protein 0.9735 1 92
AF-A0A7W1MY19-F1-model_v4 PspA-associated domain-containing protein 0.9694 1 59
AF-A0A0K8NZS6-F1-model_v4 Transcriptional regulator, GntR family 0.9692 14 54 GO:0003677
GO:0003700
AF-A0A7C2BIG1-F1-model_v4 PspA-associated domain-containing protein 0.968 1 92

Map