metagRoot

F450725

General Info

Members	Datasets	Scaffolds	Average Seq Length
472	256	471	146

Family's Representative Sequence

Representative Sequence	3300005329\|Ga0070683_100236418\|Ga0070683_1002364182
Length	177
Sequence	MSADCSPFATAAGGPFAGRVDPLWRLHSSQGIGMPATVYVLNGPNLNLLGFREPTIYGNDTLDDIAGMLEDRARELGLEVDMRQSNHEGHLVDWLHEAHFAGAKAVILNAAAFTHTSIAILDAIKSIKVPVIEVHISDPLMREPFRHISYVEMGAVATVKGMGARGYVVALEKAAEL

Samples

	Sample ID	Description	Type	Environment
1	2582581305	Rhizorhabdus wittichii YR128	Isolate	Rhizosphere
2	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
3	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
4	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
5	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
6	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
7	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
8	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
9	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
10	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
11	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
12	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
13	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
14	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
15	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
16	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
17	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
18	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
21	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
22	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
23	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
24	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
25	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
26	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
27	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
28	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
29	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
30	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
31	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
32	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
33	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
34	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
35	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
36	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
37	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
38	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
39	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
40	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
41	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
42	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
43	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
44	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
45	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
46	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
47	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
48	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
49	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
50	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
51	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
52	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
53	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
54	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
55	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
56	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
57	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
58	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
59	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
60	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
62	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
63	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
64	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
65	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
66	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
67	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
68	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
69	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
70	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
71	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
72	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
73	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
74	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
75	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
76	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
77	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
78	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
79	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
80	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
81	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
82	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
83	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
84	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
85	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
86	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
87	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
88	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
89	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
90	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
91	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
93	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
94	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
95	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
135	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
139	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
140	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
141	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
142	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
143	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
144	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
145	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
146	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
147	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
148	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
149	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
150	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
151	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
152	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
153	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
154	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
155	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
156	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
157	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
158	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
159	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
160	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
161	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
162	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
163	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
164	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
165	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
166	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
167	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
168	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
169	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
170	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
171	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
172	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
173	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
174	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
175	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
176	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
177	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
178	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
179	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
180	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
181	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
182	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
183	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
184	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
185	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
186	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
187	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
188	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
189	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
190	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
191	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
192	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
193	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
194	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
195	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
196	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
197	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
198	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
199	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
200	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
201	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
202	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
203	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
204	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
205	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
206	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
207	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
208	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
209	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
210	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
211	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
212	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
213	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
214	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
215	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
218	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
220	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
221	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
222	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
223	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
224	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
225	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
227	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
228	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
229	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
230	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
231	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
232	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
233	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
234	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
235	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
236	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
237	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
238	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
239	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
240	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
241	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
242	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
243	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
244	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
245	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
246	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
247	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
248	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
249	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
250	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
251	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
252	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
253	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
254	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
255	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
256	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.79
Metatranscriptomes	0
Isolates	0.21

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	17.16
Nodule	0
Rhizoplane	4.87
Rhizosphere	72.25
Stem	0
Stem Tuber	0
Unclassified	5.72

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24735J21928_10007574	3300002067	Bacteria	3539
2	JGI25150J39212_1000428	3300002774	Bacteria	19227
3	JGI25151J46595_10020919	3300003187	Bacteria	2747
4	JGI25153J46596_10000286	3300003215	Bacteria	38559
5	Ga0055526_1009344	3300003771	Bacteria	4732
6	Ga0055537_1003208	3300003773	Bacteria	5107
7	Ga0055536_1009589	3300003781	Bacteria	3975
8	Ga0055530_10039684	3300003791	Bacteria	1161
9	Ga0055540_1001278	3300003792	Bacteria	15307
10	Ga0065712_10204789	3300005290	Bacteria	1095
11	Ga0070658_10061993	3300005327	Bacteria	3047
12	Ga0070658_10309536	3300005327	Bacteria	1348
13	Ga0070658_10395828	3300005327	Bacteria	1186
14	Ga0070683_100236418	3300005329	Bacteria	1737
15	Ga0070670_100000027	3300005331	Bacteria	186072
16	Ga0070670_100110803	3300005331	Bacteria	2365
17	Ga0070670_101132797	3300005331	Bacteria	714
18	Ga0070666_10058403	3300005335	Bacteria	2608
19	Ga0070680_101063852	3300005336	Bacteria	699
20	Ga0070680_101315335	3300005336	Bacteria	626
21	Ga0068868_100000011	3300005338	Bacteria	117273
22	Ga0070660_100002217	3300005339	Bacteria	13392
23	Ga0070660_100164030	3300005339	Bacteria	1792
24	Ga0070660_100274927	3300005339	Bacteria	1377
25	Ga0070661_100003418	3300005344	Bacteria	10964
26	Ga0070661_100622354	3300005344	Bacteria	874
27	Ga0070668_100091910	3300005347	Bacteria	2393
28	Ga0070668_100132347	3300005347	Bacteria	2003
29	Ga0070669_100051006	3300005353	Bacteria	3023
30	Ga0070669_100096449	3300005353	Bacteria	2225
31	Ga0070669_100651981	3300005353	Bacteria	886
32	Ga0070675_100006222	3300005354	Bacteria	9157
33	Ga0070671_100000066	3300005355	Bacteria	70998
34	Ga0070671_100040627	3300005355	Bacteria	3864
35	Ga0070671_100791565	3300005355	Bacteria	825
36	Ga0070688_100292492	3300005365	Bacteria	1174
37	Ga0070659_100000004	3300005366	Bacteria	267958
38	Ga0070659_100146196	3300005366	Bacteria	1926
39	Ga0070667_100000280	3300005367	Bacteria	58186
40	Ga0070667_100056154	3300005367	Bacteria	3325
41	Ga0070667_100080843	3300005367	Bacteria	2780
42	Ga0070663_100011683	3300005455	Bacteria	5522
43	Ga0070663_100220548	3300005455	Bacteria	1489
44	Ga0070663_101071412	3300005455	Bacteria	704
45	Ga0070662_100018172	3300005457	Bacteria	4752
46	Ga0070685_10129756	3300005466	Bacteria	1575
47	Ga0070679_100042024	3300005530	Bacteria	4552
48	Ga0070679_100169900	3300005530	Bacteria	2153
49	Ga0070679_100313001	3300005530	Bacteria	1520
50	Ga0070684_100224824	3300005535	Bacteria	1713
51	Ga0068853_100335425	3300005539	Bacteria	1404
52	Ga0070686_100034811	3300005544	Bacteria	3106
53	Ga0070693_101060810	3300005547	Bacteria	616
54	Ga0070665_100045063	3300005548	Bacteria	4428
55	Ga0068855_100019338	3300005563	Bacteria	8184
56	Ga0068855_100078544	3300005563	Bacteria	3828
57	Ga0068855_100477775	3300005563	Bacteria	1357
58	Ga0068854_100002728	3300005578	Bacteria	10957
59	Ga0068854_101763658	3300005578	Bacteria	567
60	Ga0068856_100013388	3300005614	Bacteria	7941
61	Ga0068852_100019487	3300005616	Bacteria	5371
62	Ga0068852_100030982	3300005616	Bacteria	4408
63	Ga0068852_100080737	3300005616	Bacteria	2885
64	Ga0068852_100107888	3300005616	Bacteria	2527
65	Ga0068852_100202970	3300005616	Bacteria	1877
66	Ga0068852_100351138	3300005616	Bacteria	1440
67	Ga0068859_100011652	3300005617	Bacteria	8837
68	Ga0068859_100029205	3300005617	Bacteria	5533
69	Ga0068859_100158056	3300005617	Bacteria	2345
70	Ga0068859_100645459	3300005617	Bacteria	1151
71	Ga0068859_101161312	3300005617	Bacteria	850
72	Ga0068864_100000083	3300005618	Bacteria	100972
73	Ga0068864_100058695	3300005618	Bacteria	3327
74	Ga0068864_100196533	3300005618	Bacteria	1851
75	Ga0068863_100000025	3300005841	Bacteria	186072
76	Ga0068858_100658097	3300005842	Bacteria	1018
77	Ga0068860_100258924	3300005843	Bacteria	1695
78	Ga0068862_100000027	3300005844	Bacteria	186072
79	Ga0068862_100258631	3300005844	Bacteria	1588
80	Ga0068862_100356674	3300005844	Bacteria	1358
81	Ga0075365_10067981	3300006038	Bacteria	2393
82	Ga0075368_10000199	3300006042	Bacteria	16601
83	Ga0075363_100000482	3300006048	Bacteria	12603
84	Ga0075363_100017436	3300006048	Bacteria	3561
85	Ga0075364_10151087	3300006051	Bacteria	1565
86	Ga0075432_10001279	3300006058	Bacteria	8117
87	Ga0075362_10000104	3300006177	Bacteria	23319
88	Ga0075362_10002982	3300006177	Bacteria	5822
89	Ga0075362_10046036	3300006177	Bacteria	1939
90	Ga0075367_10022138	3300006178	Bacteria	3561
91	Ga0075369_10002202	3300006186	Bacteria	6896
92	Ga0075369_10010168	3300006186	Bacteria	3676
93	Ga0075369_10120093	3300006186	Bacteria	1189
94	Ga0075366_10000768	3300006195	Bacteria	15283
95	Ga0075366_10037143	3300006195	Bacteria	2874
96	Ga0075370_10000032	3300006353	Bacteria	44839
97	Ga0075370_10141938	3300006353	Bacteria	1404
98	Ga0068871_100673795	3300006358	Bacteria	946
99	Ga0075428_100237247	3300006844	Bacteria	1968
100	Ga0075429_100400288	3300006880	Bacteria	1202
101	Ga0068865_101072396	3300006881	Bacteria	708
102	Ga0097620_100011652	3300006931	Bacteria	8837
103	Ga0097620_100029209	3300006931	Bacteria	5533
104	Ga0097620_100104486	3300006931	Bacteria	2892
105	Ga0097620_100158056	3300006931	Bacteria	2345
106	Ga0097620_100645483	3300006931	Bacteria	1151
107	Ga0097620_101161188	3300006931	Bacteria	850
108	Ga0105251_10000138	3300009011	Bacteria	74430
109	Ga0105240_10025126	3300009093	Bacteria	7835
110	Ga0105240_10929068	3300009093	Bacteria	934
111	Ga0105240_10972789	3300009093	Bacteria	909
112	Ga0105245_10077314	3300009098	Bacteria	3034
113	Ga0105245_11486759	3300009098	Bacteria	728
114	Ga0105247_10000748	3300009101	Bacteria	25085
115	Ga0105248_10000026	3300009177	Bacteria	257155
116	Ga0105248_10008515	3300009177	Bacteria	11263
117	Ga0105248_10068163	3300009177	Bacteria	3995
118	Ga0105248_10130953	3300009177	Bacteria	2830
119	Ga0105237_10008177	3300009545	Bacteria	11365
120	Ga0105249_10000123	3300009553	Bacteria	104747
121	Ga0105249_10193697	3300009553	Bacteria	1985
122	Ga0105249_10439516	3300009553	Bacteria	1341
123	Ga0105249_10649168	3300009553	Bacteria	1113
124	Ga0105239_11569146	3300010375	Bacteria	761
125	Ga0157373_10158215	3300013100	Bacteria	1594
126	Ga0157373_10260105	3300013100	Bacteria	1228
127	Ga0157373_10291086	3300013100	Bacteria	1158
128	Ga0157371_10021859	3300013102	Bacteria	4694
129	Ga0157371_10265642	3300013102	Bacteria	1238
130	Ga0157371_10296906	3300013102	Bacteria	1169
131	Ga0157370_10363025	3300013104	Bacteria	1334
132	Ga0157370_10584498	3300013104	Bacteria	1023
133	Ga0157369_10001999	3300013105	Bacteria	24545
134	Ga0157374_12214134	3300013296	Bacteria	577
135	Ga0157378_10063422	3300013297	Bacteria	3302
136	Ga0157378_12133653	3300013297	Bacteria	611
137	Ga0163162_10034795	3300013306	Bacteria	5015
138	Ga0163162_10035659	3300013306	Bacteria	4956
139	Ga0157372_10155444	3300013307	Bacteria	2642
140	Ga0157372_10603024	3300013307	Bacteria	1280
141	Ga0157372_10709271	3300013307	Bacteria	1170
142	Ga0157375_10244894	3300013308	Bacteria	1953
143	Ga0157375_11200590	3300013308	Bacteria	890
144	Ga0163163_10454986	3300014325	Bacteria	1340
145	Ga0157380_10635580	3300014326	Bacteria	1062
146	Ga0157380_11264139	3300014326	Bacteria	784
147	Ga0157379_10012423	3300014968	Bacteria	7436
148	Ga0157379_10107937	3300014968	Bacteria	2499
149	Ga0157376_12398224	3300014969	Bacteria	567
150	Ga0163161_10702852	3300017792	Bacteria	842
151	Ga0213876_10006296	3300021384	Bacteria	6466
152	Ga0207425_1000041	3300025245	Bacteria	210441
153	Ga0209129_1003782	3300025258	Bacteria	6359
154	Ga0209565_1000134	3300025263	Bacteria	104013
155	Ga0209673_1022988	3300025273	Bacteria	2135
156	Ga0209676_1037917	3300025292	Bacteria	1384
157	Ga0209025_1000068	3300025294	Bacteria	294129
158	Ga0209564_1000622	3300025295	Bacteria	53970
159	Ga0209758_1000004	3300025297	Bacteria	1375322
160	Ga0209758_1043973	3300025297	Bacteria	1639
161	Ga0209050_1000001	3300025298	Bacteria	3563507
162	Ga0209050_1011695	3300025298	Bacteria	4125
163	Ga0207426_1043910	3300025302	Bacteria	1369
164	Ga0209051_1000191	3300025303	Bacteria	108763
165	Ga0209257_1003025	3300025304	Bacteria	15213
166	Ga0209257_1003254	3300025304	Bacteria	14226
167	Ga0207697_10089287	3300025315	Bacteria	1305
168	Ga0207713_1000497	3300025735	Bacteria	40486
169	Ga0207682_10003842	3300025893	Bacteria	6448
170	Ga0207680_10128705	3300025903	Bacteria	1666
171	Ga0207645_10285141	3300025907	Bacteria	1097
172	Ga0207705_10022699	3300025909	Bacteria	4476
173	Ga0207705_10183531	3300025909	Bacteria	1580
174	Ga0207705_10273704	3300025909	Bacteria	1291
175	Ga0207705_10515972	3300025909	Bacteria	928
176	Ga0207705_10990158	3300025909	Bacteria	650
177	Ga0207695_10351700	3300025913	Bacteria	1361
178	Ga0207671_10010589	3300025914	Bacteria	7593
179	Ga0207660_10734924	3300025917	Bacteria	805
180	Ga0207657_10005326	3300025919	Bacteria	13475
181	Ga0207657_10037866	3300025919	Bacteria	4301
182	Ga0207657_10453205	3300025919	Bacteria	1006
183	Ga0207657_11426295	3300025919	Bacteria	519
184	Ga0207649_10188238	3300025920	Bacteria	1449
185	Ga0207652_10021249	3300025921	Bacteria	5356
186	Ga0207652_10401521	3300025921	Bacteria	1237
187	Ga0207652_10982642	3300025921	Bacteria	743
188	Ga0207652_11532104	3300025921	Bacteria	571
189	Ga0207681_10036257	3300025923	Bacteria	3253
190	Ga0207681_10423221	3300025923	Bacteria	1079
191	Ga0207694_10978295	3300025924	Bacteria	716
192	Ga0207650_10000056	3300025925	Bacteria	157972
193	Ga0207650_10261582	3300025925	Bacteria	1404
194	Ga0207650_10263460	3300025925	Bacteria	1399
195	Ga0207659_10025377	3300025926	Bacteria	3982
196	Ga0207687_10496168	3300025927	Bacteria	1018
197	Ga0207644_10000353	3300025931	Bacteria	29799
198	Ga0207644_10027231	3300025931	Bacteria	3949
199	Ga0207690_10000001	3300025932	Bacteria	807539
200	Ga0207690_10000002	3300025932	Bacteria	807473
201	Ga0207690_10000003	3300025932	Bacteria	783011
202	Ga0207690_10000004	3300025932	Bacteria	746138
203	Ga0207706_10011270	3300025933	Bacteria	8147
204	Ga0207706_10030087	3300025933	Bacteria	4846
205	Ga0207704_10869963	3300025938	Bacteria	756
206	Ga0207711_10000004	3300025941	Bacteria	870636
207	Ga0207711_10000852	3300025941	Bacteria	29486
208	Ga0207711_10016018	3300025941	Bacteria	6220
209	Ga0207711_10047499	3300025941	Bacteria	3670
210	Ga0207661_10757722	3300025944	Bacteria	894
211	Ga0207667_10006417	3300025949	Bacteria	14247
212	Ga0207667_10619701	3300025949	Bacteria	1090
213	Ga0207667_11493607	3300025949	Bacteria	647
214	Ga0207712_10000102	3300025961	Bacteria	96444
215	Ga0207712_10570572	3300025961	Bacteria	975
216	Ga0207712_10592034	3300025961	Bacteria	958
217	Ga0207668_10012137	3300025972	Bacteria	5265
218	Ga0207640_10034269	3300025981	Bacteria	3167
219	Ga0207640_10325754	3300025981	Bacteria	1225
220	Ga0207658_10000251	3300025986	Bacteria	56192
221	Ga0207658_10051667	3300025986	Bacteria	3030
222	Ga0207658_10188072	3300025986	Bacteria	1714
223	Ga0207677_10000014	3300026023	Bacteria	181712
224	Ga0207703_10616974	3300026035	Bacteria	1027
225	Ga0207639_10263779	3300026041	Bacteria	1508
226	Ga0207639_10305241	3300026041	Bacteria	1408
227	Ga0207678_10040544	3300026067	Bacteria	4038
228	Ga0207678_10087488	3300026067	Bacteria	2663
229	Ga0207702_10027637	3300026078	Bacteria	4712
230	Ga0207641_10000018	3300026088	Bacteria	298209
231	Ga0207641_10487031	3300026088	Bacteria	1196
232	Ga0207676_10000027	3300026095	Bacteria	245868
233	Ga0207676_10554366	3300026095	Bacteria	1098
234	Ga0207675_100000159	3300026118	Bacteria	59714
235	Ga0207698_10063308	3300026142	Bacteria	2894
236	Ga0207698_10117589	3300026142	Bacteria	2243
237	Ga0207698_11361467	3300026142	Bacteria	725
238	Ga0207698_12624143	3300026142	Bacteria	513
239	Ga0209813_10000065	3300027866	Bacteria	42169
240	Ga0207428_10029569	3300027907	Bacteria	4539
241	Ga0268266_10000002	3300028379	Bacteria	3059047
242	Ga0268266_10003655	3300028379	Bacteria	15198
243	Ga0268266_10095883	3300028379	Bacteria	2606
244	Ga0268265_10000042	3300028380	Bacteria	186086
245	Ga0268265_10714998	3300028380	Bacteria	969
246	Ga0268265_10836974	3300028380	Bacteria	899
247	Ga0268265_11066393	3300028380	Bacteria	801
248	Ga0268264_10109883	3300028381	Bacteria	2413
249	Ga0307517_10036810	3300028786	Bacteria	5490
250	Ga0316177_1209949	3300030731	Bacteria	1073
251	Ga0316176_1117175	3300030732	Bacteria	2063
252	Ga0314311_1208813	3300030733	Bacteria	1369
253	Ga0316178_1079727	3300030735	Bacteria	1830
254	Ga0316180_1162834	3300030736	Bacteria	1440
255	Ga0316183_1030586	3300030742	Bacteria	1595
256	Ga0316181_1152471	3300030744	Bacteria	2295
257	Ga0316182_1073368	3300030745	Bacteria	2105
258	Ga0265327_10061872	3300031251	Bacteria	1907
259	Ga0307408_100124036	3300031548	Bacteria	2005
260	Ga0307408_100512894	3300031548	Bacteria	1052
261	Ga0307408_101642142	3300031548	Bacteria	611
262	Ga0307408_101804318	3300031548	Bacteria	585
263	Ga0307405_10049536	3300031731	Bacteria	2596
264	Ga0307405_10175876	3300031731	Bacteria	1531
265	Ga0307405_10402782	3300031731	Bacteria	1071
266	Ga0307405_10505993	3300031731	Bacteria	969
267	Ga0307405_11886640	3300031731	Bacteria	533
268	Ga0307413_10013491	3300031824	Bacteria	4111
269	Ga0307413_10025881	3300031824	Bacteria	3225
270	Ga0307413_10134022	3300031824	Bacteria	1700
271	Ga0307413_10248645	3300031824	Bacteria	1318
272	Ga0307413_10613164	3300031824	Bacteria	892
273	Ga0307413_11728441	3300031824	Bacteria	558
274	Ga0307410_10012419	3300031852	Bacteria	4925
275	Ga0307410_10152459	3300031852	Bacteria	1722
276	Ga0307410_10153824	3300031852	Bacteria	1715
277	Ga0307410_10343872	3300031852	Bacteria	1190
278	Ga0307406_10021183	3300031901	Bacteria	3842
279	Ga0307406_10111215	3300031901	Bacteria	1886
280	Ga0307406_10114147	3300031901	Bacteria	1865
281	Ga0307406_10192728	3300031901	Bacteria	1493
282	Ga0307406_10410656	3300031901	Bacteria	1076
283	Ga0307407_10011384	3300031903	Bacteria	4232
284	Ga0307407_10147320	3300031903	Bacteria	1526
285	Ga0307407_10171038	3300031903	Bacteria	1431
286	Ga0307407_10595471	3300031903	Bacteria	823
287	Ga0307412_10036143	3300031911	Bacteria	3161
288	Ga0307412_10238780	3300031911	Bacteria	1404
289	Ga0307412_10311747	3300031911	Bacteria	1248
290	Ga0307412_10527697	3300031911	Bacteria	987
291	Ga0307412_11012934	3300031911	Bacteria	734
292	Ga0307409_100049773	3300031995	Bacteria	3197
293	Ga0307409_100098653	3300031995	Bacteria	2416
294	Ga0307409_100401734	3300031995	Bacteria	1309
295	Ga0307409_100486545	3300031995	Bacteria	1198
296	Ga0307409_101117609	3300031995	Bacteria	810
297	Ga0307409_101343234	3300031995	Bacteria	740
298	Ga0307409_102345992	3300031995	Bacteria	563
299	Ga0307416_100054480	3300032002	Bacteria	3215
300	Ga0307416_100263928	3300032002	Bacteria	1685
301	Ga0307416_100285878	3300032002	Bacteria	1629
302	Ga0307416_100472001	3300032002	Bacteria	1312
303	Ga0307416_100577786	3300032002	Bacteria	1201
304	Ga0307416_100752034	3300032002	Bacteria	1067
305	Ga0307416_100843082	3300032002	Bacteria	1014
306	Ga0307416_101025737	3300032002	Bacteria	928
307	Ga0307414_10018012	3300032004	Bacteria	4335
308	Ga0307414_10030107	3300032004	Bacteria	3542
309	Ga0307414_10048302	3300032004	Bacteria	2935
310	Ga0307414_10074054	3300032004	Bacteria	2466
311	Ga0307414_10117967	3300032004	Bacteria	2034
312	Ga0307414_10133230	3300032004	Bacteria	1933
313	Ga0307414_10190947	3300032004	Bacteria	1657
314	Ga0307414_10218419	3300032004	Bacteria	1563
315	Ga0307414_10263161	3300032004	Bacteria	1440
316	Ga0307414_10394078	3300032004	Bacteria	1201
317	Ga0307414_10415904	3300032004	Bacteria	1171
318	Ga0307414_10687897	3300032004	Bacteria	925
319	Ga0307414_10792225	3300032004	Bacteria	864
320	Ga0307411_10079744	3300032005	Bacteria	2249
321	Ga0307411_10250383	3300032005	Bacteria	1392
322	Ga0307411_10543800	3300032005	Bacteria	990
323	Ga0307411_10640689	3300032005	Bacteria	919
324	Ga0307411_10880551	3300032005	Bacteria	794
325	Ga0307415_100094059	3300032126	Bacteria	2178
326	Ga0307415_100139626	3300032126	Bacteria	1848
327	Ga0307415_100334287	3300032126	Bacteria	1269
328	Ga0307415_102378848	3300032126	Bacteria	520
329	Ga0373931_0111729	3300035691	Bacteria	1551
330	Ga0316582_0034395	3300036647	Bacteria	3121
331	Ga0316584_0115052	3300036712	Bacteria	2012
332	Ga0316584_0430242	3300036712	Bacteria	936
333	Ga0395905_0053671	3300037471	Bacteria	3772
334	Ga0395905_0432060	3300037471	Bacteria	1214
335	Ga0395905_0749256	3300037471	Bacteria	879
336	Ga0436364_1467807	3300037853	Bacteria	1170
337	Ga0436365_0654934	3300039437	Bacteria	2738
338	Ga0436365_0969639	3300039437	Bacteria	1129
339	Ga0436365_1451957	3300039437	Bacteria	18903
340	Ga0436363_0386512	3300039450	Bacteria	2357
341	Ga0451843_1695510	3300041509	Bacteria	1249
342	Ga0466970_0178210	3300044765	Bacteria	1179
343	Ga0495617_048383	3300046452	Bacteria	1415
344	Ga0495629_0442174	3300046459	Bacteria	881
345	Ga0495638_0000033	3300046460	Bacteria	288195
346	Ga0495650_0199300	3300046471	Bacteria	696
347	Ga0495596_0005241	3300046500	Bacteria	6158
348	Ga0495583_0001255	3300046506	Bacteria	26748
349	Ga0495606_0111417	3300046507	Bacteria	1650
350	Ga0495610_0005814	3300046512	Bacteria	8669
351	Ga0495610_0071589	3300046512	Bacteria	1616
352	Ga0495616_0000539	3300046513	Bacteria	28561
353	Ga0495616_0233607	3300046513	Bacteria	796
354	Ga0495632_0013736	3300046519	Bacteria	4608
355	Ga0495637_0016937	3300046520	Bacteria	3403
356	Ga0495643_0103042	3300046522	Bacteria	1460
357	Ga0495643_0180573	3300046522	Bacteria	1026
358	Ga0495648_0000014	3300046524	Bacteria	288365
359	Ga0495598_0000657	3300046537	Bacteria	6538
360	Ga0495621_0027191	3300046539	Bacteria	1935
361	Ga0495621_0053301	3300046539	Bacteria	1452
362	Ga0495656_0732975	3300046615	Bacteria	532
363	Ga0495668_0014596	3300046616	Bacteria	4601
364	Ga0495668_0046828	3300046616	Bacteria	2402
365	Ga0495625_0072494	3300046660	Bacteria	2415
366	Ga0495671_0000019	3300046692	Bacteria	288186
367	Ga0495676_0431714	3300047321	Bacteria	871
368	Ga0495673_0000042	3300047469	Bacteria	288018
369	Ga0495673_0103407	3300047469	Bacteria	1148
370	Ga0495686_0001246	3300047472	Bacteria	29040
371	Ga0495686_0055212	3300047472	Bacteria	2485
372	Ga0495626_0001920	3300048091	Bacteria	15460
373	Ga0496100_0375963	3300048903	Bacteria	1078
374	Ga0496101_0142872	3300048904	Bacteria	1825
375	Ga0496102_0000418	3300048905	Bacteria	49009
376	Ga0496102_0256838	3300048905	Bacteria	1647
377	Ga0496103_0000274	3300048906	Bacteria	49009
378	Ga0496103_0008979	3300048906	Bacteria	5927
379	Ga0496103_0174523	3300048906	Bacteria	1381
380	Ga0496104_0200074	3300048907	Bacteria	1910
381	Ga0496104_0512414	3300048907	Bacteria	1111
382	Ga0496105_0222410	3300048908	Bacteria	1536
383	Ga0496105_0289410	3300048908	Bacteria	1319
384	Ga0496105_0412181	3300048908	Bacteria	1071
385	Ga0496106_0010127	3300048909	Bacteria	6964
386	Ga0496107_0630577	3300048910	Bacteria	791
387	Ga0496108_0234653	3300048911	Bacteria	1595
388	Ga0496109_0581159	3300048912	Bacteria	1056
389	Ga0496110_0070535	3300048913	Bacteria	3096
390	Ga0496110_0270538	3300048913	Bacteria	1547
391	Ga0496111_0017065	3300048914	Bacteria	5012
392	Ga0496113_0000445	3300048916	Bacteria	20040
393	Ga0496113_0803602	3300048916	Bacteria	747
394	Ga0496114_0071065	3300048917	Bacteria	2924
395	Ga0496115_0008325	3300048918	Bacteria	7669
396	Ga0496116_0003144	3300048919	Bacteria	16561
397	Ga0496117_0000784	3300048920	Bacteria	49899
398	Ga0496117_0010290	3300048920	Bacteria	8553
399	Ga0496117_0263872	3300048920	Bacteria	932
400	Ga0496118_0000262	3300048921	Bacteria	92154
401	Ga0496118_0002399	3300048921	Bacteria	25293
402	Ga0496118_0507689	3300048921	Bacteria	598
403	Ga0496119_0007046	3300048922	Bacteria	10230
404	Ga0496121_0010499	3300048924	Bacteria	10435
405	Ga0496121_0012561	3300048924	Bacteria	9212
406	Ga0496121_0303564	3300048924	Bacteria	1082
407	Ga0496124_0000846	3300048927	Bacteria	49899
408	Ga0496124_0063033	3300048927	Bacteria	3099
409	Ga0496124_0123791	3300048927	Bacteria	2063
410	Ga0496124_0742121	3300048927	Bacteria	616
411	Ga0496125_0080192	3300048928	Bacteria	2499
412	Ga0496125_0526796	3300048928	Bacteria	659
413	Ga0496126_0003256	3300048929	Bacteria	20755
414	Ga0496126_0812448	3300048929	Bacteria	716
415	Ga0501031_0384692	3300049568	Bacteria	908
416	Ga0501032_0524979	3300049569	Bacteria	756
417	Ga0501033_0334293	3300049570	Bacteria	1063
418	Ga0501043_0330331	3300049579	Bacteria	1161
419	Ga0501043_0584151	3300049579	Bacteria	827
420	Ga0501047_0761306	3300049581	Bacteria	784
421	Ga0501225_0211474	3300049705	Bacteria	620
422	Ga0501267_003509	3300049764	Bacteria	1431
423	Ga0501267_020222	3300049764	Bacteria	730
424	Ga0501268_015649	3300049765	Bacteria	1249
425	Ga0501270_053659	3300049767	Bacteria	737
426	Ga0501035_0323581	3300049822	Bacteria	1295
427	Ga0501044_0238118	3300049823	Bacteria	1765
428	nmdc:mga03683_149_c1	3300050489	Bacteria	23934
429	nmdc:mga03683_1709_c1	3300050489	Bacteria	6612
430	nmdc:mga03683_57_c1	3300050489	Bacteria	46363
431	nmdc:mga03n38_768_c1	3300050490	Bacteria	8507
432	nmdc:mga00v17_33761_c1	3300050491	Bacteria	3034
433	nmdc:mga00v17_798_c1	3300050491	Bacteria	17178
434	nmdc:mga00v17_83529_c1	3300050491	Bacteria	1998
435	nmdc:mga0k408_240200_c1	3300050493	Bacteria	1082
436	nmdc:mga0k408_488_c1	3300050493	Bacteria	21772
437	nmdc:mga06z11_61_c1	3300050494	Bacteria	46697
438	nmdc:mga04h51_1140_c1	3300050495	Bacteria	6137
439	nmdc:mga07m45_133558_c1	3300050496	Bacteria	1436
440	nmdc:mga07m45_3935_c1	3300050496	Bacteria	7223
441	nmdc:mga07m45_8_c1	3300050496	Bacteria	214050
442	nmdc:mga09592_395344_c1	3300050508	Bacteria	1195
443	nmdc:mga08y16_129179_c1	3300050511	Bacteria	2628
444	nmdc:mga0sz30_114985_c1	3300050516	Bacteria	1181
445	nmdc:mga0sz30_179159_c1	3300050516	Bacteria	940
446	nmdc:mga0sz30_843_c1	3300050516	Bacteria	11082
447	nmdc:mga0sz30_9513_c1	3300050516	Bacteria	3701
448	Ga0495655_0003745	3300053083	Bacteria	2538
449	Ga0500643_000001	3300053087	Bacteria	1440111
450	Ga0500643_128930	3300053087	Bacteria	680
451	Ga0500647_0157866	3300053091	Bacteria	1054
452	Ga0500651_0028940	3300053093	Bacteria	3482
453	Ga0500641_0053119	3300053096	Bacteria	1672
454	Ga0500641_0151487	3300053096	Bacteria	1001
455	Ga0500593_154319	3300053117	Bacteria	886
456	Ga0500594_0153946	3300053118	Bacteria	740
457	Ga0500595_059734	3300053119	Bacteria	1155
458	Ga0500618_026852	3300053125	Bacteria	1372
459	Ga0500642_0239727	3300053130	Bacteria	835
460	Ga0500559_0106047	3300053136	Bacteria	1299
461	Ga0500573_0149397	3300053140	Bacteria	1281
462	Ga0500577_0169010	3300053142	Bacteria	934
463	Ga0500604_0007302	3300053151	Bacteria	2927
464	Ga0500616_0141170	3300053153	Bacteria	1126
465	Ga0500616_0154760	3300053153	Bacteria	1057
466	Ga0500622_0061379	3300053156	Bacteria	1916
467	Ga0500627_0003120	3300053158	Bacteria	5068
468	Ga0500636_0194329	3300053177	Bacteria	1078
469	Ga0500645_008043	3300053730	Bacteria	3629
470	Ga0500596_015828	3300053735	Bacteria	1133
471	Ga0500587_002703	3300053739	Bacteria	2512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300032005	Ga0307411_10640689	Ga0307411_106406892	142
2	3300044765	Ga0466970_0178210	Ga0466970_0178210_616_1047	142
3	3300031548	Ga0307408_100124036	Ga0307408_1001240362	143
4	3300031731	Ga0307405_10402782	Ga0307405_104027822	143
5	3300031731	Ga0307405_10505993	Ga0307405_105059931	143
6	3300031824	Ga0307413_10025881	Ga0307413_100258813	143
7	3300031824	Ga0307413_10248645	Ga0307413_102486452	143
8	3300031852	Ga0307410_10012419	Ga0307410_100124196	143
9	3300031901	Ga0307406_10192728	Ga0307406_101927282	143
10	3300031903	Ga0307407_10011384	Ga0307407_100113845	143
11	3300031903	Ga0307407_10147320	Ga0307407_101473203	143
12	3300031911	Ga0307412_11012934	Ga0307412_110129342	143
13	3300031995	Ga0307409_100049773	Ga0307409_1000497732	143
14	3300032002	Ga0307416_100054480	Ga0307416_1000544803	143
15	3300032002	Ga0307416_100285878	Ga0307416_1002858783	143
16	3300032002	Ga0307416_101025737	Ga0307416_1010257372	143
17	3300032004	Ga0307414_10190947	Ga0307414_101909473	143
18	3300032126	Ga0307415_100094059	Ga0307415_1000940593	143
19	3300037471	Ga0395905_0053671	Ga0395905_0053671_62_493	143
20	3300053153	Ga0500616_0141170	Ga0500616_0141170_242_673	143
21	3300002774	JGI25150J39212_1000428	JGI25150J39212_100042818	144
22	3300003187	JGI25151J46595_10020919	JGI25151J46595_100209193	144
23	3300003215	JGI25153J46596_10000286	JGI25153J46596_100002866	144
24	3300003771	Ga0055526_1009344	Ga0055526_10093446	144
25	3300003773	Ga0055537_1003208	Ga0055537_10032082	144
26	3300003781	Ga0055536_1009589	Ga0055536_10095893	144
27	3300003791	Ga0055530_10039684	Ga0055530_100396842	144
28	3300003792	Ga0055540_1001278	Ga0055540_100127810	144
29	3300005290	Ga0065712_10204789	Ga0065712_102047892	144
30	3300005327	Ga0070658_10061993	Ga0070658_100619933	144
31	3300005327	Ga0070658_10309536	Ga0070658_103095362	144
32	3300005327	Ga0070658_10395828	Ga0070658_103958282	144
33	3300005329	Ga0070683_100236418	Ga0070683_1002364182	144
34	3300005331	Ga0070670_100110803	Ga0070670_1001108033	144
35	3300005331	Ga0070670_101132797	Ga0070670_1011327972	144
36	3300005335	Ga0070666_10058403	Ga0070666_100584032	144
37	3300005336	Ga0070680_101063852	Ga0070680_1010638521	144
38	3300005336	Ga0070680_101315335	Ga0070680_1013153351	144
39	3300005339	Ga0070660_100164030	Ga0070660_1001640303	144
40	3300005339	Ga0070660_100274927	Ga0070660_1002749272	144
41	3300005344	Ga0070661_100622354	Ga0070661_1006223542	144
42	3300005347	Ga0070668_100091910	Ga0070668_1000919102	144
43	3300005347	Ga0070668_100132347	Ga0070668_1001323472	144
44	3300005353	Ga0070669_100051006	Ga0070669_1000510063	144
45	3300005353	Ga0070669_100651981	Ga0070669_1006519812	144
46	3300005355	Ga0070671_100000066	Ga0070671_10000006678	144
47	3300005355	Ga0070671_100040627	Ga0070671_1000406274	144
48	3300005355	Ga0070671_100791565	Ga0070671_1007915652	144
49	3300005366	Ga0070659_100146196	Ga0070659_1001461962	144
50	3300005367	Ga0070667_100056154	Ga0070667_1000561543	144
51	3300005367	Ga0070667_100080843	Ga0070667_1000808436	144
52	3300005455	Ga0070663_100220548	Ga0070663_1002205481	144
53	3300005455	Ga0070663_101071412	Ga0070663_1010714121	144
54	3300005457	Ga0070662_100018172	Ga0070662_1000181723	144
55	3300005466	Ga0070685_10129756	Ga0070685_101297563	144
56	3300005530	Ga0070679_100042024	Ga0070679_1000420247	144
57	3300005530	Ga0070679_100169900	Ga0070679_1001699003	144
58	3300005530	Ga0070679_100313001	Ga0070679_1003130013	144
59	3300005535	Ga0070684_100224824	Ga0070684_1002248242	144
60	3300005539	Ga0068853_100335425	Ga0068853_1003354252	144
61	3300005544	Ga0070686_100034811	Ga0070686_1000348113	144
62	3300005547	Ga0070693_101060810	Ga0070693_1010608101	144
63	3300005548	Ga0070665_100045063	Ga0070665_1000450633	144
64	3300005563	Ga0068855_100019338	Ga0068855_1000193384	144
65	3300005563	Ga0068855_100477775	Ga0068855_1004777752	144
66	3300005578	Ga0068854_100002728	Ga0068854_1000027286	144
67	3300005578	Ga0068854_101763658	Ga0068854_1017636581	144
68	3300005616	Ga0068852_100030982	Ga0068852_1000309822	144
69	3300005616	Ga0068852_100080737	Ga0068852_1000807373	144
70	3300005616	Ga0068852_100107888	Ga0068852_1001078883	144
71	3300005616	Ga0068852_100202970	Ga0068852_1002029702	144
72	3300005616	Ga0068852_100351138	Ga0068852_1003511383	144
73	3300005617	Ga0068859_100029205	Ga0068859_1000292055	144
74	3300005617	Ga0068859_100645459	Ga0068859_1006454591	144
75	3300005617	Ga0068859_101161312	Ga0068859_1011613122	144
76	3300005618	Ga0068864_100058695	Ga0068864_1000586954	144
77	3300005618	Ga0068864_100196533	Ga0068864_1001965332	144
78	3300005843	Ga0068860_100258924	Ga0068860_1002589243	144
79	3300005844	Ga0068862_100258631	Ga0068862_1002586312	144
80	3300005844	Ga0068862_100356674	Ga0068862_1003566742	144
81	3300006058	Ga0075432_10001279	Ga0075432_100012795	144
82	3300006358	Ga0068871_100673795	Ga0068871_1006737951	144
83	3300006931	Ga0097620_100029209	Ga0097620_1000292095	144
84	3300006931	Ga0097620_100104486	Ga0097620_1001044863	144
85	3300006931	Ga0097620_100645483	Ga0097620_1006454831	144
86	3300006931	Ga0097620_101161188	Ga0097620_1011611882	144
87	3300009093	Ga0105240_10929068	Ga0105240_109290682	144
88	3300009093	Ga0105240_10972789	Ga0105240_109727892	144
89	3300009177	Ga0105248_10008515	Ga0105248_100085158	144
90	3300009177	Ga0105248_10068163	Ga0105248_100681637	144
91	3300009177	Ga0105248_10130953	Ga0105248_101309533	144
92	3300009545	Ga0105237_10008177	Ga0105237_1000817716	144
93	3300009553	Ga0105249_10193697	Ga0105249_101936973	144
94	3300009553	Ga0105249_10439516	Ga0105249_104395162	144
95	3300010375	Ga0105239_11569146	Ga0105239_115691462	144
96	3300013100	Ga0157373_10158215	Ga0157373_101582153	144
97	3300013100	Ga0157373_10291086	Ga0157373_102910862	144
98	3300013102	Ga0157371_10265642	Ga0157371_102656422	144
99	3300013102	Ga0157371_10296906	Ga0157371_102969062	144
100	3300013104	Ga0157370_10363025	Ga0157370_103630251	144
101	3300013297	Ga0157378_10063422	Ga0157378_100634222	144
102	3300013306	Ga0163162_10035659	Ga0163162_100356593	144
103	3300013307	Ga0157372_10603024	Ga0157372_106030242	144
104	3300013307	Ga0157372_10709271	Ga0157372_107092712	144
105	3300013308	Ga0157375_10244894	Ga0157375_102448943	144
106	3300013308	Ga0157375_11200590	Ga0157375_112005902	144
107	3300014326	Ga0157380_10635580	Ga0157380_106355801	144
108	3300014326	Ga0157380_11264139	Ga0157380_112641392	144
109	3300014968	Ga0157379_10107937	Ga0157379_101079372	144
110	3300014969	Ga0157376_12398224	Ga0157376_123982241	144
111	3300017792	Ga0163161_10702852	Ga0163161_107028522	144
112	3300025245	Ga0207425_1000041	Ga0207425_100004138	144
113	3300025258	Ga0209129_1003782	Ga0209129_10037825	144
114	3300025263	Ga0209565_1000134	Ga0209565_100013420	144
115	3300025273	Ga0209673_1022988	Ga0209673_10229882	144
116	3300025292	Ga0209676_1037917	Ga0209676_10379172	144
117	3300025294	Ga0209025_1000068	Ga0209025_1000068207	144
118	3300025295	Ga0209564_1000622	Ga0209564_100062240	144
119	3300025297	Ga0209758_1000004	Ga0209758_1000004106	144
120	3300025297	Ga0209758_1043973	Ga0209758_10439732	144
121	3300025298	Ga0209050_1000001	Ga0209050_10000012036	144
122	3300025298	Ga0209050_1011695	Ga0209050_10116955	144
123	3300025302	Ga0207426_1043910	Ga0207426_10439102	144
124	3300025303	Ga0209051_1000191	Ga0209051_100019133	144
125	3300025304	Ga0209257_1003025	Ga0209257_10030257	144
126	3300025304	Ga0209257_1003254	Ga0209257_100325413	144
127	3300025315	Ga0207697_10089287	Ga0207697_100892872	144
128	3300025903	Ga0207680_10128705	Ga0207680_101287052	144
129	3300025909	Ga0207705_10022699	Ga0207705_100226993	144
130	3300025909	Ga0207705_10183531	Ga0207705_101835311	144
131	3300025909	Ga0207705_10273704	Ga0207705_102737042	144
132	3300025909	Ga0207705_10515972	Ga0207705_105159722	144
133	3300025909	Ga0207705_10990158	Ga0207705_109901582	144
134	3300025914	Ga0207671_10010589	Ga0207671_100105893	144
135	3300025917	Ga0207660_10734924	Ga0207660_107349242	144
136	3300025919	Ga0207657_10037866	Ga0207657_100378662	144
137	3300025919	Ga0207657_10453205	Ga0207657_104532052	144
138	3300025919	Ga0207657_11426295	Ga0207657_114262951	144
139	3300025921	Ga0207652_10021249	Ga0207652_100212492	144
140	3300025921	Ga0207652_10401521	Ga0207652_104015212	144
141	3300025921	Ga0207652_10982642	Ga0207652_109826422	144
142	3300025921	Ga0207652_11532104	Ga0207652_115321041	144
143	3300025923	Ga0207681_10036257	Ga0207681_100362573	144
144	3300025925	Ga0207650_10261582	Ga0207650_102615822	144
145	3300025925	Ga0207650_10263460	Ga0207650_102634603	144
146	3300025931	Ga0207644_10000353	Ga0207644_1000035328	144
147	3300025931	Ga0207644_10027231	Ga0207644_100272313	144
148	3300025933	Ga0207706_10011270	Ga0207706_100112703	144
149	3300025933	Ga0207706_10030087	Ga0207706_100300873	144
150	3300025941	Ga0207711_10000852	Ga0207711_1000085238	144
151	3300025941	Ga0207711_10016018	Ga0207711_100160184	144
152	3300025941	Ga0207711_10047499	Ga0207711_100474993	144
153	3300025944	Ga0207661_10757722	Ga0207661_107577222	144
154	3300025949	Ga0207667_10619701	Ga0207667_106197012	144
155	3300025961	Ga0207712_10570572	Ga0207712_105705722	144
156	3300025961	Ga0207712_10592034	Ga0207712_105920342	144
157	3300025972	Ga0207668_10012137	Ga0207668_100121372	144
158	3300025981	Ga0207640_10034269	Ga0207640_100342693	144
159	3300025981	Ga0207640_10325754	Ga0207640_103257542	144
160	3300025986	Ga0207658_10051667	Ga0207658_100516672	144
161	3300025986	Ga0207658_10188072	Ga0207658_101880723	144
162	3300026041	Ga0207639_10263779	Ga0207639_102637793	144
163	3300026041	Ga0207639_10305241	Ga0207639_103052412	144
164	3300026067	Ga0207678_10087488	Ga0207678_100874883	144
165	3300026088	Ga0207641_10487031	Ga0207641_104870312	144
166	3300026095	Ga0207676_10554366	Ga0207676_105543662	144
167	3300026118	Ga0207675_100000159	Ga0207675_10000015924	144
168	3300026142	Ga0207698_10063308	Ga0207698_100633083	144
169	3300026142	Ga0207698_10117589	Ga0207698_101175893	144
170	3300026142	Ga0207698_11361467	Ga0207698_113614671	144
171	3300026142	Ga0207698_12624143	Ga0207698_126241431	144
172	3300027907	Ga0207428_10029569	Ga0207428_100295695	144
173	3300028379	Ga0268266_10000002	Ga0268266_100000022987	144
174	3300028379	Ga0268266_10095883	Ga0268266_100958832	144
175	3300028380	Ga0268265_10714998	Ga0268265_107149982	144
176	3300028380	Ga0268265_10836974	Ga0268265_108369741	144
177	3300028380	Ga0268265_11066393	Ga0268265_110663931	144
178	3300028381	Ga0268264_10109883	Ga0268264_101098832	144
179	3300028786	Ga0307517_10036810	Ga0307517_100368103	144
180	3300030731	Ga0316177_1209949	Ga0316177_12099492	144
181	3300030732	Ga0316176_1117175	Ga0316176_11171753	144
182	3300030733	Ga0314311_1208813	Ga0314311_12088132	144
183	3300030735	Ga0316178_1079727	Ga0316178_10797273	144
184	3300030736	Ga0316180_1162834	Ga0316180_11628342	144
185	3300030742	Ga0316183_1030586	Ga0316183_10305862	144
186	3300030744	Ga0316181_1152471	Ga0316181_11524714	144
187	3300030745	Ga0316182_1073368	Ga0316182_10733683	144
188	3300031731	Ga0307405_10049536	Ga0307405_100495361	144
189	3300031731	Ga0307405_11886640	Ga0307405_118866402	144
190	3300031824	Ga0307413_10013491	Ga0307413_100134914	144
191	3300031824	Ga0307413_10134022	Ga0307413_101340224	144
192	3300031852	Ga0307410_10152459	Ga0307410_101524593	144
193	3300031852	Ga0307410_10343872	Ga0307410_103438722	144
194	3300031901	Ga0307406_10111215	Ga0307406_101112154	144
195	3300031901	Ga0307406_10114147	Ga0307406_101141474	144
196	3300031903	Ga0307407_10171038	Ga0307407_101710383	144
197	3300031911	Ga0307412_10238780	Ga0307412_102387802	144
198	3300031911	Ga0307412_10311747	Ga0307412_103117473	144
199	3300031911	Ga0307412_10527697	Ga0307412_105276972	144
200	3300031995	Ga0307409_100098653	Ga0307409_1000986533	144
201	3300031995	Ga0307409_100401734	Ga0307409_1004017341	144
202	3300031995	Ga0307409_100486545	Ga0307409_1004865451	144
203	3300032002	Ga0307416_100577786	Ga0307416_1005777862	144
204	3300032002	Ga0307416_100752034	Ga0307416_1007520342	144
205	3300032002	Ga0307416_100843082	Ga0307416_1008430822	144
206	3300032004	Ga0307414_10030107	Ga0307414_100301072	144
207	3300032004	Ga0307414_10074054	Ga0307414_100740543	144
208	3300032004	Ga0307414_10117967	Ga0307414_101179671	144
209	3300032004	Ga0307414_10218419	Ga0307414_102184193	144
210	3300032004	Ga0307414_10263161	Ga0307414_102631612	144
211	3300032004	Ga0307414_10394078	Ga0307414_103940782	144
212	3300032004	Ga0307414_10415904	Ga0307414_104159043	144
213	3300032004	Ga0307414_10687897	Ga0307414_106878971	144
214	3300032005	Ga0307411_10079744	Ga0307411_100797443	144
215	3300032005	Ga0307411_10543800	Ga0307411_105438001	144
216	3300032126	Ga0307415_100139626	Ga0307415_1001396263	144
217	3300032126	Ga0307415_100334287	Ga0307415_1003342873	144
218	3300036712	Ga0316584_0430242	Ga0316584_0430242_222_659	144
219	3300037471	Ga0395905_0432060	Ga0395905_0432060_522_956	144
220	3300037471	Ga0395905_0749256	Ga0395905_0749256_57_491	144
221	3300039437	Ga0436365_0969639	Ga0436365_0969639_116_550	144
222	3300041509	Ga0451843_1695510	Ga0451843_1695510_107_541	144
223	3300046471	Ga0495650_0199300	Ga0495650_0199300_249_683	144
224	3300046513	Ga0495616_0233607	Ga0495616_0233607_194_628	144
225	3300046537	Ga0495598_0000657	Ga0495598_0000657_390_965	144
226	3300046539	Ga0495621_0027191	Ga0495621_0027191_1154_1588	144
227	3300046539	Ga0495621_0053301	Ga0495621_0053301_241_762	144
228	3300046615	Ga0495656_0732975	Ga0495656_0732975_57_491	144
229	3300047469	Ga0495673_0103407	Ga0495673_0103407_512_946	144
230	3300047472	Ga0495686_0001246	Ga0495686_0001246_17915_18349	144
231	3300048903	Ga0496100_0375963	Ga0496100_0375963_611_1045	144
232	3300048904	Ga0496101_0142872	Ga0496101_0142872_1101_1535	144
233	3300048905	Ga0496102_0256838	Ga0496102_0256838_615_1049	144
234	3300048906	Ga0496103_0174523	Ga0496103_0174523_752_1186	144
235	3300048907	Ga0496104_0200074	Ga0496104_0200074_910_1344	144
236	3300048907	Ga0496104_0512414	Ga0496104_0512414_593_1027	144
237	3300048908	Ga0496105_0222410	Ga0496105_0222410_390_824	144
238	3300048908	Ga0496105_0412181	Ga0496105_0412181_216_650	144
239	3300048909	Ga0496106_0010127	Ga0496106_0010127_5126_5560	144
240	3300048910	Ga0496107_0630577	Ga0496107_0630577_193_627	144
241	3300048911	Ga0496108_0234653	Ga0496108_0234653_1072_1506	144
242	3300048912	Ga0496109_0581159	Ga0496109_0581159_65_499	144
243	3300048913	Ga0496110_0070535	Ga0496110_0070535_1425_1859	144
244	3300048913	Ga0496110_0270538	Ga0496110_0270538_185_619	144
245	3300048914	Ga0496111_0017065	Ga0496111_0017065_3918_4352	144
246	3300048916	Ga0496113_0000445	Ga0496113_0000445_4363_4797	144
247	3300048916	Ga0496113_0803602	Ga0496113_0803602_277_711	144
248	3300048917	Ga0496114_0071065	Ga0496114_0071065_2222_2656	144
249	3300048918	Ga0496115_0008325	Ga0496115_0008325_6175_6609	144
250	3300048920	Ga0496117_0263872	Ga0496117_0263872_167_607	144
251	3300048921	Ga0496118_0507689	Ga0496118_0507689_51_485	144
252	3300048924	Ga0496121_0012561	Ga0496121_0012561_1589_2023	144
253	3300048927	Ga0496124_0123791	Ga0496124_0123791_1417_1851	144
254	3300048927	Ga0496124_0742121	Ga0496124_0742121_11_445	144
255	3300048928	Ga0496125_0526796	Ga0496125_0526796_201_635	144
256	3300048929	Ga0496126_0003256	Ga0496126_0003256_9781_10215	144
257	3300049568	Ga0501031_0384692	Ga0501031_0384692_269_703	144
258	3300049569	Ga0501032_0524979	Ga0501032_0524979_17_454	144
259	3300049570	Ga0501033_0334293	Ga0501033_0334293_61_495	144
260	3300049579	Ga0501043_0330331	Ga0501043_0330331_473_910	144
261	3300049579	Ga0501043_0584151	Ga0501043_0584151_370_804	144
262	3300049705	Ga0501225_0211474	Ga0501225_0211474_111_545	144
263	3300049764	Ga0501267_003509	Ga0501267_003509_227_661	144
264	3300049765	Ga0501268_015649	Ga0501268_015649_69_503	144
265	3300049767	Ga0501270_053659	Ga0501270_053659_222_656	144
266	3300049822	Ga0501035_0323581	Ga0501035_0323581_33_467	144
267	3300049823	Ga0501044_0238118	Ga0501044_0238118_559_993	144
268	3300050496	nmdc:mga07m45_133558_c1	nmdc:mga07m45_133558_c1_313_747	144
269	3300053087	Ga0500643_000001	Ga0500643_000001_856539_856973	144
270	3300053087	Ga0500643_128930	Ga0500643_128930_211_645	144
271	3300053118	Ga0500594_0153946	Ga0500594_0153946_177_611	144
272	3300053119	Ga0500595_059734	Ga0500595_059734_251_685	144
273	3300053136	Ga0500559_0106047	Ga0500559_0106047_117_551	144
274	3300053140	Ga0500573_0149397	Ga0500573_0149397_623_1057	144
275	3300053153	Ga0500616_0154760	Ga0500616_0154760_400_834	144
276	3300006038	Ga0075365_10067981	Ga0075365_100679814	145
277	3300006042	Ga0075368_10000199	Ga0075368_100001993	145
278	3300006048	Ga0075363_100000482	Ga0075363_1000004823	145
279	3300006048	Ga0075363_100017436	Ga0075363_1000174364	145
280	3300006051	Ga0075364_10151087	Ga0075364_101510872	145
281	3300006177	Ga0075362_10000104	Ga0075362_1000010411	145
282	3300006177	Ga0075362_10002982	Ga0075362_100029822	145
283	3300006177	Ga0075362_10046036	Ga0075362_100460361	145
284	3300006178	Ga0075367_10022138	Ga0075367_100221384	145
285	3300006186	Ga0075369_10002202	Ga0075369_100022026	145
286	3300006186	Ga0075369_10010168	Ga0075369_100101683	145
287	3300006186	Ga0075369_10120093	Ga0075369_101200932	145
288	3300006195	Ga0075366_10000768	Ga0075366_100007682	145
289	3300006195	Ga0075366_10037143	Ga0075366_100371432	145
290	3300006353	Ga0075370_10000032	Ga0075370_1000003230	145
291	3300006353	Ga0075370_10141938	Ga0075370_101419382	145
292	3300027866	Ga0209813_10000065	Ga0209813_100000655	145
293	3300031251	Ga0265327_10061872	Ga0265327_100618724	145
294	3300035691	Ga0373931_0111729	Ga0373931_0111729_120_593	145
295	3300036647	Ga0316582_0034395	Ga0316582_0034395_2650_3087	145
296	3300036712	Ga0316584_0115052	Ga0316584_0115052_398_835	145
297	3300046500	Ga0495596_0005241	Ga0495596_0005241_5019_5456	145
298	3300046507	Ga0495606_0111417	Ga0495606_0111417_1004_1441	145
299	3300046512	Ga0495610_0005814	Ga0495610_0005814_735_1172	145
300	3300046522	Ga0495643_0180573	Ga0495643_0180573_243_680	145
301	3300048091	Ga0495626_0001920	Ga0495626_0001920_546_983	145
302	3300048927	Ga0496124_0063033	Ga0496124_0063033_646_1083	145
303	3300050489	nmdc:mga03683_149_c1	nmdc:mga03683_149_c1_4273_4710	145
304	3300050489	nmdc:mga03683_1709_c1	nmdc:mga03683_1709_c1_5893_6330	145
305	3300050489	nmdc:mga03683_57_c1	nmdc:mga03683_57_c1_28764_29237	145
306	3300050490	nmdc:mga03n38_768_c1	nmdc:mga03n38_768_c1_7264_7737	145
307	3300050491	nmdc:mga00v17_33761_c1	nmdc:mga00v17_33761_c1_1087_1560	145
308	3300050491	nmdc:mga00v17_798_c1	nmdc:mga00v17_798_c1_7528_7965	145
309	3300050491	nmdc:mga00v17_83529_c1	nmdc:mga00v17_83529_c1_840_1277	145
310	3300050493	nmdc:mga0k408_240200_c1	nmdc:mga0k408_240200_c1_307_744	145
311	3300050493	nmdc:mga0k408_488_c1	nmdc:mga0k408_488_c1_5534_5971	145
312	3300050494	nmdc:mga06z11_61_c1	nmdc:mga06z11_61_c1_30450_30887	145
313	3300050495	nmdc:mga04h51_1140_c1	nmdc:mga04h51_1140_c1_3665_4102	145
314	3300050496	nmdc:mga07m45_3935_c1	nmdc:mga07m45_3935_c1_4688_5125	145
315	3300050496	nmdc:mga07m45_8_c1	nmdc:mga07m45_8_c1_28581_29054	145
316	3300050511	nmdc:mga08y16_129179_c1	nmdc:mga08y16_129179_c1_171_608	145
317	3300050516	nmdc:mga0sz30_114985_c1	nmdc:mga0sz30_114985_c1_497_934	145
318	3300050516	nmdc:mga0sz30_179159_c1	nmdc:mga0sz30_179159_c1_359_796	145
319	3300050516	nmdc:mga0sz30_843_c1	nmdc:mga0sz30_843_c1_4268_4741	145
320	3300050516	nmdc:mga0sz30_9513_c1	nmdc:mga0sz30_9513_c1_3117_3554	145
321	3300053117	Ga0500593_154319	Ga0500593_154319_74_511	145
322	3300053730	Ga0500645_008043	Ga0500645_008043_279_716	145
323	3300002067	JGI24735J21928_10007574	JGI24735J21928_100075742	146
324	3300005331	Ga0070670_100000027	Ga0070670_100000027146	146
325	3300005338	Ga0068868_100000011	Ga0068868_10000001183	146
326	3300005339	Ga0070660_100002217	Ga0070660_1000022173	146
327	3300005344	Ga0070661_100003418	Ga0070661_10000341811	146
328	3300005353	Ga0070669_100096449	Ga0070669_1000964491	146
329	3300005354	Ga0070675_100006222	Ga0070675_1000062229	146
330	3300005365	Ga0070688_100292492	Ga0070688_1002924922	146
331	3300005366	Ga0070659_100000004	Ga0070659_10000000448	146
332	3300005367	Ga0070667_100000280	Ga0070667_1000002804	146
333	3300005455	Ga0070663_100011683	Ga0070663_1000116837	146
334	3300005563	Ga0068855_100078544	Ga0068855_1000785443	146
335	3300005614	Ga0068856_100013388	Ga0068856_1000133888	146
336	3300005616	Ga0068852_100019487	Ga0068852_1000194873	146
337	3300005617	Ga0068859_100011652	Ga0068859_1000116527	146
338	3300005617	Ga0068859_100158056	Ga0068859_1001580562	146
339	3300005618	Ga0068864_100000083	Ga0068864_10000008363	146
340	3300005841	Ga0068863_100000025	Ga0068863_10000002563	146
341	3300005842	Ga0068858_100658097	Ga0068858_1006580971	146
342	3300005844	Ga0068862_100000027	Ga0068862_100000027152	146
343	3300006844	Ga0075428_100237247	Ga0075428_1002372473	146
344	3300006880	Ga0075429_100400288	Ga0075429_1004002882	146
345	3300006881	Ga0068865_101072396	Ga0068865_1010723961	146
346	3300006931	Ga0097620_100011652	Ga0097620_1000116527	146
347	3300006931	Ga0097620_100158056	Ga0097620_1001580562	146
348	3300009011	Ga0105251_10000138	Ga0105251_1000013863	146
349	3300009093	Ga0105240_10025126	Ga0105240_100251262	146
350	3300009098	Ga0105245_10077314	Ga0105245_100773145	146
351	3300009098	Ga0105245_11486759	Ga0105245_114867591	146
352	3300009101	Ga0105247_10000748	Ga0105247_1000074820	146
353	3300009177	Ga0105248_10000026	Ga0105248_1000002691	146
354	3300009553	Ga0105249_10000123	Ga0105249_1000012371	146
355	3300009553	Ga0105249_10649168	Ga0105249_106491682	146
356	3300013100	Ga0157373_10260105	Ga0157373_102601053	146
357	3300013102	Ga0157371_10021859	Ga0157371_100218596	146
358	3300013104	Ga0157370_10584498	Ga0157370_105844982	146
359	3300013105	Ga0157369_10001999	Ga0157369_100019993	146
360	3300013296	Ga0157374_12214134	Ga0157374_122141341	146
361	3300013297	Ga0157378_12133653	Ga0157378_121336531	146
362	3300013306	Ga0163162_10034795	Ga0163162_100347955	146
363	3300013307	Ga0157372_10155444	Ga0157372_101554443	146
364	3300014325	Ga0163163_10454986	Ga0163163_104549862	146
365	3300014968	Ga0157379_10012423	Ga0157379_100124234	146
366	3300021384	Ga0213876_10006296	Ga0213876_100062964	146
367	3300025735	Ga0207713_1000497	Ga0207713_100049730	146
368	3300025893	Ga0207682_10003842	Ga0207682_100038423	146
369	3300025907	Ga0207645_10285141	Ga0207645_102851413	146
370	3300025913	Ga0207695_10351700	Ga0207695_103517001	146
371	3300025919	Ga0207657_10005326	Ga0207657_100053263	146
372	3300025920	Ga0207649_10188238	Ga0207649_101882382	146
373	3300025923	Ga0207681_10423221	Ga0207681_104232212	146
374	3300025924	Ga0207694_10978295	Ga0207694_109782952	146
375	3300025925	Ga0207650_10000056	Ga0207650_10000056109	146
376	3300025926	Ga0207659_10025377	Ga0207659_100253773	146
377	3300025927	Ga0207687_10496168	Ga0207687_104961681	146
378	3300025932	Ga0207690_10000001	Ga0207690_10000001536	146
379	3300025932	Ga0207690_10000002	Ga0207690_10000002536	146
380	3300025932	Ga0207690_10000003	Ga0207690_10000003536	146
381	3300025932	Ga0207690_10000004	Ga0207690_10000004536	146
382	3300025938	Ga0207704_10869963	Ga0207704_108699631	146
383	3300025941	Ga0207711_10000004	Ga0207711_10000004106	146
384	3300025949	Ga0207667_10006417	Ga0207667_1000641714	146
385	3300025949	Ga0207667_11493607	Ga0207667_114936071	146
386	3300025961	Ga0207712_10000102	Ga0207712_1000010272	146
387	3300025986	Ga0207658_10000251	Ga0207658_1000025124	146
388	3300026023	Ga0207677_10000014	Ga0207677_1000001439	146
389	3300026035	Ga0207703_10616974	Ga0207703_106169742	146
390	3300026067	Ga0207678_10040544	Ga0207678_100405445	146
391	3300026078	Ga0207702_10027637	Ga0207702_100276373	146
392	3300026088	Ga0207641_10000018	Ga0207641_10000018251	146
393	3300026095	Ga0207676_10000027	Ga0207676_10000027196	146
394	3300028379	Ga0268266_10003655	Ga0268266_1000365517	146
395	3300028380	Ga0268265_10000042	Ga0268265_10000042138	146
396	3300031548	Ga0307408_100512894	Ga0307408_1005128942	146
397	3300031548	Ga0307408_101642142	Ga0307408_1016421422	146
398	3300031548	Ga0307408_101804318	Ga0307408_1018043181	146
399	3300031731	Ga0307405_10175876	Ga0307405_101758763	146
400	3300031824	Ga0307413_10613164	Ga0307413_106131642	146
401	3300031824	Ga0307413_11728441	Ga0307413_117284411	146
402	3300031852	Ga0307410_10153824	Ga0307410_101538242	146
403	3300031901	Ga0307406_10021183	Ga0307406_100211832	146
404	3300031901	Ga0307406_10410656	Ga0307406_104106562	146
405	3300031903	Ga0307407_10595471	Ga0307407_105954712	146
406	3300031911	Ga0307412_10036143	Ga0307412_100361435	146
407	3300031995	Ga0307409_101117609	Ga0307409_1011176092	146
408	3300031995	Ga0307409_101343234	Ga0307409_1013432342	146
409	3300031995	Ga0307409_102345992	Ga0307409_1023459921	146
410	3300032002	Ga0307416_100263928	Ga0307416_1002639283	146
411	3300032002	Ga0307416_100472001	Ga0307416_1004720013	146
412	3300032004	Ga0307414_10018012	Ga0307414_100180126	146
413	3300032004	Ga0307414_10048302	Ga0307414_100483023	146
414	3300032004	Ga0307414_10133230	Ga0307414_101332303	146
415	3300032004	Ga0307414_10792225	Ga0307414_107922252	146
416	3300032005	Ga0307411_10250383	Ga0307411_102503833	146
417	3300032005	Ga0307411_10880551	Ga0307411_108805512	146
418	3300032126	Ga0307415_102378848	Ga0307415_1023788481	146
419	3300037853	Ga0436364_1467807	Ga0436364_1467807_495_935	146
420	3300039437	Ga0436365_0654934	Ga0436365_0654934_1336_1776	146
421	3300039437	Ga0436365_1451957	Ga0436365_1451957_10141_10581	146
422	3300039450	Ga0436363_0386512	Ga0436363_0386512_1223_1669	146
423	3300046452	Ga0495617_048383	Ga0495617_048383_182_622	146
424	3300046459	Ga0495629_0442174	Ga0495629_0442174_315_770	146
425	3300046460	Ga0495638_0000033	Ga0495638_0000033_25047_25487	146
426	3300046506	Ga0495583_0001255	Ga0495583_0001255_4113_4553	146
427	3300046512	Ga0495610_0071589	Ga0495610_0071589_415_855	146
428	3300046513	Ga0495616_0000539	Ga0495616_0000539_24771_25211	146
429	3300046519	Ga0495632_0013736	Ga0495632_0013736_1043_1483	146
430	3300046520	Ga0495637_0016937	Ga0495637_0016937_806_1261	146
431	3300046522	Ga0495643_0103042	Ga0495643_0103042_364_819	146
432	3300046524	Ga0495648_0000014	Ga0495648_0000014_262879_263319	146
433	3300046616	Ga0495668_0014596	Ga0495668_0014596_3135_3575	146
434	3300046616	Ga0495668_0046828	Ga0495668_0046828_1305_1760	146
435	3300046660	Ga0495625_0072494	Ga0495625_0072494_1627_2082	146
436	3300046692	Ga0495671_0000019	Ga0495671_0000019_25435_25875	146
437	3300047321	Ga0495676_0431714	Ga0495676_0431714_197_652	146
438	3300047469	Ga0495673_0000042	Ga0495673_0000042_25208_25648	146
439	3300047472	Ga0495686_0055212	Ga0495686_0055212_1805_2245	146
440	3300048905	Ga0496102_0000418	Ga0496102_0000418_37770_38210	146
441	3300048906	Ga0496103_0000274	Ga0496103_0000274_37770_38210	146
442	3300048906	Ga0496103_0008979	Ga0496103_0008979_897_1337	146
443	3300048908	Ga0496105_0289410	Ga0496105_0289410_51_491	146
444	3300048919	Ga0496116_0003144	Ga0496116_0003144_5331_5771	146
445	3300048920	Ga0496117_0000784	Ga0496117_0000784_10800_11240	146
446	3300048920	Ga0496117_0010290	Ga0496117_0010290_2480_2920	146
447	3300048921	Ga0496118_0000262	Ga0496118_0000262_36271_36711	146
448	3300048921	Ga0496118_0002399	Ga0496118_0002399_14054_14494	146
449	3300048922	Ga0496119_0007046	Ga0496119_0007046_9612_10052	146
450	3300048924	Ga0496121_0010499	Ga0496121_0010499_1744_2184	146
451	3300048924	Ga0496121_0303564	Ga0496121_0303564_191_631	146
452	3300048927	Ga0496124_0000846	Ga0496124_0000846_10800_11240	146
453	3300048928	Ga0496125_0080192	Ga0496125_0080192_1771_2211	146
454	3300048929	Ga0496126_0812448	Ga0496126_0812448_56_496	146
455	3300049581	Ga0501047_0761306	Ga0501047_0761306_139_579	146
456	3300049764	Ga0501267_020222	Ga0501267_020222_59_499	146
457	3300050508	nmdc:mga09592_395344_c1	nmdc:mga09592_395344_c1_585_1025	146
458	3300053083	Ga0495655_0003745	Ga0495655_0003745_1412_1852	146
459	3300053091	Ga0500647_0157866	Ga0500647_0157866_320_775	146
460	3300053093	Ga0500651_0028940	Ga0500651_0028940_1752_2207	146
461	3300053096	Ga0500641_0053119	Ga0500641_0053119_1188_1628	146
462	3300053096	Ga0500641_0151487	Ga0500641_0151487_100_555	146
463	3300053125	Ga0500618_026852	Ga0500618_026852_226_681	146
464	3300053130	Ga0500642_0239727	Ga0500642_0239727_221_676	146
465	3300053142	Ga0500577_0169010	Ga0500577_0169010_286_741	146
466	3300053151	Ga0500604_0007302	Ga0500604_0007302_2193_2633	146
467	3300053156	Ga0500622_0061379	Ga0500622_0061379_1217_1672	146
468	3300053158	Ga0500627_0003120	Ga0500627_0003120_4195_4635	146
469	3300053177	Ga0500636_0194329	Ga0500636_0194329_425_880	146
470	3300053735	Ga0500596_015828	Ga0500596_015828_125_565	146
471	3300053739	Ga0500587_002703	Ga0500587_002703_783_1223	146
472	iso_pu_bacteria	2582581305	2585262285	146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

37

175

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8idu-assembly1.cif.gz_A	crystal structure of substrate bound-form dehydroquinate dehydratase from corynebacterium glutamicum	0.9715	5	143
2uyg-assembly1.cif.gz_F	crystallogaphic structure of the typeii 3-dehydroquinase from thermus thermophilus	0.9685	6	144
6hs9-assembly1.cif.gz_A	the crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876	0.961	2	141
1gqo-assembly1.cif.gz_E	type ii dehydroquinase from bacillus subtilis	0.96	6	144
6smf-assembly1.cif.gz_A	the crystal structure of type ii dehydroquinase from zymomonas mobilis	0.9546	4	144

ID	Description	Score	Start	End	Superfamily
1gqoA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II	0.9581	6	144	3.40.50.9100
1d0iH00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II	0.9427	1	143	3.40.50.9100
1gqoA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II	0.9385	6	144	3.40.50.9100
1d0iH00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II	0.9301	1	143	3.40.50.9100
4kiuM00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II	0.9295	6	144	3.40.50.9100

ID	Description	Score	Start	End	GO Terms
AF-A0A0N0JTM4-F1-model_v4	3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase)	0.9951	4	143	GO:0003855 GO:0008652 GO:0009073 GO:0009423 GO:0019631
AF-A0A7V9AY21-F1-model_v4	3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase)	0.9851	6	140	GO:0003855 GO:0008652 GO:0009073 GO:0009423 GO:0019631
AF-A0A061QFC2-F1-model_v4	3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase)	0.9844	6	143	GO:0003855 GO:0008652 GO:0009073 GO:0009423 GO:0019631
AF-A0A1S6IUM9-F1-model_v4	3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase)	0.9836	6	144	GO:0003855 GO:0008652 GO:0009073 GO:0009423 GO:0019631
AF-A0A1F9IJ94-F1-model_v4	3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase)	0.9834	5	143	GO:0003855 GO:0008652 GO:0009073 GO:0009423 GO:0019631

Feature Viewer

pLDDT	pTM	Quality
94.81	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F450725

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01220

DHquinase_II

Dehydroquinase class II

37

175

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map