F450732
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 472 | 302 | 427 | 385 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100048064|Ga0070680_1000480642 |
| Length | 415 |
| Sequence | MRWSSLLRPTAQPHAPVAVRARRLPGVNPGFDTFVLPEEHQLLRATVREVADDKIAPRAAEIDETGEFPYDVLKSLVEADLHAVHVPEQYGGAGADAIASAIVIEEVARACCASSLIPAVNKLGTMGLLLSGSEELKQKYLPPLARGEVMFSYALSEPEAGSDAAGMRTRAVRDGDGFVLNGVKRWITNAGVSDYYTVMAVTDPDAGSRGISAFVVEKNDEGVSFGAPEKKMGIKGSPTREVYFDNVRIPADRMIGAEGTGFKTALATLDHTRLTIGAQALGVAQGAVDYCTRYVQERKQFGKPIADFQGVSFMLADMAMKTEAARALIYHAAALSERRDPNLTFMSAAAKCFASDTAMEVTTNGVQLLGGYGYTRDYPLERMMRDAKITQIYEGTNQIQRLVMSRNLLKAHPVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 3 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 4 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 5 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 6 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 7 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 8 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 9 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 10 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 11 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 12 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 13 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 14 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 15 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 16 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 17 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 18 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 19 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 20 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 21 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 22 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 23 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 24 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 25 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 26 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 27 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 28 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 29 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 30 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 31 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 32 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 33 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 34 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 35 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 36 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 37 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 38 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 39 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 40 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 154 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 159 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 160 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 161 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 162 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 166 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 167 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 172 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 174 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 182 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 183 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 184 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 185 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 186 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 187 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 197 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 287 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 288 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 289 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 290 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 294 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 295 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 296 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 297 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 298 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 299 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 300 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 301 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 302 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.19 |
| Metatranscriptomes | 1.27 |
| Isolates | 9.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.97 |
| Nodule | 0.42 |
| Rhizoplane | 6.36 |
| Rhizosphere | 75.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10029109 | 3300001989 | Bacteria | 1923 |
| 2 | JGI24737J22298_10017734 | 3300001990 | Bacteria | 2291 |
| 3 | JGI24738J21930_10010025 | 3300002075 | Bacteria | 2119 |
| 4 | Ga0006562J51391_1076718 | 3300003578 | Bacteria | 2550 |
| 5 | Ga0070658_10000934 | 3300005327 | Bacteria | 25019 |
| 6 | Ga0070658_10001118 | 3300005327 | Bacteria | 22898 |
| 7 | Ga0070658_10093471 | 3300005327 | Bacteria | 2481 |
| 8 | Ga0070658_10157161 | 3300005327 | Bacteria | 1906 |
| 9 | Ga0070666_10004238 | 3300005335 | Bacteria | 8712 |
| 10 | Ga0070680_100000019 | 3300005336 | Bacteria | 83282 |
| 11 | Ga0070680_100004789 | 3300005336 | Bacteria | 10186 |
| 12 | Ga0070680_100048064 | 3300005336 | Bacteria | 3476 |
| 13 | Ga0068868_100017712 | 3300005338 | Bacteria | 5312 |
| 14 | Ga0070660_100029363 | 3300005339 | Bacteria | 4121 |
| 15 | Ga0070660_100057584 | 3300005339 | Bacteria | 3011 |
| 16 | Ga0070691_10024569 | 3300005341 | Bacteria | 2800 |
| 17 | Ga0070668_100000611 | 3300005347 | Bacteria | 23925 |
| 18 | Ga0070674_100012722 | 3300005356 | Bacteria | 5176 |
| 19 | Ga0070659_100000513 | 3300005366 | Bacteria | 28466 |
| 20 | Ga0070659_100046241 | 3300005366 | Bacteria | 3411 |
| 21 | Ga0070667_100000572 | 3300005367 | Bacteria | 36433 |
| 22 | Ga0070701_10004658 | 3300005438 | Bacteria | 5583 |
| 23 | Ga0070663_100017669 | 3300005455 | Bacteria | 4659 |
| 24 | Ga0070663_100282617 | 3300005455 | Bacteria | 1323 |
| 25 | Ga0070662_100101126 | 3300005457 | Bacteria | 2182 |
| 26 | Ga0070681_10000017 | 3300005458 | Bacteria | 125537 |
| 27 | Ga0070681_10002068 | 3300005458 | Bacteria | 18207 |
| 28 | Ga0070681_10043507 | 3300005458 | Bacteria | 4499 |
| 29 | Ga0070679_100000009 | 3300005530 | Bacteria | 191579 |
| 30 | Ga0070679_100002893 | 3300005530 | Bacteria | 15597 |
| 31 | Ga0070679_100050208 | 3300005530 | Bacteria | 4155 |
| 32 | Ga0070679_100248811 | 3300005530 | Bacteria | 1734 |
| 33 | Ga0070672_100000632 | 3300005543 | Bacteria | 20612 |
| 34 | Ga0070693_100009333 | 3300005547 | Bacteria | 4876 |
| 35 | Ga0070665_100014771 | 3300005548 | Bacteria | 7838 |
| 36 | Ga0068855_100005045 | 3300005563 | Bacteria | 16111 |
| 37 | Ga0068855_100046486 | 3300005563 | Bacteria | 5131 |
| 38 | Ga0068855_100210198 | 3300005563 | Bacteria | 2187 |
| 39 | Ga0070664_100118852 | 3300005564 | Bacteria | 2312 |
| 40 | Ga0068854_100002147 | 3300005578 | Bacteria | 12110 |
| 41 | Ga0068856_100044268 | 3300005614 | Bacteria | 4380 |
| 42 | Ga0070702_100018627 | 3300005615 | Bacteria | 3605 |
| 43 | Ga0068864_100006230 | 3300005618 | Bacteria | 9784 |
| 44 | Ga0068863_100009275 | 3300005841 | Bacteria | 9598 |
| 45 | Ga0068863_100012826 | 3300005841 | Bacteria | 8083 |
| 46 | Ga0068863_100324979 | 3300005841 | Bacteria | 1495 |
| 47 | Ga0068858_100340414 | 3300005842 | Bacteria | 1436 |
| 48 | Ga0068862_100114714 | 3300005844 | Bacteria | 2368 |
| 49 | Ga0081455_10004069 | 3300005937 | Bacteria | 16563 |
| 50 | Ga0081540_1011841 | 3300005983 | Bacteria | 5796 |
| 51 | Ga0081540_1015359 | 3300005983 | Bacteria | 4851 |
| 52 | Ga0081539_10020927 | 3300005985 | Bacteria | 4394 |
| 53 | Ga0070717_10004332 | 3300006028 | Bacteria | 10241 |
| 54 | Ga0075364_10192462 | 3300006051 | Bacteria | 1381 |
| 55 | Ga0070716_100003625 | 3300006173 | Bacteria | 7297 |
| 56 | Ga0070712_100004630 | 3300006175 | Bacteria | 8502 |
| 57 | Ga0075367_10047181 | 3300006178 | Bacteria | 2534 |
| 58 | Ga0075369_10022754 | 3300006186 | Bacteria | 2587 |
| 59 | Ga0075370_10096483 | 3300006353 | Bacteria | 1708 |
| 60 | Ga0068871_100080031 | 3300006358 | Bacteria | 2704 |
| 61 | Ga0075431_100480096 | 3300006847 | Bacteria | 1236 |
| 62 | Ga0075433_10018196 | 3300006852 | Bacteria | 5836 |
| 63 | Ga0075434_100040744 | 3300006871 | Bacteria | 4600 |
| 64 | Ga0075436_100043423 | 3300006914 | Bacteria | 3099 |
| 65 | Ga0105251_10082056 | 3300009011 | Bacteria | 1489 |
| 66 | Ga0105240_10070915 | 3300009093 | Bacteria | 4309 |
| 67 | Ga0111539_10325130 | 3300009094 | Bacteria | 1790 |
| 68 | Ga0111539_10361281 | 3300009094 | Bacteria | 1690 |
| 69 | Ga0105245_10003879 | 3300009098 | Bacteria | 13300 |
| 70 | Ga0105245_10019189 | 3300009098 | Bacteria | 5988 |
| 71 | Ga0105247_10021611 | 3300009101 | Bacteria | 3874 |
| 72 | Ga0114129_10139498 | 3300009147 | Bacteria | 3324 |
| 73 | Ga0105241_10005291 | 3300009174 | Bacteria | 9533 |
| 74 | Ga0105237_10038129 | 3300009545 | Bacteria | 4854 |
| 75 | Ga0105237_10138838 | 3300009545 | Bacteria | 2425 |
| 76 | Ga0105238_10004485 | 3300009551 | Bacteria | 13832 |
| 77 | Ga0105249_10000071 | 3300009553 | Bacteria | 146512 |
| 78 | Ga0105239_10057835 | 3300010375 | Bacteria | 4254 |
| 79 | Ga0105246_10003955 | 3300011119 | Bacteria | 8984 |
| 80 | Ga0105246_10008917 | 3300011119 | Bacteria | 6173 |
| 81 | Ga0157371_10015230 | 3300013102 | Bacteria | 5775 |
| 82 | Ga0157369_10001900 | 3300013105 | Bacteria | 25188 |
| 83 | Ga0157369_10014807 | 3300013105 | Bacteria | 8801 |
| 84 | Ga0157369_10033647 | 3300013105 | Bacteria | 5631 |
| 85 | Ga0157374_10010283 | 3300013296 | Bacteria | 8046 |
| 86 | Ga0157374_10059500 | 3300013296 | Bacteria | 3573 |
| 87 | Ga0157378_10217011 | 3300013297 | Bacteria | 1817 |
| 88 | Ga0163162_10198178 | 3300013306 | Bacteria | 2137 |
| 89 | Ga0157372_10051578 | 3300013307 | Bacteria | 4579 |
| 90 | Ga0157372_10228800 | 3300013307 | Bacteria | 2155 |
| 91 | Ga0157375_10025882 | 3300013308 | Bacteria | 5460 |
| 92 | Ga0157375_10126492 | 3300013308 | Bacteria | 2671 |
| 93 | Ga0163163_10115307 | 3300014325 | Bacteria | 2718 |
| 94 | Ga0163163_10124564 | 3300014325 | Bacteria | 2614 |
| 95 | Ga0157380_10012667 | 3300014326 | Bacteria | 6122 |
| 96 | Ga0157379_10017300 | 3300014968 | Bacteria | 6352 |
| 97 | Ga0182007_10003191 | 3300015262 | Bacteria | 7834 |
| 98 | Ga0163161_10003978 | 3300017792 | Bacteria | 10351 |
| 99 | Ga0206354_10948830 | 3300020081 | Bacteria | 1536 |
| 100 | Ga0206353_10014688 | 3300020082 | Bacteria | 15094 |
| 101 | Ga0206353_10093504 | 3300020082 | Bacteria | 2828 |
| 102 | Ga0213876_10001920 | 3300021384 | Bacteria | 12469 |
| 103 | Ga0213875_10000488 | 3300021388 | Bacteria | 33637 |
| 104 | Ga0213875_10013606 | 3300021388 | Bacteria | 3987 |
| 105 | Ga0224712_10012606 | 3300022467 | Bacteria | 2666 |
| 106 | Ga0209758_1001238 | 3300025297 | Bacteria | 31885 |
| 107 | Ga0207426_1038906 | 3300025302 | Bacteria | 1494 |
| 108 | Ga0207692_10043440 | 3300025898 | Bacteria | 2236 |
| 109 | Ga0207642_10025832 | 3300025899 | Bacteria | 2382 |
| 110 | Ga0207710_10029668 | 3300025900 | Bacteria | 2382 |
| 111 | Ga0207688_10009843 | 3300025901 | Bacteria | 5202 |
| 112 | Ga0207680_10037694 | 3300025903 | Bacteria | 2793 |
| 113 | Ga0207647_10005937 | 3300025904 | Bacteria | 8902 |
| 114 | Ga0207647_10016783 | 3300025904 | Bacteria | 4989 |
| 115 | Ga0207647_10038860 | 3300025904 | Bacteria | 3006 |
| 116 | Ga0207647_10049496 | 3300025904 | Bacteria | 2606 |
| 117 | Ga0207699_10016727 | 3300025906 | Bacteria | 3843 |
| 118 | Ga0207705_10000251 | 3300025909 | Bacteria | 52410 |
| 119 | Ga0207705_10013887 | 3300025909 | Bacteria | 5807 |
| 120 | Ga0207705_10062078 | 3300025909 | Bacteria | 2699 |
| 121 | Ga0207654_10018748 | 3300025911 | Bacteria | 3637 |
| 122 | Ga0207654_10023503 | 3300025911 | Bacteria | 3303 |
| 123 | Ga0207707_10000257 | 3300025912 | Bacteria | 57640 |
| 124 | Ga0207707_10005505 | 3300025912 | Bacteria | 11067 |
| 125 | Ga0207707_10038148 | 3300025912 | Bacteria | 4198 |
| 126 | Ga0207707_10038344 | 3300025912 | Bacteria | 4187 |
| 127 | Ga0207695_10002866 | 3300025913 | Bacteria | 25047 |
| 128 | Ga0207671_10003461 | 3300025914 | Bacteria | 15716 |
| 129 | Ga0207693_10004630 | 3300025915 | Bacteria | 11604 |
| 130 | Ga0207660_10053286 | 3300025917 | Bacteria | 2883 |
| 131 | Ga0207657_10003612 | 3300025919 | Bacteria | 16487 |
| 132 | Ga0207657_10031676 | 3300025919 | Bacteria | 4786 |
| 133 | Ga0207652_10000124 | 3300025921 | Bacteria | 82835 |
| 134 | Ga0207652_10001683 | 3300025921 | Bacteria | 19373 |
| 135 | Ga0207652_10055536 | 3300025921 | Bacteria | 3407 |
| 136 | Ga0207652_10210899 | 3300025921 | Bacteria | 1749 |
| 137 | Ga0207687_10009837 | 3300025927 | Bacteria | 6260 |
| 138 | Ga0207690_10000189 | 3300025932 | Bacteria | 47490 |
| 139 | Ga0207709_10020090 | 3300025935 | Bacteria | 3765 |
| 140 | Ga0207709_10090588 | 3300025935 | Bacteria | 1998 |
| 141 | Ga0207665_10000738 | 3300025939 | Bacteria | 22007 |
| 142 | Ga0207689_10094796 | 3300025942 | Bacteria | 2451 |
| 143 | Ga0207679_10011518 | 3300025945 | Bacteria | 5732 |
| 144 | Ga0207667_10053160 | 3300025949 | Bacteria | 4262 |
| 145 | Ga0207667_10067772 | 3300025949 | Bacteria | 3717 |
| 146 | Ga0207712_10000028 | 3300025961 | Bacteria | 250190 |
| 147 | Ga0207712_10070906 | 3300025961 | Bacteria | 2505 |
| 148 | Ga0207668_10002350 | 3300025972 | Bacteria | 11047 |
| 149 | Ga0207668_10064913 | 3300025972 | Bacteria | 2582 |
| 150 | Ga0207640_10270389 | 3300025981 | Bacteria | 1329 |
| 151 | Ga0207658_10000505 | 3300025986 | Bacteria | 35682 |
| 152 | Ga0207703_10033005 | 3300026035 | Bacteria | 4101 |
| 153 | Ga0207639_10169003 | 3300026041 | Bacteria | 1850 |
| 154 | Ga0207678_10305255 | 3300026067 | Bacteria | 1368 |
| 155 | Ga0207708_10015379 | 3300026075 | Bacteria | 5740 |
| 156 | Ga0207641_10000845 | 3300026088 | Bacteria | 32537 |
| 157 | Ga0207641_10032352 | 3300026088 | Bacteria | 4342 |
| 158 | Ga0207641_10378103 | 3300026088 | Bacteria | 1356 |
| 159 | Ga0207674_10424203 | 3300026116 | Bacteria | 1285 |
| 160 | Ga0207683_10003061 | 3300026121 | Bacteria | 14623 |
| 161 | Ga0207428_10135032 | 3300027907 | Bacteria | 1886 |
| 162 | Ga0268265_10133199 | 3300028380 | Bacteria | 2069 |
| 163 | Ga0268264_10164235 | 3300028381 | Bacteria | 2003 |
| 164 | Ga0268264_10177119 | 3300028381 | Bacteria | 1933 |
| 165 | Ga0307515_10000668 | 3300028794 | Bacteria | 79033 |
| 166 | Ga0307515_10001363 | 3300028794 | Bacteria | 55232 |
| 167 | Ga0307515_10026270 | 3300028794 | Bacteria | 10030 |
| 168 | Ga0307515_10052431 | 3300028794 | Bacteria | 6050 |
| 169 | Ga0307515_10087152 | 3300028794 | Bacteria | 3968 |
| 170 | Ga0265338_10003387 | 3300028800 | Bacteria | 22494 |
| 171 | Ga0307511_10121231 | 3300030521 | Bacteria | 1616 |
| 172 | Ga0307512_10001051 | 3300030522 | Bacteria | 40387 |
| 173 | Ga0307512_10006458 | 3300030522 | Bacteria | 11874 |
| 174 | Ga0307512_10051898 | 3300030522 | Bacteria | 3276 |
| 175 | Ga0265340_10001511 | 3300031247 | Bacteria | 13340 |
| 176 | Ga0265339_10008228 | 3300031249 | Bacteria | 6651 |
| 177 | Ga0265327_10001829 | 3300031251 | Bacteria | 24850 |
| 178 | Ga0307513_10003078 | 3300031456 | Bacteria | 22757 |
| 179 | Ga0307513_10059804 | 3300031456 | Bacteria | 4043 |
| 180 | Ga0307509_10028031 | 3300031507 | Bacteria | 6263 |
| 181 | Ga0307508_10002592 | 3300031616 | Bacteria | 19015 |
| 182 | Ga0307508_10007204 | 3300031616 | Bacteria | 10359 |
| 183 | Ga0307508_10146082 | 3300031616 | Bacteria | 1969 |
| 184 | Ga0316576_10028560 | 3300031727 | Bacteria | 3933 |
| 185 | Ga0307516_10082464 | 3300031730 | Bacteria | 3057 |
| 186 | Ga0307413_10002072 | 3300031824 | Bacteria | 8013 |
| 187 | Ga0307410_10020808 | 3300031852 | Bacteria | 4023 |
| 188 | Ga0307507_10122857 | 3300033179 | Bacteria | 2069 |
| 189 | Ga0373938_0007309 | 3300034957 | Bacteria | 1939 |
| 190 | Ga0373928_0009856 | 3300035084 | Bacteria | 1870 |
| 191 | Ga0373929_0001942 | 3300035085 | Bacteria | 3865 |
| 192 | Ga0373940_0003760 | 3300035088 | Bacteria | 3135 |
| 193 | Ga0373951_0000053 | 3300035091 | Bacteria | 46153 |
| 194 | Ga0373951_0015601 | 3300035091 | Bacteria | 1712 |
| 195 | Ga0373939_0006560 | 3300035114 | Bacteria | 2806 |
| 196 | Ga0373942_0002341 | 3300035207 | Bacteria | 4618 |
| 197 | Ga0373942_0002925 | 3300035207 | Bacteria | 4045 |
| 198 | Ga0373962_0013841 | 3300035242 | Bacteria | 2049 |
| 199 | Ga0316574_0026309 | 3300035398 | Bacteria | 3497 |
| 200 | Ga0373931_0041702 | 3300035691 | Bacteria | 2411 |
| 201 | Ga0316584_0088862 | 3300036712 | Bacteria | 2313 |
| 202 | Ga0395899_0211418 | 3300037312 | Bacteria | 1348 |
| 203 | Ga0395898_0019341 | 3300037466 | Bacteria | 6933 |
| 204 | Ga0395898_0073711 | 3300037466 | Bacteria | 3298 |
| 205 | Ga0436364_0012131 | 3300037853 | Bacteria | 4042 |
| 206 | Ga0436364_0132601 | 3300037853 | Bacteria | 24278 |
| 207 | Ga0436365_1454613 | 3300039437 | Bacteria | 26721 |
| 208 | Ga0436361_1044359 | 3300039447 | Bacteria | 4210 |
| 209 | Ga0436363_1202288 | 3300039450 | Bacteria | 3001 |
| 210 | Ga0439466_0002013 | 3300041411 | Bacteria | 7976 |
| 211 | Ga0439431_0016174 | 3300041997 | Bacteria | 1743 |
| 212 | Ga0439445_0006588 | 3300042004 | Bacteria | 2672 |
| 213 | Ga0439445_0012073 | 3300042004 | Bacteria | 2069 |
| 214 | Ga0439449_0002617 | 3300042007 | Bacteria | 7010 |
| 215 | Ga0466969_0000846 | 3300044656 | Bacteria | 16623 |
| 216 | Ga0466969_0009134 | 3300044656 | Bacteria | 5257 |
| 217 | Ga0466969_0038869 | 3300044656 | Bacteria | 2392 |
| 218 | Ga0466972_0009994 | 3300044658 | Bacteria | 4765 |
| 219 | Ga0466972_0014209 | 3300044658 | Bacteria | 3990 |
| 220 | Ga0466972_0017379 | 3300044658 | Bacteria | 3600 |
| 221 | Ga0466972_0102979 | 3300044658 | Bacteria | 1350 |
| 222 | Ga0466965_0002082 | 3300044683 | Bacteria | 8384 |
| 223 | Ga0466965_0012273 | 3300044683 | Bacteria | 4026 |
| 224 | Ga0466965_0050608 | 3300044683 | Bacteria | 2060 |
| 225 | Ga0466965_0062623 | 3300044683 | Bacteria | 1861 |
| 226 | Ga0466966_0001727 | 3300044684 | Bacteria | 14128 |
| 227 | Ga0466966_0003063 | 3300044684 | Bacteria | 11020 |
| 228 | Ga0466966_0005284 | 3300044684 | Bacteria | 8490 |
| 229 | Ga0466961_0003182 | 3300044693 | Bacteria | 10221 |
| 230 | Ga0466961_0008823 | 3300044693 | Bacteria | 6430 |
| 231 | Ga0466961_0013620 | 3300044693 | Bacteria | 5210 |
| 232 | Ga0466961_0030248 | 3300044693 | Bacteria | 3480 |
| 233 | Ga0466961_0033501 | 3300044693 | Bacteria | 3300 |
| 234 | Ga0466961_0178762 | 3300044693 | Bacteria | 1318 |
| 235 | Ga0466963_0000918 | 3300044694 | Bacteria | 15006 |
| 236 | Ga0466963_0004229 | 3300044694 | Bacteria | 8327 |
| 237 | Ga0466963_0076383 | 3300044694 | Bacteria | 2262 |
| 238 | Ga0466971_0000394 | 3300044719 | Bacteria | 16912 |
| 239 | Ga0466971_0002502 | 3300044719 | Bacteria | 7773 |
| 240 | Ga0466971_0005752 | 3300044719 | Bacteria | 5392 |
| 241 | Ga0466971_0125383 | 3300044719 | Bacteria | 1190 |
| 242 | Ga0466970_0001367 | 3300044765 | Bacteria | 11761 |
| 243 | Ga0466970_0009534 | 3300044765 | Bacteria | 4910 |
| 244 | Ga0466970_0009592 | 3300044765 | Bacteria | 4896 |
| 245 | Ga0466970_0030900 | 3300044765 | Bacteria | 2826 |
| 246 | Ga0466970_0045317 | 3300044765 | Bacteria | 2341 |
| 247 | Ga0466957_0013876 | 3300044842 | Bacteria | 4683 |
| 248 | Ga0466957_0016231 | 3300044842 | Bacteria | 4355 |
| 249 | Ga0466957_0025933 | 3300044842 | Bacteria | 3475 |
| 250 | Ga0466957_0029443 | 3300044842 | Bacteria | 3274 |
| 251 | Ga0466957_0085446 | 3300044842 | Bacteria | 1971 |
| 252 | Ga0466960_0003863 | 3300044901 | Bacteria | 5808 |
| 253 | Ga0466960_0048841 | 3300044901 | Bacteria | 2034 |
| 254 | Ga0466959_0003768 | 3300045049 | Bacteria | 10041 |
| 255 | Ga0466959_0022226 | 3300045049 | Bacteria | 4686 |
| 256 | Ga0466959_0062851 | 3300045049 | Bacteria | 2697 |
| 257 | Ga0466959_0158963 | 3300045049 | Bacteria | 1589 |
| 258 | Ga0466958_0006001 | 3300045836 | Bacteria | 6579 |
| 259 | Ga0466958_0006242 | 3300045836 | Bacteria | 6470 |
| 260 | Ga0466958_0032433 | 3300045836 | Bacteria | 3108 |
| 261 | Ga0466958_0068668 | 3300045836 | Bacteria | 2167 |
| 262 | Ga0466958_0093686 | 3300045836 | Bacteria | 1860 |
| 263 | Ga0466958_0127562 | 3300045836 | Bacteria | 1596 |
| 264 | Ga0466967_0018994 | 3300045976 | Bacteria | 5515 |
| 265 | Ga0466967_0029072 | 3300045976 | Bacteria | 4622 |
| 266 | Ga0466967_0032778 | 3300045976 | Bacteria | 4391 |
| 267 | Ga0466967_0033369 | 3300045976 | Bacteria | 4356 |
| 268 | Ga0466967_0051360 | 3300045976 | Bacteria | 3613 |
| 269 | Ga0466967_0083055 | 3300045976 | Bacteria | 2896 |
| 270 | Ga0466967_0110410 | 3300045976 | Bacteria | 2526 |
| 271 | Ga0466967_0237208 | 3300045976 | Bacteria | 1738 |
| 272 | Ga0466967_0352950 | 3300045976 | Bacteria | 1424 |
| 273 | Ga0495592_0003573 | 3300046454 | Bacteria | 11176 |
| 274 | Ga0495603_0002583 | 3300046455 | Bacteria | 10682 |
| 275 | Ga0495629_0000935 | 3300046459 | Bacteria | 23513 |
| 276 | Ga0495629_0016409 | 3300046459 | Bacteria | 5316 |
| 277 | Ga0495638_0161869 | 3300046460 | Bacteria | 1290 |
| 278 | Ga0495651_0089836 | 3300046462 | Bacteria | 2305 |
| 279 | Ga0495582_0165582 | 3300046473 | Bacteria | 1258 |
| 280 | Ga0495639_0115322 | 3300046475 | Bacteria | 1278 |
| 281 | Ga0495594_0000163 | 3300046499 | Bacteria | 31842 |
| 282 | Ga0495618_0126629 | 3300046514 | Bacteria | 1635 |
| 283 | Ga0495628_0070054 | 3300046516 | Bacteria | 2734 |
| 284 | Ga0495632_0038855 | 3300046519 | Bacteria | 2407 |
| 285 | Ga0495666_0088144 | 3300046526 | Bacteria | 1466 |
| 286 | Ga0495652_0017946 | 3300046529 | Bacteria | 6313 |
| 287 | Ga0495640_0009935 | 3300046533 | Bacteria | 7378 |
| 288 | Ga0495622_0006021 | 3300046557 | Bacteria | 5635 |
| 289 | Ga0495633_0078038 | 3300046558 | Bacteria | 1542 |
| 290 | Ga0495634_0001735 | 3300046642 | Bacteria | 18881 |
| 291 | Ga0495588_0002102 | 3300046674 | Bacteria | 8545 |
| 292 | Ga0495657_0020317 | 3300046675 | Bacteria | 4775 |
| 293 | Ga0495613_0038905 | 3300046689 | Bacteria | 3526 |
| 294 | Ga0495581_0063805 | 3300047315 | Bacteria | 2128 |
| 295 | Ga0495676_0003711 | 3300047321 | Bacteria | 13866 |
| 296 | Ga0495676_0073916 | 3300047321 | Bacteria | 2612 |
| 297 | Ga0495687_011713 | 3300047443 | Bacteria | 4692 |
| 298 | Ga0496100_0000585 | 3300048903 | Bacteria | 17202 |
| 299 | Ga0496100_0041670 | 3300048903 | Bacteria | 2928 |
| 300 | Ga0496101_0000032 | 3300048904 | Bacteria | 186783 |
| 301 | Ga0496101_0009524 | 3300048904 | Bacteria | 6385 |
| 302 | Ga0496101_0094305 | 3300048904 | Bacteria | 2230 |
| 303 | Ga0496102_0000127 | 3300048905 | Bacteria | 104838 |
| 304 | Ga0496102_0030323 | 3300048905 | Bacteria | 4840 |
| 305 | Ga0496102_0077331 | 3300048905 | Bacteria | 3063 |
| 306 | Ga0496102_0261709 | 3300048905 | Bacteria | 1631 |
| 307 | Ga0496103_0000134 | 3300048906 | Bacteria | 77847 |
| 308 | Ga0496103_0000801 | 3300048906 | Bacteria | 23137 |
| 309 | Ga0496104_0002487 | 3300048907 | Bacteria | 15864 |
| 310 | Ga0496104_0141859 | 3300048907 | Bacteria | 2308 |
| 311 | Ga0496105_0019641 | 3300048908 | Bacteria | 5451 |
| 312 | Ga0496106_0005776 | 3300048909 | Bacteria | 9150 |
| 313 | Ga0496107_0000546 | 3300048910 | Bacteria | 21055 |
| 314 | Ga0496107_0066165 | 3300048910 | Bacteria | 2620 |
| 315 | Ga0496108_0000016 | 3300048911 | Bacteria | 237051 |
| 316 | Ga0496108_0006276 | 3300048911 | Bacteria | 9633 |
| 317 | Ga0496108_0035866 | 3300048911 | Bacteria | 4124 |
| 318 | Ga0496108_0037206 | 3300048911 | Bacteria | 4053 |
| 319 | Ga0496109_0000030 | 3300048912 | Bacteria | 164120 |
| 320 | Ga0496110_0001248 | 3300048913 | Bacteria | 18173 |
| 321 | Ga0496111_0010739 | 3300048914 | Bacteria | 6157 |
| 322 | Ga0496111_0114347 | 3300048914 | Bacteria | 1989 |
| 323 | Ga0496112_0024584 | 3300048915 | Bacteria | 5772 |
| 324 | Ga0496112_0028106 | 3300048915 | Bacteria | 5426 |
| 325 | Ga0496114_0000187 | 3300048917 | Bacteria | 44786 |
| 326 | Ga0496115_0014978 | 3300048918 | Bacteria | 5878 |
| 327 | Ga0496115_0018585 | 3300048918 | Bacteria | 5341 |
| 328 | Ga0496116_0000228 | 3300048919 | Bacteria | 104766 |
| 329 | Ga0496116_0002431 | 3300048919 | Bacteria | 19606 |
| 330 | Ga0496117_0000204 | 3300048920 | Bacteria | 116843 |
| 331 | Ga0496118_0000202 | 3300048921 | Bacteria | 104816 |
| 332 | Ga0496118_0004508 | 3300048921 | Bacteria | 16465 |
| 333 | Ga0496119_0000700 | 3300048922 | Bacteria | 44933 |
| 334 | Ga0496119_0001772 | 3300048922 | Bacteria | 25130 |
| 335 | Ga0496119_0053789 | 3300048922 | Bacteria | 2457 |
| 336 | Ga0496120_0006080 | 3300048923 | Bacteria | 9374 |
| 337 | Ga0496120_0009258 | 3300048923 | Bacteria | 7010 |
| 338 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 339 | Ga0496121_0016157 | 3300048924 | Bacteria | 7730 |
| 340 | Ga0496122_0000173 | 3300048925 | Bacteria | 153768 |
| 341 | Ga0496123_0005483 | 3300048926 | Bacteria | 12756 |
| 342 | Ga0496124_0000012 | 3300048927 | Bacteria | 512581 |
| 343 | Ga0496124_0005696 | 3300048927 | Bacteria | 13879 |
| 344 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 345 | Ga0496125_0033162 | 3300048928 | Bacteria | 4575 |
| 346 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 347 | Ga0496126_0000490 | 3300048929 | Bacteria | 77991 |
| 348 | Ga0496126_0005743 | 3300048929 | Bacteria | 14041 |
| 349 | Ga0501306_006800 | 3300049127 | Bacteria | 1354 |
| 350 | Ga0501031_0085994 | 3300049568 | Bacteria | 2050 |
| 351 | Ga0501031_0111474 | 3300049568 | Bacteria | 1787 |
| 352 | Ga0501031_0174351 | 3300049568 | Bacteria | 1405 |
| 353 | Ga0501032_0012121 | 3300049569 | Bacteria | 6171 |
| 354 | Ga0501032_0014525 | 3300049569 | Bacteria | 5575 |
| 355 | Ga0501032_0018279 | 3300049569 | Bacteria | 4912 |
| 356 | Ga0501032_0064849 | 3300049569 | Bacteria | 2444 |
| 357 | Ga0501032_0176057 | 3300049569 | Bacteria | 1401 |
| 358 | Ga0501033_0037100 | 3300049570 | Bacteria | 3649 |
| 359 | Ga0501034_0029682 | 3300049571 | Bacteria | 5559 |
| 360 | Ga0501034_0115224 | 3300049571 | Bacteria | 2676 |
| 361 | Ga0501036_0006857 | 3300049572 | Bacteria | 9256 |
| 362 | Ga0501036_0014103 | 3300049572 | Bacteria | 6643 |
| 363 | Ga0501036_0021901 | 3300049572 | Bacteria | 5374 |
| 364 | Ga0501037_0218824 | 3300049573 | Bacteria | 1341 |
| 365 | Ga0501038_0059180 | 3300049574 | Bacteria | 3282 |
| 366 | Ga0501039_0027953 | 3300049575 | Bacteria | 4338 |
| 367 | Ga0501040_0007809 | 3300049576 | Bacteria | 6929 |
| 368 | Ga0501041_0027687 | 3300049577 | Bacteria | 3416 |
| 369 | Ga0501042_0000616 | 3300049578 | Bacteria | 18986 |
| 370 | Ga0501043_0020781 | 3300049579 | Bacteria | 5148 |
| 371 | Ga0501043_0079572 | 3300049579 | Bacteria | 2575 |
| 372 | Ga0501043_0210997 | 3300049579 | Bacteria | 1505 |
| 373 | Ga0501046_0063133 | 3300049580 | Bacteria | 2893 |
| 374 | Ga0501047_0015027 | 3300049581 | Bacteria | 7368 |
| 375 | Ga0501048_0006807 | 3300049582 | Bacteria | 8682 |
| 376 | Ga0501068_0058567 | 3300049584 | Bacteria | 2338 |
| 377 | Ga0501069_0003390 | 3300049585 | Bacteria | 8182 |
| 378 | Ga0501070_0000776 | 3300049586 | Bacteria | 29084 |
| 379 | Ga0501070_0002928 | 3300049586 | Bacteria | 14854 |
| 380 | Ga0501070_0027795 | 3300049586 | Bacteria | 4744 |
| 381 | Ga0501070_0119336 | 3300049586 | Bacteria | 2180 |
| 382 | Ga0501070_0155067 | 3300049586 | Bacteria | 1888 |
| 383 | Ga0501071_0009431 | 3300049587 | Bacteria | 6499 |
| 384 | Ga0501072_0196576 | 3300049588 | Bacteria | 1608 |
| 385 | Ga0501074_0001371 | 3300049590 | Bacteria | 16150 |
| 386 | Ga0501074_0088732 | 3300049590 | Bacteria | 2215 |
| 387 | Ga0501076_0013326 | 3300049592 | Bacteria | 6165 |
| 388 | Ga0501076_0019568 | 3300049592 | Bacteria | 5176 |
| 389 | Ga0501077_0031641 | 3300049593 | Bacteria | 3367 |
| 390 | Ga0501077_0081650 | 3300049593 | Bacteria | 2048 |
| 391 | Ga0501077_0128787 | 3300049593 | Bacteria | 1604 |
| 392 | Ga0501079_0000029 | 3300049741 | Bacteria | 60538 |
| 393 | Ga0501080_0002688 | 3300049742 | Bacteria | 15576 |
| 394 | Ga0501080_0003657 | 3300049742 | Bacteria | 13569 |
| 395 | Ga0501080_0035713 | 3300049742 | Bacteria | 4640 |
| 396 | Ga0501080_0076972 | 3300049742 | Bacteria | 3102 |
| 397 | Ga0501080_0096997 | 3300049742 | Bacteria | 2737 |
| 398 | Ga0501081_0029043 | 3300049743 | Bacteria | 3735 |
| 399 | Ga0501035_0055060 | 3300049822 | Bacteria | 3552 |
| 400 | Ga0501035_0062522 | 3300049822 | Bacteria | 3313 |
| 401 | Ga0501035_0131803 | 3300049822 | Bacteria | 2178 |
| 402 | Ga0501044_0002655 | 3300049823 | Bacteria | 20338 |
| 403 | Ga0501044_0040078 | 3300049823 | Bacteria | 4884 |
| 404 | Ga0501044_0063753 | 3300049823 | Bacteria | 3763 |
| 405 | Ga0501044_0073502 | 3300049823 | Bacteria | 3475 |
| 406 | Ga0501045_0011211 | 3300049824 | Bacteria | 6288 |
| 407 | Ga0501045_0085032 | 3300049824 | Bacteria | 2334 |
| 408 | nmdc:mga00v17_162193_c1 | 3300050491 | Bacteria | 1439 |
| 409 | nmdc:mga00v17_42584_c1 | 3300050491 | Bacteria | 2732 |
| 410 | nmdc:mga06r32_442039_c1 | 3300050510 | Bacteria | 1280 |
| 411 | nmdc:mga08y16_275542_c1 | 3300050511 | Bacteria | 1736 |
| 412 | nmdc:mga0rr50_117988_c1 | 3300050513 | Bacteria | 2108 |
| 413 | nmdc:mga08x19_44646_c1 | 3300050514 | Bacteria | 2830 |
| 414 | nmdc:mga0a205_133915_c1 | 3300050515 | Bacteria | 2379 |
| 415 | nmdc:mga0sz30_1287_c2 | 3300050516 | Bacteria | 4266 |
| 416 | Ga0500594_0009201 | 3300053118 | Bacteria | 2269 |
| 417 | Ga0500642_0005837 | 3300053130 | Bacteria | 4006 |
| 418 | Ga0500652_021611 | 3300053131 | Bacteria | 2426 |
| 419 | Ga0500568_0000585 | 3300053139 | Bacteria | 26473 |
| 420 | Ga0500579_099760 | 3300053143 | Bacteria | 1520 |
| 421 | Ga0501084_0020015 | 3300054114 | Bacteria | 5579 |
| 422 | Ga0501082_0092821 | 3300060353 | Bacteria | 2608 |
| 423 | Ga0466962_0002002 | 3300061719 | Bacteria | 9625 |
| 424 | Ga0466962_0003681 | 3300061719 | Bacteria | 7305 |
| 425 | Ga0466962_0006111 | 3300061719 | Bacteria | 5788 |
| 426 | Ga0466962_0014701 | 3300061719 | Bacteria | 3773 |
| 427 | Ga0530510_0047767 | 3300061734 | Bacteria | 3093 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026088 | Ga0207641_10378103 | Ga0207641_103781031 | 353 |
| 2 | 3300044683 | Ga0466965_0050608 | Ga0466965_0050608_188_1360 | 354 |
| 3 | 3300050491 | nmdc:mga00v17_162193_c1 | nmdc:mga00v17_162193_c1_194_1372 | 354 |
| 4 | 3300005564 | Ga0070664_100118852 | Ga0070664_1001188522 | 355 |
| 5 | 3300025945 | Ga0207679_10011518 | Ga0207679_100115185 | 355 |
| 6 | 3300049568 | Ga0501031_0111474 | Ga0501031_0111474_609_1763 | 356 |
| 7 | 3300021388 | Ga0213875_10013606 | Ga0213875_100136063 | 357 |
| 8 | 3300037853 | Ga0436364_0012131 | Ga0436364_0012131_1424_2530 | 357 |
| 9 | 3300044683 | Ga0466965_0062623 | Ga0466965_0062623_113_1282 | 357 |
| 10 | 3300026075 | Ga0207708_10015379 | Ga0207708_100153795 | 358 |
| 11 | 3300049569 | Ga0501032_0014525 | Ga0501032_0014525_3063_4247 | 358 |
| 12 | 3300049572 | Ga0501036_0006857 | Ga0501036_0006857_4743_5927 | 358 |
| 13 | 3300049574 | Ga0501038_0059180 | Ga0501038_0059180_1540_2724 | 358 |
| 14 | 3300049576 | Ga0501040_0007809 | Ga0501040_0007809_3905_5089 | 358 |
| 15 | 3300049577 | Ga0501041_0027687 | Ga0501041_0027687_2068_3252 | 358 |
| 16 | 3300049578 | Ga0501042_0000616 | Ga0501042_0000616_12641_13825 | 358 |
| 17 | 3300049579 | Ga0501043_0210997 | Ga0501043_0210997_163_1347 | 358 |
| 18 | 3300049580 | Ga0501046_0063133 | Ga0501046_0063133_78_1262 | 358 |
| 19 | 3300049582 | Ga0501048_0006807 | Ga0501048_0006807_3250_4434 | 358 |
| 20 | 3300049584 | Ga0501068_0058567 | Ga0501068_0058567_856_2040 | 358 |
| 21 | 3300049587 | Ga0501071_0009431 | Ga0501071_0009431_1864_3048 | 358 |
| 22 | 3300049588 | Ga0501072_0196576 | Ga0501072_0196576_188_1372 | 358 |
| 23 | 3300049592 | Ga0501076_0013326 | Ga0501076_0013326_4813_5997 | 358 |
| 24 | 3300049593 | Ga0501077_0081650 | Ga0501077_0081650_688_1872 | 358 |
| 25 | 3300049742 | Ga0501080_0096997 | Ga0501080_0096997_1227_2411 | 358 |
| 26 | 3300049743 | Ga0501081_0029043 | Ga0501081_0029043_853_2037 | 358 |
| 27 | 3300049822 | Ga0501035_0062522 | Ga0501035_0062522_2066_3250 | 358 |
| 28 | 3300049824 | Ga0501045_0011211 | Ga0501045_0011211_1157_2341 | 358 |
| 29 | 3300054114 | Ga0501084_0020015 | Ga0501084_0020015_1205_2389 | 358 |
| 30 | 3300061734 | Ga0530510_0047767 | Ga0530510_0047767_659_1843 | 358 |
| 31 | 3300028794 | Ga0307515_10026270 | Ga0307515_100262706 | 359 |
| 32 | 3300044719 | Ga0466971_0125383 | Ga0466971_0125383_70_1173 | 360 |
| 33 | 3300049569 | Ga0501032_0064849 | Ga0501032_0064849_787_1932 | 362 |
| 34 | 3300039447 | Ga0436361_1044359 | Ga0436361_1044359_1241_2386 | 363 |
| 35 | iso_pu_bacteria | 2582581312 | 2585301421 | 364 |
| 36 | iso_pu_bacteria | 2582581313 | 2585310360 | 364 |
| 37 | iso_pu_bacteria | 2616644941 | 2616905009 | 364 |
| 38 | iso_pu_bacteria | 2643221678 | 2644436850 | 364 |
| 39 | iso_pu_bacteria | 2643221714 | 2644628589 | 364 |
| 40 | iso_pu_bacteria | 2808606359 | 2808841746 | 364 |
| 41 | iso_pu_bacteria | 2818991463 | 2819697808 | 364 |
| 42 | iso_pu_bacteria | 2946072368 | 2946075631 | 364 |
| 43 | 3300046462 | Ga0495651_0089836 | Ga0495651_0089836_1117_2274 | 365 |
| 44 | 3300049592 | Ga0501076_0019568 | Ga0501076_0019568_1001_2107 | 366 |
| 45 | 3300049593 | Ga0501077_0031641 | Ga0501077_0031641_1658_2764 | 366 |
| 46 | 3300049593 | Ga0501077_0128787 | Ga0501077_0128787_90_1262 | 366 |
| 47 | 3300049824 | Ga0501045_0085032 | Ga0501045_0085032_355_1461 | 366 |
| 48 | 3300053130 | Ga0500642_0005837 | Ga0500642_0005837_167_1324 | 366 |
| 49 | 3300060353 | Ga0501082_0092821 | Ga0501082_0092821_466_1572 | 366 |
| 50 | iso_pu_bacteria | 2894772417 | 2894776895 | 366 |
| 51 | 3300005543 | Ga0070672_100000632 | Ga0070672_10000063218 | 367 |
| 52 | 3300006847 | Ga0075431_100480096 | Ga0075431_1004800961 | 367 |
| 53 | 3300009098 | Ga0105245_10003879 | Ga0105245_100038792 | 367 |
| 54 | 3300020082 | Ga0206353_10093504 | Ga0206353_100935042 | 367 |
| 55 | 3300021388 | Ga0213875_10000488 | Ga0213875_1000048835 | 367 |
| 56 | 3300026116 | Ga0207674_10424203 | Ga0207674_104242031 | 367 |
| 57 | 3300031456 | Ga0307513_10059804 | Ga0307513_100598044 | 367 |
| 58 | 3300031824 | Ga0307413_10002072 | Ga0307413_100020726 | 367 |
| 59 | 3300037853 | Ga0436364_0132601 | Ga0436364_0132601_21557_22687 | 367 |
| 60 | 3300044658 | Ga0466972_0014209 | Ga0466972_0014209_79_1239 | 367 |
| 61 | 3300044684 | Ga0466966_0001727 | Ga0466966_0001727_7401_8531 | 367 |
| 62 | 3300044694 | Ga0466963_0000918 | Ga0466963_0000918_11771_12901 | 367 |
| 63 | 3300044719 | Ga0466971_0000394 | Ga0466971_0000394_15091_16221 | 367 |
| 64 | 3300044765 | Ga0466970_0009592 | Ga0466970_0009592_810_1940 | 367 |
| 65 | 3300044765 | Ga0466970_0045317 | Ga0466970_0045317_688_1848 | 367 |
| 66 | 3300044842 | Ga0466957_0016231 | Ga0466957_0016231_3083_4243 | 367 |
| 67 | 3300044842 | Ga0466957_0029443 | Ga0466957_0029443_1494_2624 | 367 |
| 68 | 3300045049 | Ga0466959_0003768 | Ga0466959_0003768_7254_8384 | 367 |
| 69 | 3300045049 | Ga0466959_0022226 | Ga0466959_0022226_2603_3763 | 367 |
| 70 | 3300045836 | Ga0466958_0006242 | Ga0466958_0006242_3888_5018 | 367 |
| 71 | 3300045976 | Ga0466967_0051360 | Ga0466967_0051360_590_1720 | 367 |
| 72 | 3300049823 | Ga0501044_0002655 | Ga0501044_0002655_22_1143 | 367 |
| 73 | 3300050510 | nmdc:mga06r32_442039_c1 | nmdc:mga06r32_442039_c1_72_1217 | 367 |
| 74 | 3300061719 | Ga0466962_0002002 | Ga0466962_0002002_1160_2290 | 367 |
| 75 | iso_pu_bacteria | 2506783011 | 2506866682 | 367 |
| 76 | iso_pu_bacteria | 2773857933 | 2774904234 | 367 |
| 77 | iso_pu_bacteria | 2795385472 | 2795796414 | 367 |
| 78 | 3300001989 | JGI24739J22299_10029109 | JGI24739J22299_100291091 | 368 |
| 79 | 3300001990 | JGI24737J22298_10017734 | JGI24737J22298_100177342 | 368 |
| 80 | 3300002075 | JGI24738J21930_10010025 | JGI24738J21930_100100252 | 368 |
| 81 | 3300003578 | Ga0006562J51391_1076718 | Ga0006562J51391_10767183 | 368 |
| 82 | 3300005327 | Ga0070658_10000934 | Ga0070658_100009348 | 368 |
| 83 | 3300005327 | Ga0070658_10001118 | Ga0070658_1000111811 | 368 |
| 84 | 3300005327 | Ga0070658_10093471 | Ga0070658_100934712 | 368 |
| 85 | 3300005327 | Ga0070658_10157161 | Ga0070658_101571611 | 368 |
| 86 | 3300005335 | Ga0070666_10004238 | Ga0070666_100042385 | 368 |
| 87 | 3300005336 | Ga0070680_100000019 | Ga0070680_10000001942 | 368 |
| 88 | 3300005336 | Ga0070680_100004789 | Ga0070680_1000047894 | 368 |
| 89 | 3300005336 | Ga0070680_100048064 | Ga0070680_1000480642 | 368 |
| 90 | 3300005338 | Ga0068868_100017712 | Ga0068868_1000177123 | 368 |
| 91 | 3300005339 | Ga0070660_100029363 | Ga0070660_1000293632 | 368 |
| 92 | 3300005339 | Ga0070660_100057584 | Ga0070660_1000575842 | 368 |
| 93 | 3300005341 | Ga0070691_10024569 | Ga0070691_100245694 | 368 |
| 94 | 3300005347 | Ga0070668_100000611 | Ga0070668_1000006112 | 368 |
| 95 | 3300005356 | Ga0070674_100012722 | Ga0070674_1000127224 | 368 |
| 96 | 3300005366 | Ga0070659_100000513 | Ga0070659_1000005132 | 368 |
| 97 | 3300005366 | Ga0070659_100046241 | Ga0070659_1000462412 | 368 |
| 98 | 3300005367 | Ga0070667_100000572 | Ga0070667_10000057213 | 368 |
| 99 | 3300005438 | Ga0070701_10004658 | Ga0070701_100046585 | 368 |
| 100 | 3300005455 | Ga0070663_100017669 | Ga0070663_1000176693 | 368 |
| 101 | 3300005455 | Ga0070663_100282617 | Ga0070663_1002826171 | 368 |
| 102 | 3300005457 | Ga0070662_100101126 | Ga0070662_1001011262 | 368 |
| 103 | 3300005458 | Ga0070681_10000017 | Ga0070681_1000001750 | 368 |
| 104 | 3300005458 | Ga0070681_10002068 | Ga0070681_100020683 | 368 |
| 105 | 3300005458 | Ga0070681_10043507 | Ga0070681_100435072 | 368 |
| 106 | 3300005530 | Ga0070679_100000009 | Ga0070679_10000000966 | 368 |
| 107 | 3300005530 | Ga0070679_100002893 | Ga0070679_1000028937 | 368 |
| 108 | 3300005530 | Ga0070679_100050208 | Ga0070679_1000502082 | 368 |
| 109 | 3300005530 | Ga0070679_100248811 | Ga0070679_1002488111 | 368 |
| 110 | 3300005547 | Ga0070693_100009333 | Ga0070693_1000093332 | 368 |
| 111 | 3300005548 | Ga0070665_100014771 | Ga0070665_1000147713 | 368 |
| 112 | 3300005563 | Ga0068855_100005045 | Ga0068855_1000050454 | 368 |
| 113 | 3300005563 | Ga0068855_100046486 | Ga0068855_1000464864 | 368 |
| 114 | 3300005563 | Ga0068855_100210198 | Ga0068855_1002101982 | 368 |
| 115 | 3300005578 | Ga0068854_100002147 | Ga0068854_10000214716 | 368 |
| 116 | 3300005614 | Ga0068856_100044268 | Ga0068856_1000442683 | 368 |
| 117 | 3300005615 | Ga0070702_100018627 | Ga0070702_1000186273 | 368 |
| 118 | 3300005618 | Ga0068864_100006230 | Ga0068864_1000062305 | 368 |
| 119 | 3300005841 | Ga0068863_100009275 | Ga0068863_1000092753 | 368 |
| 120 | 3300005841 | Ga0068863_100012826 | Ga0068863_1000128265 | 368 |
| 121 | 3300005841 | Ga0068863_100324979 | Ga0068863_1003249791 | 368 |
| 122 | 3300005842 | Ga0068858_100340414 | Ga0068858_1003404142 | 368 |
| 123 | 3300005844 | Ga0068862_100114714 | Ga0068862_1001147142 | 368 |
| 124 | 3300005937 | Ga0081455_10004069 | Ga0081455_100040692 | 368 |
| 125 | 3300005983 | Ga0081540_1011841 | Ga0081540_10118413 | 368 |
| 126 | 3300005983 | Ga0081540_1015359 | Ga0081540_10153593 | 368 |
| 127 | 3300005985 | Ga0081539_10020927 | Ga0081539_100209272 | 368 |
| 128 | 3300006028 | Ga0070717_10004332 | Ga0070717_100043325 | 368 |
| 129 | 3300006051 | Ga0075364_10192462 | Ga0075364_101924621 | 368 |
| 130 | 3300006173 | Ga0070716_100003625 | Ga0070716_1000036254 | 368 |
| 131 | 3300006175 | Ga0070712_100004630 | Ga0070712_1000046305 | 368 |
| 132 | 3300006178 | Ga0075367_10047181 | Ga0075367_100471811 | 368 |
| 133 | 3300006186 | Ga0075369_10022754 | Ga0075369_100227542 | 368 |
| 134 | 3300006353 | Ga0075370_10096483 | Ga0075370_100964832 | 368 |
| 135 | 3300006358 | Ga0068871_100080031 | Ga0068871_1000800312 | 368 |
| 136 | 3300006852 | Ga0075433_10018196 | Ga0075433_100181965 | 368 |
| 137 | 3300006871 | Ga0075434_100040744 | Ga0075434_1000407445 | 368 |
| 138 | 3300006914 | Ga0075436_100043423 | Ga0075436_1000434232 | 368 |
| 139 | 3300009011 | Ga0105251_10082056 | Ga0105251_100820561 | 368 |
| 140 | 3300009093 | Ga0105240_10070915 | Ga0105240_100709153 | 368 |
| 141 | 3300009094 | Ga0111539_10325130 | Ga0111539_103251302 | 368 |
| 142 | 3300009094 | Ga0111539_10361281 | Ga0111539_103612812 | 368 |
| 143 | 3300009098 | Ga0105245_10019189 | Ga0105245_100191893 | 368 |
| 144 | 3300009101 | Ga0105247_10021611 | Ga0105247_100216113 | 368 |
| 145 | 3300009147 | Ga0114129_10139498 | Ga0114129_101394983 | 368 |
| 146 | 3300009174 | Ga0105241_10005291 | Ga0105241_100052917 | 368 |
| 147 | 3300009545 | Ga0105237_10038129 | Ga0105237_100381292 | 368 |
| 148 | 3300009545 | Ga0105237_10138838 | Ga0105237_101388383 | 368 |
| 149 | 3300009551 | Ga0105238_10004485 | Ga0105238_1000448517 | 368 |
| 150 | 3300009553 | Ga0105249_10000071 | Ga0105249_100000715 | 368 |
| 151 | 3300010375 | Ga0105239_10057835 | Ga0105239_100578355 | 368 |
| 152 | 3300011119 | Ga0105246_10003955 | Ga0105246_100039557 | 368 |
| 153 | 3300011119 | Ga0105246_10008917 | Ga0105246_100089172 | 368 |
| 154 | 3300013102 | Ga0157371_10015230 | Ga0157371_100152304 | 368 |
| 155 | 3300013105 | Ga0157369_10001900 | Ga0157369_1000190017 | 368 |
| 156 | 3300013105 | Ga0157369_10014807 | Ga0157369_100148072 | 368 |
| 157 | 3300013105 | Ga0157369_10033647 | Ga0157369_100336472 | 368 |
| 158 | 3300013296 | Ga0157374_10010283 | Ga0157374_100102832 | 368 |
| 159 | 3300013296 | Ga0157374_10059500 | Ga0157374_100595002 | 368 |
| 160 | 3300013297 | Ga0157378_10217011 | Ga0157378_102170111 | 368 |
| 161 | 3300013306 | Ga0163162_10198178 | Ga0163162_101981782 | 368 |
| 162 | 3300013307 | Ga0157372_10051578 | Ga0157372_100515784 | 368 |
| 163 | 3300013307 | Ga0157372_10228800 | Ga0157372_102288002 | 368 |
| 164 | 3300013308 | Ga0157375_10025882 | Ga0157375_100258824 | 368 |
| 165 | 3300013308 | Ga0157375_10126492 | Ga0157375_101264924 | 368 |
| 166 | 3300014325 | Ga0163163_10115307 | Ga0163163_101153072 | 368 |
| 167 | 3300014325 | Ga0163163_10124564 | Ga0163163_101245643 | 368 |
| 168 | 3300014326 | Ga0157380_10012667 | Ga0157380_100126674 | 368 |
| 169 | 3300014968 | Ga0157379_10017300 | Ga0157379_100173004 | 368 |
| 170 | 3300015262 | Ga0182007_10003191 | Ga0182007_100031916 | 368 |
| 171 | 3300017792 | Ga0163161_10003978 | Ga0163161_100039786 | 368 |
| 172 | 3300020081 | Ga0206354_10948830 | Ga0206354_109488302 | 368 |
| 173 | 3300020082 | Ga0206353_10014688 | Ga0206353_1001468810 | 368 |
| 174 | 3300021384 | Ga0213876_10001920 | Ga0213876_100019203 | 368 |
| 175 | 3300022467 | Ga0224712_10012606 | Ga0224712_100126061 | 368 |
| 176 | 3300025297 | Ga0209758_1001238 | Ga0209758_10012384 | 368 |
| 177 | 3300025302 | Ga0207426_1038906 | Ga0207426_10389061 | 368 |
| 178 | 3300025898 | Ga0207692_10043440 | Ga0207692_100434403 | 368 |
| 179 | 3300025899 | Ga0207642_10025832 | Ga0207642_100258322 | 368 |
| 180 | 3300025900 | Ga0207710_10029668 | Ga0207710_100296682 | 368 |
| 181 | 3300025901 | Ga0207688_10009843 | Ga0207688_100098435 | 368 |
| 182 | 3300025903 | Ga0207680_10037694 | Ga0207680_100376943 | 368 |
| 183 | 3300025904 | Ga0207647_10005937 | Ga0207647_1000593710 | 368 |
| 184 | 3300025904 | Ga0207647_10016783 | Ga0207647_100167834 | 368 |
| 185 | 3300025904 | Ga0207647_10038860 | Ga0207647_100388603 | 368 |
| 186 | 3300025904 | Ga0207647_10049496 | Ga0207647_100494963 | 368 |
| 187 | 3300025906 | Ga0207699_10016727 | Ga0207699_100167274 | 368 |
| 188 | 3300025909 | Ga0207705_10000251 | Ga0207705_1000025112 | 368 |
| 189 | 3300025909 | Ga0207705_10013887 | Ga0207705_100138872 | 368 |
| 190 | 3300025909 | Ga0207705_10062078 | Ga0207705_100620783 | 368 |
| 191 | 3300025911 | Ga0207654_10018748 | Ga0207654_100187484 | 368 |
| 192 | 3300025911 | Ga0207654_10023503 | Ga0207654_100235033 | 368 |
| 193 | 3300025912 | Ga0207707_10000257 | Ga0207707_1000025751 | 368 |
| 194 | 3300025912 | Ga0207707_10005505 | Ga0207707_100055056 | 368 |
| 195 | 3300025912 | Ga0207707_10038148 | Ga0207707_100381484 | 368 |
| 196 | 3300025912 | Ga0207707_10038344 | Ga0207707_100383445 | 368 |
| 197 | 3300025913 | Ga0207695_10002866 | Ga0207695_1000286623 | 368 |
| 198 | 3300025914 | Ga0207671_10003461 | Ga0207671_100034614 | 368 |
| 199 | 3300025915 | Ga0207693_10004630 | Ga0207693_100046305 | 368 |
| 200 | 3300025917 | Ga0207660_10053286 | Ga0207660_100532862 | 368 |
| 201 | 3300025919 | Ga0207657_10003612 | Ga0207657_100036128 | 368 |
| 202 | 3300025919 | Ga0207657_10031676 | Ga0207657_100316762 | 368 |
| 203 | 3300025921 | Ga0207652_10000124 | Ga0207652_100001248 | 368 |
| 204 | 3300025921 | Ga0207652_10001683 | Ga0207652_1000168312 | 368 |
| 205 | 3300025921 | Ga0207652_10055536 | Ga0207652_100555363 | 368 |
| 206 | 3300025921 | Ga0207652_10210899 | Ga0207652_102108991 | 368 |
| 207 | 3300025927 | Ga0207687_10009837 | Ga0207687_100098376 | 368 |
| 208 | 3300025932 | Ga0207690_10000189 | Ga0207690_1000018931 | 368 |
| 209 | 3300025935 | Ga0207709_10020090 | Ga0207709_100200903 | 368 |
| 210 | 3300025935 | Ga0207709_10090588 | Ga0207709_100905882 | 368 |
| 211 | 3300025939 | Ga0207665_10000738 | Ga0207665_100007385 | 368 |
| 212 | 3300025942 | Ga0207689_10094796 | Ga0207689_100947962 | 368 |
| 213 | 3300025949 | Ga0207667_10053160 | Ga0207667_100531604 | 368 |
| 214 | 3300025949 | Ga0207667_10067772 | Ga0207667_100677725 | 368 |
| 215 | 3300025961 | Ga0207712_10000028 | Ga0207712_100000285 | 368 |
| 216 | 3300025961 | Ga0207712_10070906 | Ga0207712_100709062 | 368 |
| 217 | 3300025972 | Ga0207668_10002350 | Ga0207668_100023502 | 368 |
| 218 | 3300025972 | Ga0207668_10064913 | Ga0207668_100649132 | 368 |
| 219 | 3300025981 | Ga0207640_10270389 | Ga0207640_102703891 | 368 |
| 220 | 3300025986 | Ga0207658_10000505 | Ga0207658_1000050532 | 368 |
| 221 | 3300026035 | Ga0207703_10033005 | Ga0207703_100330053 | 368 |
| 222 | 3300026041 | Ga0207639_10169003 | Ga0207639_101690031 | 368 |
| 223 | 3300026067 | Ga0207678_10305255 | Ga0207678_103052551 | 368 |
| 224 | 3300026088 | Ga0207641_10000845 | Ga0207641_100008453 | 368 |
| 225 | 3300026088 | Ga0207641_10032352 | Ga0207641_100323523 | 368 |
| 226 | 3300026121 | Ga0207683_10003061 | Ga0207683_1000306110 | 368 |
| 227 | 3300027907 | Ga0207428_10135032 | Ga0207428_101350322 | 368 |
| 228 | 3300028380 | Ga0268265_10133199 | Ga0268265_101331991 | 368 |
| 229 | 3300028381 | Ga0268264_10164235 | Ga0268264_101642352 | 368 |
| 230 | 3300028381 | Ga0268264_10177119 | Ga0268264_101771192 | 368 |
| 231 | 3300028794 | Ga0307515_10000668 | Ga0307515_1000066813 | 368 |
| 232 | 3300028794 | Ga0307515_10001363 | Ga0307515_100013635 | 368 |
| 233 | 3300028794 | Ga0307515_10052431 | Ga0307515_100524312 | 368 |
| 234 | 3300028794 | Ga0307515_10087152 | Ga0307515_100871523 | 368 |
| 235 | 3300028800 | Ga0265338_10003387 | Ga0265338_100033877 | 368 |
| 236 | 3300030521 | Ga0307511_10121231 | Ga0307511_101212311 | 368 |
| 237 | 3300030522 | Ga0307512_10001051 | Ga0307512_100010519 | 368 |
| 238 | 3300030522 | Ga0307512_10006458 | Ga0307512_100064583 | 368 |
| 239 | 3300030522 | Ga0307512_10051898 | Ga0307512_100518983 | 368 |
| 240 | 3300031247 | Ga0265340_10001511 | Ga0265340_1000151110 | 368 |
| 241 | 3300031249 | Ga0265339_10008228 | Ga0265339_100082286 | 368 |
| 242 | 3300031251 | Ga0265327_10001829 | Ga0265327_100018295 | 368 |
| 243 | 3300031456 | Ga0307513_10003078 | Ga0307513_1000307816 | 368 |
| 244 | 3300031507 | Ga0307509_10028031 | Ga0307509_100280315 | 368 |
| 245 | 3300031616 | Ga0307508_10002592 | Ga0307508_1000259213 | 368 |
| 246 | 3300031616 | Ga0307508_10007204 | Ga0307508_100072046 | 368 |
| 247 | 3300031616 | Ga0307508_10146082 | Ga0307508_101460822 | 368 |
| 248 | 3300031727 | Ga0316576_10028560 | Ga0316576_100285603 | 368 |
| 249 | 3300031730 | Ga0307516_10082464 | Ga0307516_100824641 | 368 |
| 250 | 3300031852 | Ga0307410_10020808 | Ga0307410_100208083 | 368 |
| 251 | 3300033179 | Ga0307507_10122857 | Ga0307507_101228572 | 368 |
| 252 | 3300034957 | Ga0373938_0007309 | Ga0373938_0007309_558_1733 | 368 |
| 253 | 3300035084 | Ga0373928_0009856 | Ga0373928_0009856_45_1220 | 368 |
| 254 | 3300035085 | Ga0373929_0001942 | Ga0373929_0001942_62_1237 | 368 |
| 255 | 3300035088 | Ga0373940_0003760 | Ga0373940_0003760_55_1209 | 368 |
| 256 | 3300035091 | Ga0373951_0000053 | Ga0373951_0000053_29489_30643 | 368 |
| 257 | 3300035091 | Ga0373951_0015601 | Ga0373951_0015601_291_1466 | 368 |
| 258 | 3300035114 | Ga0373939_0006560 | Ga0373939_0006560_62_1237 | 368 |
| 259 | 3300035207 | Ga0373942_0002341 | Ga0373942_0002341_495_1649 | 368 |
| 260 | 3300035207 | Ga0373942_0002925 | Ga0373942_0002925_107_1282 | 368 |
| 261 | 3300035242 | Ga0373962_0013841 | Ga0373962_0013841_287_1441 | 368 |
| 262 | 3300035398 | Ga0316574_0026309 | Ga0316574_0026309_2114_3271 | 368 |
| 263 | 3300035691 | Ga0373931_0041702 | Ga0373931_0041702_827_2002 | 368 |
| 264 | 3300036712 | Ga0316584_0088862 | Ga0316584_0088862_764_1921 | 368 |
| 265 | 3300037312 | Ga0395899_0211418 | Ga0395899_0211418_165_1298 | 368 |
| 266 | 3300037466 | Ga0395898_0019341 | Ga0395898_0019341_5609_6766 | 368 |
| 267 | 3300037466 | Ga0395898_0073711 | Ga0395898_0073711_164_1333 | 368 |
| 268 | 3300039437 | Ga0436365_1454613 | Ga0436365_1454613_16013_17191 | 368 |
| 269 | 3300039450 | Ga0436363_1202288 | Ga0436363_1202288_837_2006 | 368 |
| 270 | 3300041411 | Ga0439466_0002013 | Ga0439466_0002013_1894_3054 | 368 |
| 271 | 3300041997 | Ga0439431_0016174 | Ga0439431_0016174_566_1726 | 368 |
| 272 | 3300042004 | Ga0439445_0006588 | Ga0439445_0006588_73_1233 | 368 |
| 273 | 3300042004 | Ga0439445_0012073 | Ga0439445_0012073_129_1292 | 368 |
| 274 | 3300042007 | Ga0439449_0002617 | Ga0439449_0002617_3677_4834 | 368 |
| 275 | 3300044656 | Ga0466969_0000846 | Ga0466969_0000846_6604_7755 | 368 |
| 276 | 3300044656 | Ga0466969_0009134 | Ga0466969_0009134_2277_3434 | 368 |
| 277 | 3300044656 | Ga0466969_0038869 | Ga0466969_0038869_878_2035 | 368 |
| 278 | 3300044658 | Ga0466972_0009994 | Ga0466972_0009994_1984_3141 | 368 |
| 279 | 3300044658 | Ga0466972_0017379 | Ga0466972_0017379_1743_2900 | 368 |
| 280 | 3300044658 | Ga0466972_0102979 | Ga0466972_0102979_98_1255 | 368 |
| 281 | 3300044683 | Ga0466965_0002082 | Ga0466965_0002082_6942_8099 | 368 |
| 282 | 3300044683 | Ga0466965_0012273 | Ga0466965_0012273_331_1488 | 368 |
| 283 | 3300044684 | Ga0466966_0003063 | Ga0466966_0003063_4814_5971 | 368 |
| 284 | 3300044684 | Ga0466966_0005284 | Ga0466966_0005284_5705_6856 | 368 |
| 285 | 3300044693 | Ga0466961_0003182 | Ga0466961_0003182_4820_5977 | 368 |
| 286 | 3300044693 | Ga0466961_0008823 | Ga0466961_0008823_5249_6415 | 368 |
| 287 | 3300044693 | Ga0466961_0013620 | Ga0466961_0013620_602_1777 | 368 |
| 288 | 3300044693 | Ga0466961_0030248 | Ga0466961_0030248_1865_3034 | 368 |
| 289 | 3300044693 | Ga0466961_0033501 | Ga0466961_0033501_1253_2422 | 368 |
| 290 | 3300044693 | Ga0466961_0178762 | Ga0466961_0178762_108_1277 | 368 |
| 291 | 3300044694 | Ga0466963_0004229 | Ga0466963_0004229_763_1920 | 368 |
| 292 | 3300044694 | Ga0466963_0076383 | Ga0466963_0076383_438_1607 | 368 |
| 293 | 3300044719 | Ga0466971_0002502 | Ga0466971_0002502_4835_6010 | 368 |
| 294 | 3300044719 | Ga0466971_0005752 | Ga0466971_0005752_2631_3788 | 368 |
| 295 | 3300044765 | Ga0466970_0001367 | Ga0466970_0001367_7184_8290 | 368 |
| 296 | 3300044765 | Ga0466970_0009534 | Ga0466970_0009534_3007_4164 | 368 |
| 297 | 3300044765 | Ga0466970_0030900 | Ga0466970_0030900_551_1708 | 368 |
| 298 | 3300044842 | Ga0466957_0013876 | Ga0466957_0013876_1767_2930 | 368 |
| 299 | 3300044842 | Ga0466957_0025933 | Ga0466957_0025933_2170_3327 | 368 |
| 300 | 3300044842 | Ga0466957_0085446 | Ga0466957_0085446_561_1718 | 368 |
| 301 | 3300044901 | Ga0466960_0003863 | Ga0466960_0003863_508_1665 | 368 |
| 302 | 3300044901 | Ga0466960_0048841 | Ga0466960_0048841_819_1976 | 368 |
| 303 | 3300045049 | Ga0466959_0062851 | Ga0466959_0062851_1345_2502 | 368 |
| 304 | 3300045049 | Ga0466959_0158963 | Ga0466959_0158963_11_1162 | 368 |
| 305 | 3300045836 | Ga0466958_0006001 | Ga0466958_0006001_5085_6242 | 368 |
| 306 | 3300045836 | Ga0466958_0032433 | Ga0466958_0032433_239_1408 | 368 |
| 307 | 3300045836 | Ga0466958_0068668 | Ga0466958_0068668_10_1185 | 368 |
| 308 | 3300045836 | Ga0466958_0093686 | Ga0466958_0093686_50_1159 | 368 |
| 309 | 3300045836 | Ga0466958_0127562 | Ga0466958_0127562_358_1515 | 368 |
| 310 | 3300045976 | Ga0466967_0018994 | Ga0466967_0018994_1281_2438 | 368 |
| 311 | 3300045976 | Ga0466967_0029072 | Ga0466967_0029072_2888_4045 | 368 |
| 312 | 3300045976 | Ga0466967_0032778 | Ga0466967_0032778_2256_3431 | 368 |
| 313 | 3300045976 | Ga0466967_0033369 | Ga0466967_0033369_1183_2355 | 368 |
| 314 | 3300045976 | Ga0466967_0083055 | Ga0466967_0083055_730_1884 | 368 |
| 315 | 3300045976 | Ga0466967_0110410 | Ga0466967_0110410_778_1935 | 368 |
| 316 | 3300045976 | Ga0466967_0237208 | Ga0466967_0237208_112_1284 | 368 |
| 317 | 3300045976 | Ga0466967_0352950 | Ga0466967_0352950_224_1393 | 368 |
| 318 | 3300046454 | Ga0495592_0003573 | Ga0495592_0003573_51_1208 | 368 |
| 319 | 3300046455 | Ga0495603_0002583 | Ga0495603_0002583_6296_7453 | 368 |
| 320 | 3300046459 | Ga0495629_0000935 | Ga0495629_0000935_5472_6629 | 368 |
| 321 | 3300046459 | Ga0495629_0016409 | Ga0495629_0016409_4129_5286 | 368 |
| 322 | 3300046460 | Ga0495638_0161869 | Ga0495638_0161869_140_1246 | 368 |
| 323 | 3300046473 | Ga0495582_0165582 | Ga0495582_0165582_56_1228 | 368 |
| 324 | 3300046475 | Ga0495639_0115322 | Ga0495639_0115322_92_1255 | 368 |
| 325 | 3300046499 | Ga0495594_0000163 | Ga0495594_0000163_26361_27518 | 368 |
| 326 | 3300046514 | Ga0495618_0126629 | Ga0495618_0126629_442_1599 | 368 |
| 327 | 3300046516 | Ga0495628_0070054 | Ga0495628_0070054_911_2068 | 368 |
| 328 | 3300046519 | Ga0495632_0038855 | Ga0495632_0038855_1185_2339 | 368 |
| 329 | 3300046526 | Ga0495666_0088144 | Ga0495666_0088144_62_1237 | 368 |
| 330 | 3300046529 | Ga0495652_0017946 | Ga0495652_0017946_601_1758 | 368 |
| 331 | 3300046533 | Ga0495640_0009935 | Ga0495640_0009935_5825_6982 | 368 |
| 332 | 3300046557 | Ga0495622_0006021 | Ga0495622_0006021_853_2010 | 368 |
| 333 | 3300046558 | Ga0495633_0078038 | Ga0495633_0078038_45_1202 | 368 |
| 334 | 3300046642 | Ga0495634_0001735 | Ga0495634_0001735_8430_9587 | 368 |
| 335 | 3300046674 | Ga0495588_0002102 | Ga0495588_0002102_7346_8503 | 368 |
| 336 | 3300046675 | Ga0495657_0020317 | Ga0495657_0020317_2180_3337 | 368 |
| 337 | 3300046689 | Ga0495613_0038905 | Ga0495613_0038905_2293_3450 | 368 |
| 338 | 3300047315 | Ga0495581_0063805 | Ga0495581_0063805_944_2101 | 368 |
| 339 | 3300047321 | Ga0495676_0003711 | Ga0495676_0003711_12359_13516 | 368 |
| 340 | 3300047321 | Ga0495676_0073916 | Ga0495676_0073916_499_1674 | 368 |
| 341 | 3300047443 | Ga0495687_011713 | Ga0495687_011713_1628_2785 | 368 |
| 342 | 3300048903 | Ga0496100_0000585 | Ga0496100_0000585_1229_2398 | 368 |
| 343 | 3300048903 | Ga0496100_0041670 | Ga0496100_0041670_1083_2258 | 368 |
| 344 | 3300048904 | Ga0496101_0000032 | Ga0496101_0000032_67754_68890 | 368 |
| 345 | 3300048904 | Ga0496101_0009524 | Ga0496101_0009524_4048_5205 | 368 |
| 346 | 3300048904 | Ga0496101_0094305 | Ga0496101_0094305_286_1461 | 368 |
| 347 | 3300048905 | Ga0496102_0000127 | Ga0496102_0000127_75645_76814 | 368 |
| 348 | 3300048905 | Ga0496102_0030323 | Ga0496102_0030323_2313_3488 | 368 |
| 349 | 3300048905 | Ga0496102_0077331 | Ga0496102_0077331_1616_2785 | 368 |
| 350 | 3300048905 | Ga0496102_0261709 | Ga0496102_0261709_16_1173 | 368 |
| 351 | 3300048906 | Ga0496103_0000134 | Ga0496103_0000134_26987_28156 | 368 |
| 352 | 3300048906 | Ga0496103_0000801 | Ga0496103_0000801_18006_19142 | 368 |
| 353 | 3300048907 | Ga0496104_0002487 | Ga0496104_0002487_3964_5121 | 368 |
| 354 | 3300048907 | Ga0496104_0141859 | Ga0496104_0141859_816_1964 | 368 |
| 355 | 3300048908 | Ga0496105_0019641 | Ga0496105_0019641_988_2163 | 368 |
| 356 | 3300048909 | Ga0496106_0005776 | Ga0496106_0005776_1519_2655 | 368 |
| 357 | 3300048910 | Ga0496107_0000546 | Ga0496107_0000546_8608_9744 | 368 |
| 358 | 3300048910 | Ga0496107_0066165 | Ga0496107_0066165_660_1829 | 368 |
| 359 | 3300048911 | Ga0496108_0000016 | Ga0496108_0000016_113877_115031 | 368 |
| 360 | 3300048911 | Ga0496108_0006276 | Ga0496108_0006276_8467_9603 | 368 |
| 361 | 3300048911 | Ga0496108_0035866 | Ga0496108_0035866_1250_2425 | 368 |
| 362 | 3300048911 | Ga0496108_0037206 | Ga0496108_0037206_2342_3511 | 368 |
| 363 | 3300048912 | Ga0496109_0000030 | Ga0496109_0000030_35661_36797 | 368 |
| 364 | 3300048913 | Ga0496110_0001248 | Ga0496110_0001248_10462_11598 | 368 |
| 365 | 3300048914 | Ga0496111_0010739 | Ga0496111_0010739_453_1589 | 368 |
| 366 | 3300048914 | Ga0496111_0114347 | Ga0496111_0114347_797_1972 | 368 |
| 367 | 3300048915 | Ga0496112_0024584 | Ga0496112_0024584_2038_3213 | 368 |
| 368 | 3300048915 | Ga0496112_0028106 | Ga0496112_0028106_3991_5148 | 368 |
| 369 | 3300048917 | Ga0496114_0000187 | Ga0496114_0000187_38139_39275 | 368 |
| 370 | 3300048918 | Ga0496115_0014978 | Ga0496115_0014978_4635_5810 | 368 |
| 371 | 3300048918 | Ga0496115_0018585 | Ga0496115_0018585_2410_3546 | 368 |
| 372 | 3300048919 | Ga0496116_0000228 | Ga0496116_0000228_27955_29124 | 368 |
| 373 | 3300048919 | Ga0496116_0002431 | Ga0496116_0002431_4522_5658 | 368 |
| 374 | 3300048920 | Ga0496117_0000204 | Ga0496117_0000204_28023_29192 | 368 |
| 375 | 3300048921 | Ga0496118_0000202 | Ga0496118_0000202_75641_76810 | 368 |
| 376 | 3300048921 | Ga0496118_0004508 | Ga0496118_0004508_104_1240 | 368 |
| 377 | 3300048922 | Ga0496119_0000700 | Ga0496119_0000700_6437_7594 | 368 |
| 378 | 3300048922 | Ga0496119_0001772 | Ga0496119_0001772_13526_14662 | 368 |
| 379 | 3300048922 | Ga0496119_0053789 | Ga0496119_0053789_734_1903 | 368 |
| 380 | 3300048923 | Ga0496120_0006080 | Ga0496120_0006080_852_2009 | 368 |
| 381 | 3300048923 | Ga0496120_0009258 | Ga0496120_0009258_1823_2959 | 368 |
| 382 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_358479_359615 | 368 |
| 383 | 3300048924 | Ga0496121_0016157 | Ga0496121_0016157_5722_6891 | 368 |
| 384 | 3300048925 | Ga0496122_0000173 | Ga0496122_0000173_117894_119030 | 368 |
| 385 | 3300048926 | Ga0496123_0005483 | Ga0496123_0005483_7748_8884 | 368 |
| 386 | 3300048927 | Ga0496124_0000012 | Ga0496124_0000012_83272_84408 | 368 |
| 387 | 3300048927 | Ga0496124_0005696 | Ga0496124_0005696_1570_2727 | 368 |
| 388 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_830153_831289 | 368 |
| 389 | 3300048928 | Ga0496125_0033162 | Ga0496125_0033162_2241_3410 | 368 |
| 390 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_358479_359615 | 368 |
| 391 | 3300048929 | Ga0496126_0000490 | Ga0496126_0000490_27142_28311 | 368 |
| 392 | 3300048929 | Ga0496126_0005743 | Ga0496126_0005743_9401_10558 | 368 |
| 393 | 3300049127 | Ga0501306_006800 | Ga0501306_006800_31_1188 | 368 |
| 394 | 3300049568 | Ga0501031_0085994 | Ga0501031_0085994_475_1632 | 368 |
| 395 | 3300049568 | Ga0501031_0174351 | Ga0501031_0174351_226_1389 | 368 |
| 396 | 3300049569 | Ga0501032_0012121 | Ga0501032_0012121_18_1124 | 368 |
| 397 | 3300049569 | Ga0501032_0018279 | Ga0501032_0018279_3049_4206 | 368 |
| 398 | 3300049569 | Ga0501032_0176057 | Ga0501032_0176057_202_1371 | 368 |
| 399 | 3300049570 | Ga0501033_0037100 | Ga0501033_0037100_1360_2517 | 368 |
| 400 | 3300049571 | Ga0501034_0029682 | Ga0501034_0029682_1229_2386 | 368 |
| 401 | 3300049571 | Ga0501034_0115224 | Ga0501034_0115224_150_1307 | 368 |
| 402 | 3300049572 | Ga0501036_0014103 | Ga0501036_0014103_2276_3433 | 368 |
| 403 | 3300049572 | Ga0501036_0021901 | Ga0501036_0021901_3574_4731 | 368 |
| 404 | 3300049573 | Ga0501037_0218824 | Ga0501037_0218824_159_1322 | 368 |
| 405 | 3300049575 | Ga0501039_0027953 | Ga0501039_0027953_2920_4077 | 368 |
| 406 | 3300049579 | Ga0501043_0020781 | Ga0501043_0020781_2416_3573 | 368 |
| 407 | 3300049579 | Ga0501043_0079572 | Ga0501043_0079572_1269_2426 | 368 |
| 408 | 3300049581 | Ga0501047_0015027 | Ga0501047_0015027_1176_2333 | 368 |
| 409 | 3300049585 | Ga0501069_0003390 | Ga0501069_0003390_1974_3143 | 368 |
| 410 | 3300049586 | Ga0501070_0000776 | Ga0501070_0000776_16811_17980 | 368 |
| 411 | 3300049586 | Ga0501070_0002928 | Ga0501070_0002928_12313_13482 | 368 |
| 412 | 3300049586 | Ga0501070_0027795 | Ga0501070_0027795_2761_3930 | 368 |
| 413 | 3300049586 | Ga0501070_0119336 | Ga0501070_0119336_104_1258 | 368 |
| 414 | 3300049586 | Ga0501070_0155067 | Ga0501070_0155067_405_1562 | 368 |
| 415 | 3300049590 | Ga0501074_0001371 | Ga0501074_0001371_12324_13493 | 368 |
| 416 | 3300049590 | Ga0501074_0088732 | Ga0501074_0088732_179_1348 | 368 |
| 417 | 3300049741 | Ga0501079_0000029 | Ga0501079_0000029_45591_46760 | 368 |
| 418 | 3300049742 | Ga0501080_0002688 | Ga0501080_0002688_12740_13909 | 368 |
| 419 | 3300049742 | Ga0501080_0003657 | Ga0501080_0003657_5739_6908 | 368 |
| 420 | 3300049742 | Ga0501080_0035713 | Ga0501080_0035713_1119_2288 | 368 |
| 421 | 3300049742 | Ga0501080_0076972 | Ga0501080_0076972_1191_2366 | 368 |
| 422 | 3300049822 | Ga0501035_0055060 | Ga0501035_0055060_1165_2337 | 368 |
| 423 | 3300049822 | Ga0501035_0131803 | Ga0501035_0131803_406_1563 | 368 |
| 424 | 3300049823 | Ga0501044_0040078 | Ga0501044_0040078_686_1843 | 368 |
| 425 | 3300049823 | Ga0501044_0063753 | Ga0501044_0063753_2637_3749 | 368 |
| 426 | 3300049823 | Ga0501044_0073502 | Ga0501044_0073502_1941_3110 | 368 |
| 427 | 3300050491 | nmdc:mga00v17_42584_c1 | nmdc:mga00v17_42584_c1_1312_2472 | 368 |
| 428 | 3300050511 | nmdc:mga08y16_275542_c1 | nmdc:mga08y16_275542_c1_129_1292 | 368 |
| 429 | 3300050513 | nmdc:mga0rr50_117988_c1 | nmdc:mga0rr50_117988_c1_969_2090 | 368 |
| 430 | 3300050514 | nmdc:mga08x19_44646_c1 | nmdc:mga08x19_44646_c1_331_1506 | 368 |
| 431 | 3300050515 | nmdc:mga0a205_133915_c1 | nmdc:mga0a205_133915_c1_297_1472 | 368 |
| 432 | 3300050516 | nmdc:mga0sz30_1287_c2 | nmdc:mga0sz30_1287_c2_2141_3304 | 368 |
| 433 | 3300053118 | Ga0500594_0009201 | Ga0500594_0009201_990_2144 | 368 |
| 434 | 3300053131 | Ga0500652_021611 | Ga0500652_021611_1069_2223 | 368 |
| 435 | 3300053139 | Ga0500568_0000585 | Ga0500568_0000585_10282_11433 | 368 |
| 436 | 3300053143 | Ga0500579_099760 | Ga0500579_099760_100_1254 | 368 |
| 437 | 3300061719 | Ga0466962_0003681 | Ga0466962_0003681_2198_3373 | 368 |
| 438 | 3300061719 | Ga0466962_0006111 | Ga0466962_0006111_1461_2618 | 368 |
| 439 | 3300061719 | Ga0466962_0014701 | Ga0466962_0014701_2051_3208 | 368 |
| 440 | iso_pu_bacteria | 2501939600 | 2501943218 | 368 |
| 441 | iso_pu_bacteria | 2643221670 | 2644388209 | 368 |
| 442 | iso_pu_bacteria | 2643221715 | 2644635843 | 368 |
| 443 | iso_pu_bacteria | 2675903059 | 2676480367 | 368 |
| 444 | iso_pu_bacteria | 2751185782 | 2753263609 | 368 |
| 445 | iso_pu_bacteria | 2791354901 | 2791916742 | 368 |
| 446 | iso_pu_bacteria | 2808606375 | 2808920279 | 368 |
| 447 | iso_pu_bacteria | 2842888712 | 2842892125 | 368 |
| 448 | iso_pu_bacteria | 2855683550 | 2855684897 | 368 |
| 449 | iso_pu_bacteria | 2856858025 | 2856860616 | 368 |
| 450 | iso_pu_bacteria | 2858868258 | 2858868726 | 368 |
| 451 | iso_pu_bacteria | 2862290372 | 2862294322 | 368 |
| 452 | iso_pu_bacteria | 2862705112 | 2862710054 | 368 |
| 453 | iso_pu_bacteria | 2866552031 | 2866554162 | 368 |
| 454 | iso_pu_bacteria | 2867428634 | 2867434309 | 368 |
| 455 | iso_pu_bacteria | 2868088558 | 2868094250 | 368 |
| 456 | iso_pu_bacteria | 2902582711 | 2902586125 | 368 |
| 457 | iso_pu_bacteria | 2902810491 | 2902813299 | 368 |
| 458 | iso_pu_bacteria | 2912723979 | 2912724592 | 368 |
| 459 | iso_pu_bacteria | 2919468124 | 2919475235 | 368 |
| 460 | iso_pu_bacteria | 2990044586 | 2990047230 | 368 |
| 461 | iso_pu_bacteria | 2995463766 | 2995467899 | 368 |
| 462 | iso_pu_bacteria | 2995463766 | 2995469680 | 368 |
| 463 | iso_pu_bacteria | 3006321560 | 3006324365 | 368 |
| 464 | iso_pu_bacteria | 3006393351 | 3006394966 | 368 |
| 465 | iso_pu_bacteria | 649633069 | 649811351 | 368 |
| 466 | iso_pu_bacteria | 8003856774 | 8003860721 | 368 |
| 467 | iso_pu_bacteria | 8008485437 | 8008488308 | 368 |
| 468 | iso_pu_bacteria | 8008574985 | 8008579130 | 368 |
| 469 | iso_pu_bacteria | 8025413630 | 8025416816 | 368 |
| 470 | iso_pu_bacteria | 8025524527 | 8025530233 | 368 |
| 471 | iso_pu_bacteria | 8054472261 | 8054475142 | 368 |
| 472 | iso_pu_bacteria | 8056829672 | 8056835356 | 368 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pfd-assembly1.cif.gz_A | crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr | 0.9973 | 2 | 367 |
| 3pfd-assembly5.cif.gz_D | crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr | 0.997 | 2 | 367 |
| 3pfd-assembly4.cif.gz_C | crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr | 0.9959 | 2 | 367 |
| 7w0j-assembly1.cif.gz_F | acyl-coa dehydrogenase, tfu_1647 | 0.9928 | 2 | 367 |
| 7w0j-assembly1.cif.gz_D | acyl-coa dehydrogenase, tfu_1647 | 0.9924 | 2 | 367 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQG1_243_389_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9988 | 225 | 367 | 1.20.140.10 |
| 3pfdA01 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.9983 | 2 | 109 | 1.10.540.10 |
| 3pfdA03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9933 | 221 | 368 | 1.20.140.10 |
| 3pfdD03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9933 | 221 | 368 | 1.20.140.10 |
| 3pfdB03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9932 | 221 | 368 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y6EYD0-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9978 | 1 | 368 |
GO:0003995
GO:0050660 |
| AF-A0A239KG45-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9968 | 1 | 367 |
GO:0003995
GO:0050660 |
| AF-A0A2S8MMP0-F1-model_v4 | deleted | 0.9962 | 61 | 203 |
|
| AF-A0A7Y6EYD0-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9951 | 1 | 368 |
GO:0003995
GO:0050660 |
| AF-A0A101WSS0-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9918 | 1 | 367 |
GO:0003995
GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar