F450732

General Info

Members Datasets Scaffolds Average Seq Length
472 302 427 385

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100048064|Ga0070680_1000480642
Length 415
Sequence MRWSSLLRPTAQPHAPVAVRARRLPGVNPGFDTFVLPEEHQLLRATVREVADDKIAPRAAEIDETGEFPYDVLKSLVEADLHAVHVPEQYGGAGADAIASAIVIEEVARACCASSLIPAVNKLGTMGLLLSGSEELKQKYLPPLARGEVMFSYALSEPEAGSDAAGMRTRAVRDGDGFVLNGVKRWITNAGVSDYYTVMAVTDPDAGSRGISAFVVEKNDEGVSFGAPEKKMGIKGSPTREVYFDNVRIPADRMIGAEGTGFKTALATLDHTRLTIGAQALGVAQGAVDYCTRYVQERKQFGKPIADFQGVSFMLADMAMKTEAARALIYHAAALSERRDPNLTFMSAAAKCFASDTAMEVTTNGVQLLGGYGYTRDYPLERMMRDAKITQIYEGTNQIQRLVMSRNLLKAHPVR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2506783011 Frankia datiscae Dg1 Isolate Nodule
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
6 2643221670 Streptomyces sp. Root431 Isolate Unclassified
7 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
8 2643221714 Streptomyces sp. Root264 Isolate Unclassified
9 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
10 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
11 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
12 2773857933 Frankia sp. BMG5.30 Isolate Nodule
13 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
14 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
15 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
16 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
17 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
18 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
19 2855683550 Micromonospora sp. RP3T Isolate Unclassified
20 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
21 2858868258 Micromonospora sp. MH33 Isolate Unclassified
22 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
23 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
24 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
25 2867428634 Streptomyces sp. RP5T Isolate Unclassified
26 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
27 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
28 2902582711 Micromonospora sp. AP08 Isolate Unclassified
29 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
30 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
31 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
32 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
33 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
34 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
35 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
36 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
37 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
38 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
39 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
40 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
186 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
286 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
287 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
288 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
295 649633069 Micromonospora sp. L5 Isolate Unclassified
296 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
297 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
298 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
299 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
300 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
301 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
302 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.19
Metatranscriptomes 1.27
Isolates 9.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.97
Nodule 0.42
Rhizoplane 6.36
Rhizosphere 75.21
Stem 0
Stem Tuber 0
Unclassified 15.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10029109 3300001989 Bacteria 1923
2 JGI24737J22298_10017734 3300001990 Bacteria 2291
3 JGI24738J21930_10010025 3300002075 Bacteria 2119
4 Ga0006562J51391_1076718 3300003578 Bacteria 2550
5 Ga0070658_10000934 3300005327 Bacteria 25019
6 Ga0070658_10001118 3300005327 Bacteria 22898
7 Ga0070658_10093471 3300005327 Bacteria 2481
8 Ga0070658_10157161 3300005327 Bacteria 1906
9 Ga0070666_10004238 3300005335 Bacteria 8712
10 Ga0070680_100000019 3300005336 Bacteria 83282
11 Ga0070680_100004789 3300005336 Bacteria 10186
12 Ga0070680_100048064 3300005336 Bacteria 3476
13 Ga0068868_100017712 3300005338 Bacteria 5312
14 Ga0070660_100029363 3300005339 Bacteria 4121
15 Ga0070660_100057584 3300005339 Bacteria 3011
16 Ga0070691_10024569 3300005341 Bacteria 2800
17 Ga0070668_100000611 3300005347 Bacteria 23925
18 Ga0070674_100012722 3300005356 Bacteria 5176
19 Ga0070659_100000513 3300005366 Bacteria 28466
20 Ga0070659_100046241 3300005366 Bacteria 3411
21 Ga0070667_100000572 3300005367 Bacteria 36433
22 Ga0070701_10004658 3300005438 Bacteria 5583
23 Ga0070663_100017669 3300005455 Bacteria 4659
24 Ga0070663_100282617 3300005455 Bacteria 1323
25 Ga0070662_100101126 3300005457 Bacteria 2182
26 Ga0070681_10000017 3300005458 Bacteria 125537
27 Ga0070681_10002068 3300005458 Bacteria 18207
28 Ga0070681_10043507 3300005458 Bacteria 4499
29 Ga0070679_100000009 3300005530 Bacteria 191579
30 Ga0070679_100002893 3300005530 Bacteria 15597
31 Ga0070679_100050208 3300005530 Bacteria 4155
32 Ga0070679_100248811 3300005530 Bacteria 1734
33 Ga0070672_100000632 3300005543 Bacteria 20612
34 Ga0070693_100009333 3300005547 Bacteria 4876
35 Ga0070665_100014771 3300005548 Bacteria 7838
36 Ga0068855_100005045 3300005563 Bacteria 16111
37 Ga0068855_100046486 3300005563 Bacteria 5131
38 Ga0068855_100210198 3300005563 Bacteria 2187
39 Ga0070664_100118852 3300005564 Bacteria 2312
40 Ga0068854_100002147 3300005578 Bacteria 12110
41 Ga0068856_100044268 3300005614 Bacteria 4380
42 Ga0070702_100018627 3300005615 Bacteria 3605
43 Ga0068864_100006230 3300005618 Bacteria 9784
44 Ga0068863_100009275 3300005841 Bacteria 9598
45 Ga0068863_100012826 3300005841 Bacteria 8083
46 Ga0068863_100324979 3300005841 Bacteria 1495
47 Ga0068858_100340414 3300005842 Bacteria 1436
48 Ga0068862_100114714 3300005844 Bacteria 2368
49 Ga0081455_10004069 3300005937 Bacteria 16563
50 Ga0081540_1011841 3300005983 Bacteria 5796
51 Ga0081540_1015359 3300005983 Bacteria 4851
52 Ga0081539_10020927 3300005985 Bacteria 4394
53 Ga0070717_10004332 3300006028 Bacteria 10241
54 Ga0075364_10192462 3300006051 Bacteria 1381
55 Ga0070716_100003625 3300006173 Bacteria 7297
56 Ga0070712_100004630 3300006175 Bacteria 8502
57 Ga0075367_10047181 3300006178 Bacteria 2534
58 Ga0075369_10022754 3300006186 Bacteria 2587
59 Ga0075370_10096483 3300006353 Bacteria 1708
60 Ga0068871_100080031 3300006358 Bacteria 2704
61 Ga0075431_100480096 3300006847 Bacteria 1236
62 Ga0075433_10018196 3300006852 Bacteria 5836
63 Ga0075434_100040744 3300006871 Bacteria 4600
64 Ga0075436_100043423 3300006914 Bacteria 3099
65 Ga0105251_10082056 3300009011 Bacteria 1489
66 Ga0105240_10070915 3300009093 Bacteria 4309
67 Ga0111539_10325130 3300009094 Bacteria 1790
68 Ga0111539_10361281 3300009094 Bacteria 1690
69 Ga0105245_10003879 3300009098 Bacteria 13300
70 Ga0105245_10019189 3300009098 Bacteria 5988
71 Ga0105247_10021611 3300009101 Bacteria 3874
72 Ga0114129_10139498 3300009147 Bacteria 3324
73 Ga0105241_10005291 3300009174 Bacteria 9533
74 Ga0105237_10038129 3300009545 Bacteria 4854
75 Ga0105237_10138838 3300009545 Bacteria 2425
76 Ga0105238_10004485 3300009551 Bacteria 13832
77 Ga0105249_10000071 3300009553 Bacteria 146512
78 Ga0105239_10057835 3300010375 Bacteria 4254
79 Ga0105246_10003955 3300011119 Bacteria 8984
80 Ga0105246_10008917 3300011119 Bacteria 6173
81 Ga0157371_10015230 3300013102 Bacteria 5775
82 Ga0157369_10001900 3300013105 Bacteria 25188
83 Ga0157369_10014807 3300013105 Bacteria 8801
84 Ga0157369_10033647 3300013105 Bacteria 5631
85 Ga0157374_10010283 3300013296 Bacteria 8046
86 Ga0157374_10059500 3300013296 Bacteria 3573
87 Ga0157378_10217011 3300013297 Bacteria 1817
88 Ga0163162_10198178 3300013306 Bacteria 2137
89 Ga0157372_10051578 3300013307 Bacteria 4579
90 Ga0157372_10228800 3300013307 Bacteria 2155
91 Ga0157375_10025882 3300013308 Bacteria 5460
92 Ga0157375_10126492 3300013308 Bacteria 2671
93 Ga0163163_10115307 3300014325 Bacteria 2718
94 Ga0163163_10124564 3300014325 Bacteria 2614
95 Ga0157380_10012667 3300014326 Bacteria 6122
96 Ga0157379_10017300 3300014968 Bacteria 6352
97 Ga0182007_10003191 3300015262 Bacteria 7834
98 Ga0163161_10003978 3300017792 Bacteria 10351
99 Ga0206354_10948830 3300020081 Bacteria 1536
100 Ga0206353_10014688 3300020082 Bacteria 15094
101 Ga0206353_10093504 3300020082 Bacteria 2828
102 Ga0213876_10001920 3300021384 Bacteria 12469
103 Ga0213875_10000488 3300021388 Bacteria 33637
104 Ga0213875_10013606 3300021388 Bacteria 3987
105 Ga0224712_10012606 3300022467 Bacteria 2666
106 Ga0209758_1001238 3300025297 Bacteria 31885
107 Ga0207426_1038906 3300025302 Bacteria 1494
108 Ga0207692_10043440 3300025898 Bacteria 2236
109 Ga0207642_10025832 3300025899 Bacteria 2382
110 Ga0207710_10029668 3300025900 Bacteria 2382
111 Ga0207688_10009843 3300025901 Bacteria 5202
112 Ga0207680_10037694 3300025903 Bacteria 2793
113 Ga0207647_10005937 3300025904 Bacteria 8902
114 Ga0207647_10016783 3300025904 Bacteria 4989
115 Ga0207647_10038860 3300025904 Bacteria 3006
116 Ga0207647_10049496 3300025904 Bacteria 2606
117 Ga0207699_10016727 3300025906 Bacteria 3843
118 Ga0207705_10000251 3300025909 Bacteria 52410
119 Ga0207705_10013887 3300025909 Bacteria 5807
120 Ga0207705_10062078 3300025909 Bacteria 2699
121 Ga0207654_10018748 3300025911 Bacteria 3637
122 Ga0207654_10023503 3300025911 Bacteria 3303
123 Ga0207707_10000257 3300025912 Bacteria 57640
124 Ga0207707_10005505 3300025912 Bacteria 11067
125 Ga0207707_10038148 3300025912 Bacteria 4198
126 Ga0207707_10038344 3300025912 Bacteria 4187
127 Ga0207695_10002866 3300025913 Bacteria 25047
128 Ga0207671_10003461 3300025914 Bacteria 15716
129 Ga0207693_10004630 3300025915 Bacteria 11604
130 Ga0207660_10053286 3300025917 Bacteria 2883
131 Ga0207657_10003612 3300025919 Bacteria 16487
132 Ga0207657_10031676 3300025919 Bacteria 4786
133 Ga0207652_10000124 3300025921 Bacteria 82835
134 Ga0207652_10001683 3300025921 Bacteria 19373
135 Ga0207652_10055536 3300025921 Bacteria 3407
136 Ga0207652_10210899 3300025921 Bacteria 1749
137 Ga0207687_10009837 3300025927 Bacteria 6260
138 Ga0207690_10000189 3300025932 Bacteria 47490
139 Ga0207709_10020090 3300025935 Bacteria 3765
140 Ga0207709_10090588 3300025935 Bacteria 1998
141 Ga0207665_10000738 3300025939 Bacteria 22007
142 Ga0207689_10094796 3300025942 Bacteria 2451
143 Ga0207679_10011518 3300025945 Bacteria 5732
144 Ga0207667_10053160 3300025949 Bacteria 4262
145 Ga0207667_10067772 3300025949 Bacteria 3717
146 Ga0207712_10000028 3300025961 Bacteria 250190
147 Ga0207712_10070906 3300025961 Bacteria 2505
148 Ga0207668_10002350 3300025972 Bacteria 11047
149 Ga0207668_10064913 3300025972 Bacteria 2582
150 Ga0207640_10270389 3300025981 Bacteria 1329
151 Ga0207658_10000505 3300025986 Bacteria 35682
152 Ga0207703_10033005 3300026035 Bacteria 4101
153 Ga0207639_10169003 3300026041 Bacteria 1850
154 Ga0207678_10305255 3300026067 Bacteria 1368
155 Ga0207708_10015379 3300026075 Bacteria 5740
156 Ga0207641_10000845 3300026088 Bacteria 32537
157 Ga0207641_10032352 3300026088 Bacteria 4342
158 Ga0207641_10378103 3300026088 Bacteria 1356
159 Ga0207674_10424203 3300026116 Bacteria 1285
160 Ga0207683_10003061 3300026121 Bacteria 14623
161 Ga0207428_10135032 3300027907 Bacteria 1886
162 Ga0268265_10133199 3300028380 Bacteria 2069
163 Ga0268264_10164235 3300028381 Bacteria 2003
164 Ga0268264_10177119 3300028381 Bacteria 1933
165 Ga0307515_10000668 3300028794 Bacteria 79033
166 Ga0307515_10001363 3300028794 Bacteria 55232
167 Ga0307515_10026270 3300028794 Bacteria 10030
168 Ga0307515_10052431 3300028794 Bacteria 6050
169 Ga0307515_10087152 3300028794 Bacteria 3968
170 Ga0265338_10003387 3300028800 Bacteria 22494
171 Ga0307511_10121231 3300030521 Bacteria 1616
172 Ga0307512_10001051 3300030522 Bacteria 40387
173 Ga0307512_10006458 3300030522 Bacteria 11874
174 Ga0307512_10051898 3300030522 Bacteria 3276
175 Ga0265340_10001511 3300031247 Bacteria 13340
176 Ga0265339_10008228 3300031249 Bacteria 6651
177 Ga0265327_10001829 3300031251 Bacteria 24850
178 Ga0307513_10003078 3300031456 Bacteria 22757
179 Ga0307513_10059804 3300031456 Bacteria 4043
180 Ga0307509_10028031 3300031507 Bacteria 6263
181 Ga0307508_10002592 3300031616 Bacteria 19015
182 Ga0307508_10007204 3300031616 Bacteria 10359
183 Ga0307508_10146082 3300031616 Bacteria 1969
184 Ga0316576_10028560 3300031727 Bacteria 3933
185 Ga0307516_10082464 3300031730 Bacteria 3057
186 Ga0307413_10002072 3300031824 Bacteria 8013
187 Ga0307410_10020808 3300031852 Bacteria 4023
188 Ga0307507_10122857 3300033179 Bacteria 2069
189 Ga0373938_0007309 3300034957 Bacteria 1939
190 Ga0373928_0009856 3300035084 Bacteria 1870
191 Ga0373929_0001942 3300035085 Bacteria 3865
192 Ga0373940_0003760 3300035088 Bacteria 3135
193 Ga0373951_0000053 3300035091 Bacteria 46153
194 Ga0373951_0015601 3300035091 Bacteria 1712
195 Ga0373939_0006560 3300035114 Bacteria 2806
196 Ga0373942_0002341 3300035207 Bacteria 4618
197 Ga0373942_0002925 3300035207 Bacteria 4045
198 Ga0373962_0013841 3300035242 Bacteria 2049
199 Ga0316574_0026309 3300035398 Bacteria 3497
200 Ga0373931_0041702 3300035691 Bacteria 2411
201 Ga0316584_0088862 3300036712 Bacteria 2313
202 Ga0395899_0211418 3300037312 Bacteria 1348
203 Ga0395898_0019341 3300037466 Bacteria 6933
204 Ga0395898_0073711 3300037466 Bacteria 3298
205 Ga0436364_0012131 3300037853 Bacteria 4042
206 Ga0436364_0132601 3300037853 Bacteria 24278
207 Ga0436365_1454613 3300039437 Bacteria 26721
208 Ga0436361_1044359 3300039447 Bacteria 4210
209 Ga0436363_1202288 3300039450 Bacteria 3001
210 Ga0439466_0002013 3300041411 Bacteria 7976
211 Ga0439431_0016174 3300041997 Bacteria 1743
212 Ga0439445_0006588 3300042004 Bacteria 2672
213 Ga0439445_0012073 3300042004 Bacteria 2069
214 Ga0439449_0002617 3300042007 Bacteria 7010
215 Ga0466969_0000846 3300044656 Bacteria 16623
216 Ga0466969_0009134 3300044656 Bacteria 5257
217 Ga0466969_0038869 3300044656 Bacteria 2392
218 Ga0466972_0009994 3300044658 Bacteria 4765
219 Ga0466972_0014209 3300044658 Bacteria 3990
220 Ga0466972_0017379 3300044658 Bacteria 3600
221 Ga0466972_0102979 3300044658 Bacteria 1350
222 Ga0466965_0002082 3300044683 Bacteria 8384
223 Ga0466965_0012273 3300044683 Bacteria 4026
224 Ga0466965_0050608 3300044683 Bacteria 2060
225 Ga0466965_0062623 3300044683 Bacteria 1861
226 Ga0466966_0001727 3300044684 Bacteria 14128
227 Ga0466966_0003063 3300044684 Bacteria 11020
228 Ga0466966_0005284 3300044684 Bacteria 8490
229 Ga0466961_0003182 3300044693 Bacteria 10221
230 Ga0466961_0008823 3300044693 Bacteria 6430
231 Ga0466961_0013620 3300044693 Bacteria 5210
232 Ga0466961_0030248 3300044693 Bacteria 3480
233 Ga0466961_0033501 3300044693 Bacteria 3300
234 Ga0466961_0178762 3300044693 Bacteria 1318
235 Ga0466963_0000918 3300044694 Bacteria 15006
236 Ga0466963_0004229 3300044694 Bacteria 8327
237 Ga0466963_0076383 3300044694 Bacteria 2262
238 Ga0466971_0000394 3300044719 Bacteria 16912
239 Ga0466971_0002502 3300044719 Bacteria 7773
240 Ga0466971_0005752 3300044719 Bacteria 5392
241 Ga0466971_0125383 3300044719 Bacteria 1190
242 Ga0466970_0001367 3300044765 Bacteria 11761
243 Ga0466970_0009534 3300044765 Bacteria 4910
244 Ga0466970_0009592 3300044765 Bacteria 4896
245 Ga0466970_0030900 3300044765 Bacteria 2826
246 Ga0466970_0045317 3300044765 Bacteria 2341
247 Ga0466957_0013876 3300044842 Bacteria 4683
248 Ga0466957_0016231 3300044842 Bacteria 4355
249 Ga0466957_0025933 3300044842 Bacteria 3475
250 Ga0466957_0029443 3300044842 Bacteria 3274
251 Ga0466957_0085446 3300044842 Bacteria 1971
252 Ga0466960_0003863 3300044901 Bacteria 5808
253 Ga0466960_0048841 3300044901 Bacteria 2034
254 Ga0466959_0003768 3300045049 Bacteria 10041
255 Ga0466959_0022226 3300045049 Bacteria 4686
256 Ga0466959_0062851 3300045049 Bacteria 2697
257 Ga0466959_0158963 3300045049 Bacteria 1589
258 Ga0466958_0006001 3300045836 Bacteria 6579
259 Ga0466958_0006242 3300045836 Bacteria 6470
260 Ga0466958_0032433 3300045836 Bacteria 3108
261 Ga0466958_0068668 3300045836 Bacteria 2167
262 Ga0466958_0093686 3300045836 Bacteria 1860
263 Ga0466958_0127562 3300045836 Bacteria 1596
264 Ga0466967_0018994 3300045976 Bacteria 5515
265 Ga0466967_0029072 3300045976 Bacteria 4622
266 Ga0466967_0032778 3300045976 Bacteria 4391
267 Ga0466967_0033369 3300045976 Bacteria 4356
268 Ga0466967_0051360 3300045976 Bacteria 3613
269 Ga0466967_0083055 3300045976 Bacteria 2896
270 Ga0466967_0110410 3300045976 Bacteria 2526
271 Ga0466967_0237208 3300045976 Bacteria 1738
272 Ga0466967_0352950 3300045976 Bacteria 1424
273 Ga0495592_0003573 3300046454 Bacteria 11176
274 Ga0495603_0002583 3300046455 Bacteria 10682
275 Ga0495629_0000935 3300046459 Bacteria 23513
276 Ga0495629_0016409 3300046459 Bacteria 5316
277 Ga0495638_0161869 3300046460 Bacteria 1290
278 Ga0495651_0089836 3300046462 Bacteria 2305
279 Ga0495582_0165582 3300046473 Bacteria 1258
280 Ga0495639_0115322 3300046475 Bacteria 1278
281 Ga0495594_0000163 3300046499 Bacteria 31842
282 Ga0495618_0126629 3300046514 Bacteria 1635
283 Ga0495628_0070054 3300046516 Bacteria 2734
284 Ga0495632_0038855 3300046519 Bacteria 2407
285 Ga0495666_0088144 3300046526 Bacteria 1466
286 Ga0495652_0017946 3300046529 Bacteria 6313
287 Ga0495640_0009935 3300046533 Bacteria 7378
288 Ga0495622_0006021 3300046557 Bacteria 5635
289 Ga0495633_0078038 3300046558 Bacteria 1542
290 Ga0495634_0001735 3300046642 Bacteria 18881
291 Ga0495588_0002102 3300046674 Bacteria 8545
292 Ga0495657_0020317 3300046675 Bacteria 4775
293 Ga0495613_0038905 3300046689 Bacteria 3526
294 Ga0495581_0063805 3300047315 Bacteria 2128
295 Ga0495676_0003711 3300047321 Bacteria 13866
296 Ga0495676_0073916 3300047321 Bacteria 2612
297 Ga0495687_011713 3300047443 Bacteria 4692
298 Ga0496100_0000585 3300048903 Bacteria 17202
299 Ga0496100_0041670 3300048903 Bacteria 2928
300 Ga0496101_0000032 3300048904 Bacteria 186783
301 Ga0496101_0009524 3300048904 Bacteria 6385
302 Ga0496101_0094305 3300048904 Bacteria 2230
303 Ga0496102_0000127 3300048905 Bacteria 104838
304 Ga0496102_0030323 3300048905 Bacteria 4840
305 Ga0496102_0077331 3300048905 Bacteria 3063
306 Ga0496102_0261709 3300048905 Bacteria 1631
307 Ga0496103_0000134 3300048906 Bacteria 77847
308 Ga0496103_0000801 3300048906 Bacteria 23137
309 Ga0496104_0002487 3300048907 Bacteria 15864
310 Ga0496104_0141859 3300048907 Bacteria 2308
311 Ga0496105_0019641 3300048908 Bacteria 5451
312 Ga0496106_0005776 3300048909 Bacteria 9150
313 Ga0496107_0000546 3300048910 Bacteria 21055
314 Ga0496107_0066165 3300048910 Bacteria 2620
315 Ga0496108_0000016 3300048911 Bacteria 237051
316 Ga0496108_0006276 3300048911 Bacteria 9633
317 Ga0496108_0035866 3300048911 Bacteria 4124
318 Ga0496108_0037206 3300048911 Bacteria 4053
319 Ga0496109_0000030 3300048912 Bacteria 164120
320 Ga0496110_0001248 3300048913 Bacteria 18173
321 Ga0496111_0010739 3300048914 Bacteria 6157
322 Ga0496111_0114347 3300048914 Bacteria 1989
323 Ga0496112_0024584 3300048915 Bacteria 5772
324 Ga0496112_0028106 3300048915 Bacteria 5426
325 Ga0496114_0000187 3300048917 Bacteria 44786
326 Ga0496115_0014978 3300048918 Bacteria 5878
327 Ga0496115_0018585 3300048918 Bacteria 5341
328 Ga0496116_0000228 3300048919 Bacteria 104766
329 Ga0496116_0002431 3300048919 Bacteria 19606
330 Ga0496117_0000204 3300048920 Bacteria 116843
331 Ga0496118_0000202 3300048921 Bacteria 104816
332 Ga0496118_0004508 3300048921 Bacteria 16465
333 Ga0496119_0000700 3300048922 Bacteria 44933
334 Ga0496119_0001772 3300048922 Bacteria 25130
335 Ga0496119_0053789 3300048922 Bacteria 2457
336 Ga0496120_0006080 3300048923 Bacteria 9374
337 Ga0496120_0009258 3300048923 Bacteria 7010
338 Ga0496121_0000004 3300048924 Bacteria 1139011
339 Ga0496121_0016157 3300048924 Bacteria 7730
340 Ga0496122_0000173 3300048925 Bacteria 153768
341 Ga0496123_0005483 3300048926 Bacteria 12756
342 Ga0496124_0000012 3300048927 Bacteria 512581
343 Ga0496124_0005696 3300048927 Bacteria 13879
344 Ga0496125_0000003 3300048928 Bacteria 1189767
345 Ga0496125_0033162 3300048928 Bacteria 4575
346 Ga0496126_0000001 3300048929 Bacteria 1139011
347 Ga0496126_0000490 3300048929 Bacteria 77991
348 Ga0496126_0005743 3300048929 Bacteria 14041
349 Ga0501306_006800 3300049127 Bacteria 1354
350 Ga0501031_0085994 3300049568 Bacteria 2050
351 Ga0501031_0111474 3300049568 Bacteria 1787
352 Ga0501031_0174351 3300049568 Bacteria 1405
353 Ga0501032_0012121 3300049569 Bacteria 6171
354 Ga0501032_0014525 3300049569 Bacteria 5575
355 Ga0501032_0018279 3300049569 Bacteria 4912
356 Ga0501032_0064849 3300049569 Bacteria 2444
357 Ga0501032_0176057 3300049569 Bacteria 1401
358 Ga0501033_0037100 3300049570 Bacteria 3649
359 Ga0501034_0029682 3300049571 Bacteria 5559
360 Ga0501034_0115224 3300049571 Bacteria 2676
361 Ga0501036_0006857 3300049572 Bacteria 9256
362 Ga0501036_0014103 3300049572 Bacteria 6643
363 Ga0501036_0021901 3300049572 Bacteria 5374
364 Ga0501037_0218824 3300049573 Bacteria 1341
365 Ga0501038_0059180 3300049574 Bacteria 3282
366 Ga0501039_0027953 3300049575 Bacteria 4338
367 Ga0501040_0007809 3300049576 Bacteria 6929
368 Ga0501041_0027687 3300049577 Bacteria 3416
369 Ga0501042_0000616 3300049578 Bacteria 18986
370 Ga0501043_0020781 3300049579 Bacteria 5148
371 Ga0501043_0079572 3300049579 Bacteria 2575
372 Ga0501043_0210997 3300049579 Bacteria 1505
373 Ga0501046_0063133 3300049580 Bacteria 2893
374 Ga0501047_0015027 3300049581 Bacteria 7368
375 Ga0501048_0006807 3300049582 Bacteria 8682
376 Ga0501068_0058567 3300049584 Bacteria 2338
377 Ga0501069_0003390 3300049585 Bacteria 8182
378 Ga0501070_0000776 3300049586 Bacteria 29084
379 Ga0501070_0002928 3300049586 Bacteria 14854
380 Ga0501070_0027795 3300049586 Bacteria 4744
381 Ga0501070_0119336 3300049586 Bacteria 2180
382 Ga0501070_0155067 3300049586 Bacteria 1888
383 Ga0501071_0009431 3300049587 Bacteria 6499
384 Ga0501072_0196576 3300049588 Bacteria 1608
385 Ga0501074_0001371 3300049590 Bacteria 16150
386 Ga0501074_0088732 3300049590 Bacteria 2215
387 Ga0501076_0013326 3300049592 Bacteria 6165
388 Ga0501076_0019568 3300049592 Bacteria 5176
389 Ga0501077_0031641 3300049593 Bacteria 3367
390 Ga0501077_0081650 3300049593 Bacteria 2048
391 Ga0501077_0128787 3300049593 Bacteria 1604
392 Ga0501079_0000029 3300049741 Bacteria 60538
393 Ga0501080_0002688 3300049742 Bacteria 15576
394 Ga0501080_0003657 3300049742 Bacteria 13569
395 Ga0501080_0035713 3300049742 Bacteria 4640
396 Ga0501080_0076972 3300049742 Bacteria 3102
397 Ga0501080_0096997 3300049742 Bacteria 2737
398 Ga0501081_0029043 3300049743 Bacteria 3735
399 Ga0501035_0055060 3300049822 Bacteria 3552
400 Ga0501035_0062522 3300049822 Bacteria 3313
401 Ga0501035_0131803 3300049822 Bacteria 2178
402 Ga0501044_0002655 3300049823 Bacteria 20338
403 Ga0501044_0040078 3300049823 Bacteria 4884
404 Ga0501044_0063753 3300049823 Bacteria 3763
405 Ga0501044_0073502 3300049823 Bacteria 3475
406 Ga0501045_0011211 3300049824 Bacteria 6288
407 Ga0501045_0085032 3300049824 Bacteria 2334
408 nmdc:mga00v17_162193_c1 3300050491 Bacteria 1439
409 nmdc:mga00v17_42584_c1 3300050491 Bacteria 2732
410 nmdc:mga06r32_442039_c1 3300050510 Bacteria 1280
411 nmdc:mga08y16_275542_c1 3300050511 Bacteria 1736
412 nmdc:mga0rr50_117988_c1 3300050513 Bacteria 2108
413 nmdc:mga08x19_44646_c1 3300050514 Bacteria 2830
414 nmdc:mga0a205_133915_c1 3300050515 Bacteria 2379
415 nmdc:mga0sz30_1287_c2 3300050516 Bacteria 4266
416 Ga0500594_0009201 3300053118 Bacteria 2269
417 Ga0500642_0005837 3300053130 Bacteria 4006
418 Ga0500652_021611 3300053131 Bacteria 2426
419 Ga0500568_0000585 3300053139 Bacteria 26473
420 Ga0500579_099760 3300053143 Bacteria 1520
421 Ga0501084_0020015 3300054114 Bacteria 5579
422 Ga0501082_0092821 3300060353 Bacteria 2608
423 Ga0466962_0002002 3300061719 Bacteria 9625
424 Ga0466962_0003681 3300061719 Bacteria 7305
425 Ga0466962_0006111 3300061719 Bacteria 5788
426 Ga0466962_0014701 3300061719 Bacteria 3773
427 Ga0530510_0047767 3300061734 Bacteria 3093

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026088 Ga0207641_10378103 Ga0207641_103781031 353
2 3300044683 Ga0466965_0050608 Ga0466965_0050608_188_1360 354
3 3300050491 nmdc:mga00v17_162193_c1 nmdc:mga00v17_162193_c1_194_1372 354
4 3300005564 Ga0070664_100118852 Ga0070664_1001188522 355
5 3300025945 Ga0207679_10011518 Ga0207679_100115185 355
6 3300049568 Ga0501031_0111474 Ga0501031_0111474_609_1763 356
7 3300021388 Ga0213875_10013606 Ga0213875_100136063 357
8 3300037853 Ga0436364_0012131 Ga0436364_0012131_1424_2530 357
9 3300044683 Ga0466965_0062623 Ga0466965_0062623_113_1282 357
10 3300026075 Ga0207708_10015379 Ga0207708_100153795 358
11 3300049569 Ga0501032_0014525 Ga0501032_0014525_3063_4247 358
12 3300049572 Ga0501036_0006857 Ga0501036_0006857_4743_5927 358
13 3300049574 Ga0501038_0059180 Ga0501038_0059180_1540_2724 358
14 3300049576 Ga0501040_0007809 Ga0501040_0007809_3905_5089 358
15 3300049577 Ga0501041_0027687 Ga0501041_0027687_2068_3252 358
16 3300049578 Ga0501042_0000616 Ga0501042_0000616_12641_13825 358
17 3300049579 Ga0501043_0210997 Ga0501043_0210997_163_1347 358
18 3300049580 Ga0501046_0063133 Ga0501046_0063133_78_1262 358
19 3300049582 Ga0501048_0006807 Ga0501048_0006807_3250_4434 358
20 3300049584 Ga0501068_0058567 Ga0501068_0058567_856_2040 358
21 3300049587 Ga0501071_0009431 Ga0501071_0009431_1864_3048 358
22 3300049588 Ga0501072_0196576 Ga0501072_0196576_188_1372 358
23 3300049592 Ga0501076_0013326 Ga0501076_0013326_4813_5997 358
24 3300049593 Ga0501077_0081650 Ga0501077_0081650_688_1872 358
25 3300049742 Ga0501080_0096997 Ga0501080_0096997_1227_2411 358
26 3300049743 Ga0501081_0029043 Ga0501081_0029043_853_2037 358
27 3300049822 Ga0501035_0062522 Ga0501035_0062522_2066_3250 358
28 3300049824 Ga0501045_0011211 Ga0501045_0011211_1157_2341 358
29 3300054114 Ga0501084_0020015 Ga0501084_0020015_1205_2389 358
30 3300061734 Ga0530510_0047767 Ga0530510_0047767_659_1843 358
31 3300028794 Ga0307515_10026270 Ga0307515_100262706 359
32 3300044719 Ga0466971_0125383 Ga0466971_0125383_70_1173 360
33 3300049569 Ga0501032_0064849 Ga0501032_0064849_787_1932 362
34 3300039447 Ga0436361_1044359 Ga0436361_1044359_1241_2386 363
35 iso_pu_bacteria 2582581312 2585301421 364
36 iso_pu_bacteria 2582581313 2585310360 364
37 iso_pu_bacteria 2616644941 2616905009 364
38 iso_pu_bacteria 2643221678 2644436850 364
39 iso_pu_bacteria 2643221714 2644628589 364
40 iso_pu_bacteria 2808606359 2808841746 364
41 iso_pu_bacteria 2818991463 2819697808 364
42 iso_pu_bacteria 2946072368 2946075631 364
43 3300046462 Ga0495651_0089836 Ga0495651_0089836_1117_2274 365
44 3300049592 Ga0501076_0019568 Ga0501076_0019568_1001_2107 366
45 3300049593 Ga0501077_0031641 Ga0501077_0031641_1658_2764 366
46 3300049593 Ga0501077_0128787 Ga0501077_0128787_90_1262 366
47 3300049824 Ga0501045_0085032 Ga0501045_0085032_355_1461 366
48 3300053130 Ga0500642_0005837 Ga0500642_0005837_167_1324 366
49 3300060353 Ga0501082_0092821 Ga0501082_0092821_466_1572 366
50 iso_pu_bacteria 2894772417 2894776895 366
51 3300005543 Ga0070672_100000632 Ga0070672_10000063218 367
52 3300006847 Ga0075431_100480096 Ga0075431_1004800961 367
53 3300009098 Ga0105245_10003879 Ga0105245_100038792 367
54 3300020082 Ga0206353_10093504 Ga0206353_100935042 367
55 3300021388 Ga0213875_10000488 Ga0213875_1000048835 367
56 3300026116 Ga0207674_10424203 Ga0207674_104242031 367
57 3300031456 Ga0307513_10059804 Ga0307513_100598044 367
58 3300031824 Ga0307413_10002072 Ga0307413_100020726 367
59 3300037853 Ga0436364_0132601 Ga0436364_0132601_21557_22687 367
60 3300044658 Ga0466972_0014209 Ga0466972_0014209_79_1239 367
61 3300044684 Ga0466966_0001727 Ga0466966_0001727_7401_8531 367
62 3300044694 Ga0466963_0000918 Ga0466963_0000918_11771_12901 367
63 3300044719 Ga0466971_0000394 Ga0466971_0000394_15091_16221 367
64 3300044765 Ga0466970_0009592 Ga0466970_0009592_810_1940 367
65 3300044765 Ga0466970_0045317 Ga0466970_0045317_688_1848 367
66 3300044842 Ga0466957_0016231 Ga0466957_0016231_3083_4243 367
67 3300044842 Ga0466957_0029443 Ga0466957_0029443_1494_2624 367
68 3300045049 Ga0466959_0003768 Ga0466959_0003768_7254_8384 367
69 3300045049 Ga0466959_0022226 Ga0466959_0022226_2603_3763 367
70 3300045836 Ga0466958_0006242 Ga0466958_0006242_3888_5018 367
71 3300045976 Ga0466967_0051360 Ga0466967_0051360_590_1720 367
72 3300049823 Ga0501044_0002655 Ga0501044_0002655_22_1143 367
73 3300050510 nmdc:mga06r32_442039_c1 nmdc:mga06r32_442039_c1_72_1217 367
74 3300061719 Ga0466962_0002002 Ga0466962_0002002_1160_2290 367
75 iso_pu_bacteria 2506783011 2506866682 367
76 iso_pu_bacteria 2773857933 2774904234 367
77 iso_pu_bacteria 2795385472 2795796414 367
78 3300001989 JGI24739J22299_10029109 JGI24739J22299_100291091 368
79 3300001990 JGI24737J22298_10017734 JGI24737J22298_100177342 368
80 3300002075 JGI24738J21930_10010025 JGI24738J21930_100100252 368
81 3300003578 Ga0006562J51391_1076718 Ga0006562J51391_10767183 368
82 3300005327 Ga0070658_10000934 Ga0070658_100009348 368
83 3300005327 Ga0070658_10001118 Ga0070658_1000111811 368
84 3300005327 Ga0070658_10093471 Ga0070658_100934712 368
85 3300005327 Ga0070658_10157161 Ga0070658_101571611 368
86 3300005335 Ga0070666_10004238 Ga0070666_100042385 368
87 3300005336 Ga0070680_100000019 Ga0070680_10000001942 368
88 3300005336 Ga0070680_100004789 Ga0070680_1000047894 368
89 3300005336 Ga0070680_100048064 Ga0070680_1000480642 368
90 3300005338 Ga0068868_100017712 Ga0068868_1000177123 368
91 3300005339 Ga0070660_100029363 Ga0070660_1000293632 368
92 3300005339 Ga0070660_100057584 Ga0070660_1000575842 368
93 3300005341 Ga0070691_10024569 Ga0070691_100245694 368
94 3300005347 Ga0070668_100000611 Ga0070668_1000006112 368
95 3300005356 Ga0070674_100012722 Ga0070674_1000127224 368
96 3300005366 Ga0070659_100000513 Ga0070659_1000005132 368
97 3300005366 Ga0070659_100046241 Ga0070659_1000462412 368
98 3300005367 Ga0070667_100000572 Ga0070667_10000057213 368
99 3300005438 Ga0070701_10004658 Ga0070701_100046585 368
100 3300005455 Ga0070663_100017669 Ga0070663_1000176693 368
101 3300005455 Ga0070663_100282617 Ga0070663_1002826171 368
102 3300005457 Ga0070662_100101126 Ga0070662_1001011262 368
103 3300005458 Ga0070681_10000017 Ga0070681_1000001750 368
104 3300005458 Ga0070681_10002068 Ga0070681_100020683 368
105 3300005458 Ga0070681_10043507 Ga0070681_100435072 368
106 3300005530 Ga0070679_100000009 Ga0070679_10000000966 368
107 3300005530 Ga0070679_100002893 Ga0070679_1000028937 368
108 3300005530 Ga0070679_100050208 Ga0070679_1000502082 368
109 3300005530 Ga0070679_100248811 Ga0070679_1002488111 368
110 3300005547 Ga0070693_100009333 Ga0070693_1000093332 368
111 3300005548 Ga0070665_100014771 Ga0070665_1000147713 368
112 3300005563 Ga0068855_100005045 Ga0068855_1000050454 368
113 3300005563 Ga0068855_100046486 Ga0068855_1000464864 368
114 3300005563 Ga0068855_100210198 Ga0068855_1002101982 368
115 3300005578 Ga0068854_100002147 Ga0068854_10000214716 368
116 3300005614 Ga0068856_100044268 Ga0068856_1000442683 368
117 3300005615 Ga0070702_100018627 Ga0070702_1000186273 368
118 3300005618 Ga0068864_100006230 Ga0068864_1000062305 368
119 3300005841 Ga0068863_100009275 Ga0068863_1000092753 368
120 3300005841 Ga0068863_100012826 Ga0068863_1000128265 368
121 3300005841 Ga0068863_100324979 Ga0068863_1003249791 368
122 3300005842 Ga0068858_100340414 Ga0068858_1003404142 368
123 3300005844 Ga0068862_100114714 Ga0068862_1001147142 368
124 3300005937 Ga0081455_10004069 Ga0081455_100040692 368
125 3300005983 Ga0081540_1011841 Ga0081540_10118413 368
126 3300005983 Ga0081540_1015359 Ga0081540_10153593 368
127 3300005985 Ga0081539_10020927 Ga0081539_100209272 368
128 3300006028 Ga0070717_10004332 Ga0070717_100043325 368
129 3300006051 Ga0075364_10192462 Ga0075364_101924621 368
130 3300006173 Ga0070716_100003625 Ga0070716_1000036254 368
131 3300006175 Ga0070712_100004630 Ga0070712_1000046305 368
132 3300006178 Ga0075367_10047181 Ga0075367_100471811 368
133 3300006186 Ga0075369_10022754 Ga0075369_100227542 368
134 3300006353 Ga0075370_10096483 Ga0075370_100964832 368
135 3300006358 Ga0068871_100080031 Ga0068871_1000800312 368
136 3300006852 Ga0075433_10018196 Ga0075433_100181965 368
137 3300006871 Ga0075434_100040744 Ga0075434_1000407445 368
138 3300006914 Ga0075436_100043423 Ga0075436_1000434232 368
139 3300009011 Ga0105251_10082056 Ga0105251_100820561 368
140 3300009093 Ga0105240_10070915 Ga0105240_100709153 368
141 3300009094 Ga0111539_10325130 Ga0111539_103251302 368
142 3300009094 Ga0111539_10361281 Ga0111539_103612812 368
143 3300009098 Ga0105245_10019189 Ga0105245_100191893 368
144 3300009101 Ga0105247_10021611 Ga0105247_100216113 368
145 3300009147 Ga0114129_10139498 Ga0114129_101394983 368
146 3300009174 Ga0105241_10005291 Ga0105241_100052917 368
147 3300009545 Ga0105237_10038129 Ga0105237_100381292 368
148 3300009545 Ga0105237_10138838 Ga0105237_101388383 368
149 3300009551 Ga0105238_10004485 Ga0105238_1000448517 368
150 3300009553 Ga0105249_10000071 Ga0105249_100000715 368
151 3300010375 Ga0105239_10057835 Ga0105239_100578355 368
152 3300011119 Ga0105246_10003955 Ga0105246_100039557 368
153 3300011119 Ga0105246_10008917 Ga0105246_100089172 368
154 3300013102 Ga0157371_10015230 Ga0157371_100152304 368
155 3300013105 Ga0157369_10001900 Ga0157369_1000190017 368
156 3300013105 Ga0157369_10014807 Ga0157369_100148072 368
157 3300013105 Ga0157369_10033647 Ga0157369_100336472 368
158 3300013296 Ga0157374_10010283 Ga0157374_100102832 368
159 3300013296 Ga0157374_10059500 Ga0157374_100595002 368
160 3300013297 Ga0157378_10217011 Ga0157378_102170111 368
161 3300013306 Ga0163162_10198178 Ga0163162_101981782 368
162 3300013307 Ga0157372_10051578 Ga0157372_100515784 368
163 3300013307 Ga0157372_10228800 Ga0157372_102288002 368
164 3300013308 Ga0157375_10025882 Ga0157375_100258824 368
165 3300013308 Ga0157375_10126492 Ga0157375_101264924 368
166 3300014325 Ga0163163_10115307 Ga0163163_101153072 368
167 3300014325 Ga0163163_10124564 Ga0163163_101245643 368
168 3300014326 Ga0157380_10012667 Ga0157380_100126674 368
169 3300014968 Ga0157379_10017300 Ga0157379_100173004 368
170 3300015262 Ga0182007_10003191 Ga0182007_100031916 368
171 3300017792 Ga0163161_10003978 Ga0163161_100039786 368
172 3300020081 Ga0206354_10948830 Ga0206354_109488302 368
173 3300020082 Ga0206353_10014688 Ga0206353_1001468810 368
174 3300021384 Ga0213876_10001920 Ga0213876_100019203 368
175 3300022467 Ga0224712_10012606 Ga0224712_100126061 368
176 3300025297 Ga0209758_1001238 Ga0209758_10012384 368
177 3300025302 Ga0207426_1038906 Ga0207426_10389061 368
178 3300025898 Ga0207692_10043440 Ga0207692_100434403 368
179 3300025899 Ga0207642_10025832 Ga0207642_100258322 368
180 3300025900 Ga0207710_10029668 Ga0207710_100296682 368
181 3300025901 Ga0207688_10009843 Ga0207688_100098435 368
182 3300025903 Ga0207680_10037694 Ga0207680_100376943 368
183 3300025904 Ga0207647_10005937 Ga0207647_1000593710 368
184 3300025904 Ga0207647_10016783 Ga0207647_100167834 368
185 3300025904 Ga0207647_10038860 Ga0207647_100388603 368
186 3300025904 Ga0207647_10049496 Ga0207647_100494963 368
187 3300025906 Ga0207699_10016727 Ga0207699_100167274 368
188 3300025909 Ga0207705_10000251 Ga0207705_1000025112 368
189 3300025909 Ga0207705_10013887 Ga0207705_100138872 368
190 3300025909 Ga0207705_10062078 Ga0207705_100620783 368
191 3300025911 Ga0207654_10018748 Ga0207654_100187484 368
192 3300025911 Ga0207654_10023503 Ga0207654_100235033 368
193 3300025912 Ga0207707_10000257 Ga0207707_1000025751 368
194 3300025912 Ga0207707_10005505 Ga0207707_100055056 368
195 3300025912 Ga0207707_10038148 Ga0207707_100381484 368
196 3300025912 Ga0207707_10038344 Ga0207707_100383445 368
197 3300025913 Ga0207695_10002866 Ga0207695_1000286623 368
198 3300025914 Ga0207671_10003461 Ga0207671_100034614 368
199 3300025915 Ga0207693_10004630 Ga0207693_100046305 368
200 3300025917 Ga0207660_10053286 Ga0207660_100532862 368
201 3300025919 Ga0207657_10003612 Ga0207657_100036128 368
202 3300025919 Ga0207657_10031676 Ga0207657_100316762 368
203 3300025921 Ga0207652_10000124 Ga0207652_100001248 368
204 3300025921 Ga0207652_10001683 Ga0207652_1000168312 368
205 3300025921 Ga0207652_10055536 Ga0207652_100555363 368
206 3300025921 Ga0207652_10210899 Ga0207652_102108991 368
207 3300025927 Ga0207687_10009837 Ga0207687_100098376 368
208 3300025932 Ga0207690_10000189 Ga0207690_1000018931 368
209 3300025935 Ga0207709_10020090 Ga0207709_100200903 368
210 3300025935 Ga0207709_10090588 Ga0207709_100905882 368
211 3300025939 Ga0207665_10000738 Ga0207665_100007385 368
212 3300025942 Ga0207689_10094796 Ga0207689_100947962 368
213 3300025949 Ga0207667_10053160 Ga0207667_100531604 368
214 3300025949 Ga0207667_10067772 Ga0207667_100677725 368
215 3300025961 Ga0207712_10000028 Ga0207712_100000285 368
216 3300025961 Ga0207712_10070906 Ga0207712_100709062 368
217 3300025972 Ga0207668_10002350 Ga0207668_100023502 368
218 3300025972 Ga0207668_10064913 Ga0207668_100649132 368
219 3300025981 Ga0207640_10270389 Ga0207640_102703891 368
220 3300025986 Ga0207658_10000505 Ga0207658_1000050532 368
221 3300026035 Ga0207703_10033005 Ga0207703_100330053 368
222 3300026041 Ga0207639_10169003 Ga0207639_101690031 368
223 3300026067 Ga0207678_10305255 Ga0207678_103052551 368
224 3300026088 Ga0207641_10000845 Ga0207641_100008453 368
225 3300026088 Ga0207641_10032352 Ga0207641_100323523 368
226 3300026121 Ga0207683_10003061 Ga0207683_1000306110 368
227 3300027907 Ga0207428_10135032 Ga0207428_101350322 368
228 3300028380 Ga0268265_10133199 Ga0268265_101331991 368
229 3300028381 Ga0268264_10164235 Ga0268264_101642352 368
230 3300028381 Ga0268264_10177119 Ga0268264_101771192 368
231 3300028794 Ga0307515_10000668 Ga0307515_1000066813 368
232 3300028794 Ga0307515_10001363 Ga0307515_100013635 368
233 3300028794 Ga0307515_10052431 Ga0307515_100524312 368
234 3300028794 Ga0307515_10087152 Ga0307515_100871523 368
235 3300028800 Ga0265338_10003387 Ga0265338_100033877 368
236 3300030521 Ga0307511_10121231 Ga0307511_101212311 368
237 3300030522 Ga0307512_10001051 Ga0307512_100010519 368
238 3300030522 Ga0307512_10006458 Ga0307512_100064583 368
239 3300030522 Ga0307512_10051898 Ga0307512_100518983 368
240 3300031247 Ga0265340_10001511 Ga0265340_1000151110 368
241 3300031249 Ga0265339_10008228 Ga0265339_100082286 368
242 3300031251 Ga0265327_10001829 Ga0265327_100018295 368
243 3300031456 Ga0307513_10003078 Ga0307513_1000307816 368
244 3300031507 Ga0307509_10028031 Ga0307509_100280315 368
245 3300031616 Ga0307508_10002592 Ga0307508_1000259213 368
246 3300031616 Ga0307508_10007204 Ga0307508_100072046 368
247 3300031616 Ga0307508_10146082 Ga0307508_101460822 368
248 3300031727 Ga0316576_10028560 Ga0316576_100285603 368
249 3300031730 Ga0307516_10082464 Ga0307516_100824641 368
250 3300031852 Ga0307410_10020808 Ga0307410_100208083 368
251 3300033179 Ga0307507_10122857 Ga0307507_101228572 368
252 3300034957 Ga0373938_0007309 Ga0373938_0007309_558_1733 368
253 3300035084 Ga0373928_0009856 Ga0373928_0009856_45_1220 368
254 3300035085 Ga0373929_0001942 Ga0373929_0001942_62_1237 368
255 3300035088 Ga0373940_0003760 Ga0373940_0003760_55_1209 368
256 3300035091 Ga0373951_0000053 Ga0373951_0000053_29489_30643 368
257 3300035091 Ga0373951_0015601 Ga0373951_0015601_291_1466 368
258 3300035114 Ga0373939_0006560 Ga0373939_0006560_62_1237 368
259 3300035207 Ga0373942_0002341 Ga0373942_0002341_495_1649 368
260 3300035207 Ga0373942_0002925 Ga0373942_0002925_107_1282 368
261 3300035242 Ga0373962_0013841 Ga0373962_0013841_287_1441 368
262 3300035398 Ga0316574_0026309 Ga0316574_0026309_2114_3271 368
263 3300035691 Ga0373931_0041702 Ga0373931_0041702_827_2002 368
264 3300036712 Ga0316584_0088862 Ga0316584_0088862_764_1921 368
265 3300037312 Ga0395899_0211418 Ga0395899_0211418_165_1298 368
266 3300037466 Ga0395898_0019341 Ga0395898_0019341_5609_6766 368
267 3300037466 Ga0395898_0073711 Ga0395898_0073711_164_1333 368
268 3300039437 Ga0436365_1454613 Ga0436365_1454613_16013_17191 368
269 3300039450 Ga0436363_1202288 Ga0436363_1202288_837_2006 368
270 3300041411 Ga0439466_0002013 Ga0439466_0002013_1894_3054 368
271 3300041997 Ga0439431_0016174 Ga0439431_0016174_566_1726 368
272 3300042004 Ga0439445_0006588 Ga0439445_0006588_73_1233 368
273 3300042004 Ga0439445_0012073 Ga0439445_0012073_129_1292 368
274 3300042007 Ga0439449_0002617 Ga0439449_0002617_3677_4834 368
275 3300044656 Ga0466969_0000846 Ga0466969_0000846_6604_7755 368
276 3300044656 Ga0466969_0009134 Ga0466969_0009134_2277_3434 368
277 3300044656 Ga0466969_0038869 Ga0466969_0038869_878_2035 368
278 3300044658 Ga0466972_0009994 Ga0466972_0009994_1984_3141 368
279 3300044658 Ga0466972_0017379 Ga0466972_0017379_1743_2900 368
280 3300044658 Ga0466972_0102979 Ga0466972_0102979_98_1255 368
281 3300044683 Ga0466965_0002082 Ga0466965_0002082_6942_8099 368
282 3300044683 Ga0466965_0012273 Ga0466965_0012273_331_1488 368
283 3300044684 Ga0466966_0003063 Ga0466966_0003063_4814_5971 368
284 3300044684 Ga0466966_0005284 Ga0466966_0005284_5705_6856 368
285 3300044693 Ga0466961_0003182 Ga0466961_0003182_4820_5977 368
286 3300044693 Ga0466961_0008823 Ga0466961_0008823_5249_6415 368
287 3300044693 Ga0466961_0013620 Ga0466961_0013620_602_1777 368
288 3300044693 Ga0466961_0030248 Ga0466961_0030248_1865_3034 368
289 3300044693 Ga0466961_0033501 Ga0466961_0033501_1253_2422 368
290 3300044693 Ga0466961_0178762 Ga0466961_0178762_108_1277 368
291 3300044694 Ga0466963_0004229 Ga0466963_0004229_763_1920 368
292 3300044694 Ga0466963_0076383 Ga0466963_0076383_438_1607 368
293 3300044719 Ga0466971_0002502 Ga0466971_0002502_4835_6010 368
294 3300044719 Ga0466971_0005752 Ga0466971_0005752_2631_3788 368
295 3300044765 Ga0466970_0001367 Ga0466970_0001367_7184_8290 368
296 3300044765 Ga0466970_0009534 Ga0466970_0009534_3007_4164 368
297 3300044765 Ga0466970_0030900 Ga0466970_0030900_551_1708 368
298 3300044842 Ga0466957_0013876 Ga0466957_0013876_1767_2930 368
299 3300044842 Ga0466957_0025933 Ga0466957_0025933_2170_3327 368
300 3300044842 Ga0466957_0085446 Ga0466957_0085446_561_1718 368
301 3300044901 Ga0466960_0003863 Ga0466960_0003863_508_1665 368
302 3300044901 Ga0466960_0048841 Ga0466960_0048841_819_1976 368
303 3300045049 Ga0466959_0062851 Ga0466959_0062851_1345_2502 368
304 3300045049 Ga0466959_0158963 Ga0466959_0158963_11_1162 368
305 3300045836 Ga0466958_0006001 Ga0466958_0006001_5085_6242 368
306 3300045836 Ga0466958_0032433 Ga0466958_0032433_239_1408 368
307 3300045836 Ga0466958_0068668 Ga0466958_0068668_10_1185 368
308 3300045836 Ga0466958_0093686 Ga0466958_0093686_50_1159 368
309 3300045836 Ga0466958_0127562 Ga0466958_0127562_358_1515 368
310 3300045976 Ga0466967_0018994 Ga0466967_0018994_1281_2438 368
311 3300045976 Ga0466967_0029072 Ga0466967_0029072_2888_4045 368
312 3300045976 Ga0466967_0032778 Ga0466967_0032778_2256_3431 368
313 3300045976 Ga0466967_0033369 Ga0466967_0033369_1183_2355 368
314 3300045976 Ga0466967_0083055 Ga0466967_0083055_730_1884 368
315 3300045976 Ga0466967_0110410 Ga0466967_0110410_778_1935 368
316 3300045976 Ga0466967_0237208 Ga0466967_0237208_112_1284 368
317 3300045976 Ga0466967_0352950 Ga0466967_0352950_224_1393 368
318 3300046454 Ga0495592_0003573 Ga0495592_0003573_51_1208 368
319 3300046455 Ga0495603_0002583 Ga0495603_0002583_6296_7453 368
320 3300046459 Ga0495629_0000935 Ga0495629_0000935_5472_6629 368
321 3300046459 Ga0495629_0016409 Ga0495629_0016409_4129_5286 368
322 3300046460 Ga0495638_0161869 Ga0495638_0161869_140_1246 368
323 3300046473 Ga0495582_0165582 Ga0495582_0165582_56_1228 368
324 3300046475 Ga0495639_0115322 Ga0495639_0115322_92_1255 368
325 3300046499 Ga0495594_0000163 Ga0495594_0000163_26361_27518 368
326 3300046514 Ga0495618_0126629 Ga0495618_0126629_442_1599 368
327 3300046516 Ga0495628_0070054 Ga0495628_0070054_911_2068 368
328 3300046519 Ga0495632_0038855 Ga0495632_0038855_1185_2339 368
329 3300046526 Ga0495666_0088144 Ga0495666_0088144_62_1237 368
330 3300046529 Ga0495652_0017946 Ga0495652_0017946_601_1758 368
331 3300046533 Ga0495640_0009935 Ga0495640_0009935_5825_6982 368
332 3300046557 Ga0495622_0006021 Ga0495622_0006021_853_2010 368
333 3300046558 Ga0495633_0078038 Ga0495633_0078038_45_1202 368
334 3300046642 Ga0495634_0001735 Ga0495634_0001735_8430_9587 368
335 3300046674 Ga0495588_0002102 Ga0495588_0002102_7346_8503 368
336 3300046675 Ga0495657_0020317 Ga0495657_0020317_2180_3337 368
337 3300046689 Ga0495613_0038905 Ga0495613_0038905_2293_3450 368
338 3300047315 Ga0495581_0063805 Ga0495581_0063805_944_2101 368
339 3300047321 Ga0495676_0003711 Ga0495676_0003711_12359_13516 368
340 3300047321 Ga0495676_0073916 Ga0495676_0073916_499_1674 368
341 3300047443 Ga0495687_011713 Ga0495687_011713_1628_2785 368
342 3300048903 Ga0496100_0000585 Ga0496100_0000585_1229_2398 368
343 3300048903 Ga0496100_0041670 Ga0496100_0041670_1083_2258 368
344 3300048904 Ga0496101_0000032 Ga0496101_0000032_67754_68890 368
345 3300048904 Ga0496101_0009524 Ga0496101_0009524_4048_5205 368
346 3300048904 Ga0496101_0094305 Ga0496101_0094305_286_1461 368
347 3300048905 Ga0496102_0000127 Ga0496102_0000127_75645_76814 368
348 3300048905 Ga0496102_0030323 Ga0496102_0030323_2313_3488 368
349 3300048905 Ga0496102_0077331 Ga0496102_0077331_1616_2785 368
350 3300048905 Ga0496102_0261709 Ga0496102_0261709_16_1173 368
351 3300048906 Ga0496103_0000134 Ga0496103_0000134_26987_28156 368
352 3300048906 Ga0496103_0000801 Ga0496103_0000801_18006_19142 368
353 3300048907 Ga0496104_0002487 Ga0496104_0002487_3964_5121 368
354 3300048907 Ga0496104_0141859 Ga0496104_0141859_816_1964 368
355 3300048908 Ga0496105_0019641 Ga0496105_0019641_988_2163 368
356 3300048909 Ga0496106_0005776 Ga0496106_0005776_1519_2655 368
357 3300048910 Ga0496107_0000546 Ga0496107_0000546_8608_9744 368
358 3300048910 Ga0496107_0066165 Ga0496107_0066165_660_1829 368
359 3300048911 Ga0496108_0000016 Ga0496108_0000016_113877_115031 368
360 3300048911 Ga0496108_0006276 Ga0496108_0006276_8467_9603 368
361 3300048911 Ga0496108_0035866 Ga0496108_0035866_1250_2425 368
362 3300048911 Ga0496108_0037206 Ga0496108_0037206_2342_3511 368
363 3300048912 Ga0496109_0000030 Ga0496109_0000030_35661_36797 368
364 3300048913 Ga0496110_0001248 Ga0496110_0001248_10462_11598 368
365 3300048914 Ga0496111_0010739 Ga0496111_0010739_453_1589 368
366 3300048914 Ga0496111_0114347 Ga0496111_0114347_797_1972 368
367 3300048915 Ga0496112_0024584 Ga0496112_0024584_2038_3213 368
368 3300048915 Ga0496112_0028106 Ga0496112_0028106_3991_5148 368
369 3300048917 Ga0496114_0000187 Ga0496114_0000187_38139_39275 368
370 3300048918 Ga0496115_0014978 Ga0496115_0014978_4635_5810 368
371 3300048918 Ga0496115_0018585 Ga0496115_0018585_2410_3546 368
372 3300048919 Ga0496116_0000228 Ga0496116_0000228_27955_29124 368
373 3300048919 Ga0496116_0002431 Ga0496116_0002431_4522_5658 368
374 3300048920 Ga0496117_0000204 Ga0496117_0000204_28023_29192 368
375 3300048921 Ga0496118_0000202 Ga0496118_0000202_75641_76810 368
376 3300048921 Ga0496118_0004508 Ga0496118_0004508_104_1240 368
377 3300048922 Ga0496119_0000700 Ga0496119_0000700_6437_7594 368
378 3300048922 Ga0496119_0001772 Ga0496119_0001772_13526_14662 368
379 3300048922 Ga0496119_0053789 Ga0496119_0053789_734_1903 368
380 3300048923 Ga0496120_0006080 Ga0496120_0006080_852_2009 368
381 3300048923 Ga0496120_0009258 Ga0496120_0009258_1823_2959 368
382 3300048924 Ga0496121_0000004 Ga0496121_0000004_358479_359615 368
383 3300048924 Ga0496121_0016157 Ga0496121_0016157_5722_6891 368
384 3300048925 Ga0496122_0000173 Ga0496122_0000173_117894_119030 368
385 3300048926 Ga0496123_0005483 Ga0496123_0005483_7748_8884 368
386 3300048927 Ga0496124_0000012 Ga0496124_0000012_83272_84408 368
387 3300048927 Ga0496124_0005696 Ga0496124_0005696_1570_2727 368
388 3300048928 Ga0496125_0000003 Ga0496125_0000003_830153_831289 368
389 3300048928 Ga0496125_0033162 Ga0496125_0033162_2241_3410 368
390 3300048929 Ga0496126_0000001 Ga0496126_0000001_358479_359615 368
391 3300048929 Ga0496126_0000490 Ga0496126_0000490_27142_28311 368
392 3300048929 Ga0496126_0005743 Ga0496126_0005743_9401_10558 368
393 3300049127 Ga0501306_006800 Ga0501306_006800_31_1188 368
394 3300049568 Ga0501031_0085994 Ga0501031_0085994_475_1632 368
395 3300049568 Ga0501031_0174351 Ga0501031_0174351_226_1389 368
396 3300049569 Ga0501032_0012121 Ga0501032_0012121_18_1124 368
397 3300049569 Ga0501032_0018279 Ga0501032_0018279_3049_4206 368
398 3300049569 Ga0501032_0176057 Ga0501032_0176057_202_1371 368
399 3300049570 Ga0501033_0037100 Ga0501033_0037100_1360_2517 368
400 3300049571 Ga0501034_0029682 Ga0501034_0029682_1229_2386 368
401 3300049571 Ga0501034_0115224 Ga0501034_0115224_150_1307 368
402 3300049572 Ga0501036_0014103 Ga0501036_0014103_2276_3433 368
403 3300049572 Ga0501036_0021901 Ga0501036_0021901_3574_4731 368
404 3300049573 Ga0501037_0218824 Ga0501037_0218824_159_1322 368
405 3300049575 Ga0501039_0027953 Ga0501039_0027953_2920_4077 368
406 3300049579 Ga0501043_0020781 Ga0501043_0020781_2416_3573 368
407 3300049579 Ga0501043_0079572 Ga0501043_0079572_1269_2426 368
408 3300049581 Ga0501047_0015027 Ga0501047_0015027_1176_2333 368
409 3300049585 Ga0501069_0003390 Ga0501069_0003390_1974_3143 368
410 3300049586 Ga0501070_0000776 Ga0501070_0000776_16811_17980 368
411 3300049586 Ga0501070_0002928 Ga0501070_0002928_12313_13482 368
412 3300049586 Ga0501070_0027795 Ga0501070_0027795_2761_3930 368
413 3300049586 Ga0501070_0119336 Ga0501070_0119336_104_1258 368
414 3300049586 Ga0501070_0155067 Ga0501070_0155067_405_1562 368
415 3300049590 Ga0501074_0001371 Ga0501074_0001371_12324_13493 368
416 3300049590 Ga0501074_0088732 Ga0501074_0088732_179_1348 368
417 3300049741 Ga0501079_0000029 Ga0501079_0000029_45591_46760 368
418 3300049742 Ga0501080_0002688 Ga0501080_0002688_12740_13909 368
419 3300049742 Ga0501080_0003657 Ga0501080_0003657_5739_6908 368
420 3300049742 Ga0501080_0035713 Ga0501080_0035713_1119_2288 368
421 3300049742 Ga0501080_0076972 Ga0501080_0076972_1191_2366 368
422 3300049822 Ga0501035_0055060 Ga0501035_0055060_1165_2337 368
423 3300049822 Ga0501035_0131803 Ga0501035_0131803_406_1563 368
424 3300049823 Ga0501044_0040078 Ga0501044_0040078_686_1843 368
425 3300049823 Ga0501044_0063753 Ga0501044_0063753_2637_3749 368
426 3300049823 Ga0501044_0073502 Ga0501044_0073502_1941_3110 368
427 3300050491 nmdc:mga00v17_42584_c1 nmdc:mga00v17_42584_c1_1312_2472 368
428 3300050511 nmdc:mga08y16_275542_c1 nmdc:mga08y16_275542_c1_129_1292 368
429 3300050513 nmdc:mga0rr50_117988_c1 nmdc:mga0rr50_117988_c1_969_2090 368
430 3300050514 nmdc:mga08x19_44646_c1 nmdc:mga08x19_44646_c1_331_1506 368
431 3300050515 nmdc:mga0a205_133915_c1 nmdc:mga0a205_133915_c1_297_1472 368
432 3300050516 nmdc:mga0sz30_1287_c2 nmdc:mga0sz30_1287_c2_2141_3304 368
433 3300053118 Ga0500594_0009201 Ga0500594_0009201_990_2144 368
434 3300053131 Ga0500652_021611 Ga0500652_021611_1069_2223 368
435 3300053139 Ga0500568_0000585 Ga0500568_0000585_10282_11433 368
436 3300053143 Ga0500579_099760 Ga0500579_099760_100_1254 368
437 3300061719 Ga0466962_0003681 Ga0466962_0003681_2198_3373 368
438 3300061719 Ga0466962_0006111 Ga0466962_0006111_1461_2618 368
439 3300061719 Ga0466962_0014701 Ga0466962_0014701_2051_3208 368
440 iso_pu_bacteria 2501939600 2501943218 368
441 iso_pu_bacteria 2643221670 2644388209 368
442 iso_pu_bacteria 2643221715 2644635843 368
443 iso_pu_bacteria 2675903059 2676480367 368
444 iso_pu_bacteria 2751185782 2753263609 368
445 iso_pu_bacteria 2791354901 2791916742 368
446 iso_pu_bacteria 2808606375 2808920279 368
447 iso_pu_bacteria 2842888712 2842892125 368
448 iso_pu_bacteria 2855683550 2855684897 368
449 iso_pu_bacteria 2856858025 2856860616 368
450 iso_pu_bacteria 2858868258 2858868726 368
451 iso_pu_bacteria 2862290372 2862294322 368
452 iso_pu_bacteria 2862705112 2862710054 368
453 iso_pu_bacteria 2866552031 2866554162 368
454 iso_pu_bacteria 2867428634 2867434309 368
455 iso_pu_bacteria 2868088558 2868094250 368
456 iso_pu_bacteria 2902582711 2902586125 368
457 iso_pu_bacteria 2902810491 2902813299 368
458 iso_pu_bacteria 2912723979 2912724592 368
459 iso_pu_bacteria 2919468124 2919475235 368
460 iso_pu_bacteria 2990044586 2990047230 368
461 iso_pu_bacteria 2995463766 2995467899 368
462 iso_pu_bacteria 2995463766 2995469680 368
463 iso_pu_bacteria 3006321560 3006324365 368
464 iso_pu_bacteria 3006393351 3006394966 368
465 iso_pu_bacteria 649633069 649811351 368
466 iso_pu_bacteria 8003856774 8003860721 368
467 iso_pu_bacteria 8008485437 8008488308 368
468 iso_pu_bacteria 8008574985 8008579130 368
469 iso_pu_bacteria 8025413630 8025416816 368
470 iso_pu_bacteria 8025524527 8025530233 368
471 iso_pu_bacteria 8054472261 8054475142 368
472 iso_pu_bacteria 8056829672 8056835356 368

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

259

409

0.97

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

37

148

0.97

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

274

398

0.96

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

152

247

0.92

PF22924

ACOX_C_alpha1

Acyl-CoA oxidase, C-alpha1 domain

266

409

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pfd-assembly1.cif.gz_A crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr 0.9973 2 367
3pfd-assembly5.cif.gz_D crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr 0.997 2 367
3pfd-assembly4.cif.gz_C crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr 0.9959 2 367
7w0j-assembly1.cif.gz_F acyl-coa dehydrogenase, tfu_1647 0.9928 2 367
7w0j-assembly1.cif.gz_D acyl-coa dehydrogenase, tfu_1647 0.9924 2 367
ID Description Score Start End Superfamily
af_P9WQG1_243_389_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9988 225 367 1.20.140.10
3pfdA01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9983 2 109 1.10.540.10
3pfdA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9933 221 368 1.20.140.10
3pfdD03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9933 221 368 1.20.140.10
3pfdB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9932 221 368 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A7Y6EYD0-F1-model_v4 Acyl-CoA dehydrogenase 0.9978 1 368 GO:0003995
GO:0050660
AF-A0A239KG45-F1-model_v4 Acyl-CoA dehydrogenase 0.9968 1 367 GO:0003995
GO:0050660
AF-A0A2S8MMP0-F1-model_v4 deleted 0.9962 61 203
AF-A0A7Y6EYD0-F1-model_v4 Acyl-CoA dehydrogenase 0.9951 1 368 GO:0003995
GO:0050660
AF-A0A101WSS0-F1-model_v4 Acyl-CoA dehydrogenase 0.9918 1 367 GO:0003995
GO:0050660

Feature Viewer

pLDDT pTM Quality
96.96 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map