F450681

General Info

Members Datasets Scaffolds Average Seq Length
471 209 942 169

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_1083554_c1|nmdc:mga0n895_1083554_c1_11_610
Length 199
Sequence LAKTFDPLNHTNQYENVVSAISCGQERKTTVELNLKPISRAGVAEAISKVEVYRYLNEPGEAESICRDILDVEPDNQVALRLLGLAITDQFEGEVSDRYEEAEHAFRGLTNEYERTYYCGILHERKAKAQLKAGRLPHTVLPIFEEAMEYFEAAEKIRPPNNDDAILRWNRCVRLLQSRVGSEWRREFDEFDASEGPPV

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
135 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
138 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
187 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
188 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
189 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
190 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
191 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
192 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
195 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
196 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
197 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
200 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.12
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 18.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_1083554_c1 3300050512 Unclassified 779
2 MBSR1b_contig_7951254 2162886012 Unclassified 864
3 CNAas_1000348 3300000532 Bacteria 4406
4 Ga0058862_12666939 3300004803 Bacteria 1077
5 Ga0065704_10332820 3300005289 Bacteria 828
6 Ga0065712_10074827 3300005290 Bacteria 3990
7 Ga0065715_10006557 3300005293 Bacteria 3073
8 Ga0065707_10132841 3300005295 Bacteria 1891
9 Ga0070676_10481321 3300005328 Bacteria 878
10 Ga0070683_100064866 3300005329 Bacteria 3400
11 Ga0068869_100130656 3300005334 Bacteria 1930
12 Ga0068869_100372509 3300005334 Bacteria 1169
13 Ga0070682_100026648 3300005337 Bacteria 3461
14 Ga0068868_100064373 3300005338 Bacteria 2911
15 Ga0070661_101178526 3300005344 Unclassified 640
16 Ga0070692_10007732 3300005345 Bacteria 4757
17 Ga0070692_10640107 3300005345 Bacteria 708
18 Ga0070703_10005580 3300005406 Bacteria 3521
19 Ga0070709_10133073 3300005434 Unclassified 1700
20 Ga0070709_10425744 3300005434 Bacteria 996
21 Ga0070709_10579226 3300005434 Bacteria 862
22 Ga0070709_10713291 3300005434 Bacteria 781
23 Ga0070709_10840284 3300005434 Unclassified 723
24 Ga0070714_100631721 3300005435 Bacteria 1030
25 Ga0070714_100729841 3300005435 Bacteria 957
26 Ga0070714_101142249 3300005435 Bacteria 759
27 Ga0070713_100035065 3300005436 Bacteria 4036
28 Ga0070713_100043539 3300005436 Bacteria 3670
29 Ga0070713_100254476 3300005436 Bacteria 1603
30 Ga0070713_100621862 3300005436 Bacteria 1027
31 Ga0070713_101225496 3300005436 Unclassified 726
32 Ga0070710_10103543 3300005437 Bacteria 1699
33 Ga0070710_10158432 3300005437 Bacteria 1402
34 Ga0070711_100034165 3300005439 Bacteria 3391
35 Ga0070711_100049982 3300005439 Bacteria 2865
36 Ga0070711_100116203 3300005439 Bacteria 1971
37 Ga0070711_100443457 3300005439 Bacteria 1061
38 Ga0070711_101215876 3300005439 Unclassified 652
39 Ga0070705_100010850 3300005440 Bacteria 4574
40 Ga0070705_100887117 3300005440 Bacteria 716
41 Ga0070700_100465666 3300005441 Bacteria 965
42 Ga0070694_100014946 3300005444 Bacteria 4863
43 Ga0070694_100016823 3300005444 Bacteria 4610
44 Ga0070694_100046610 3300005444 Bacteria 2911
45 Ga0070694_100064866 3300005444 Bacteria 2501
46 Ga0070694_100110026 3300005444 Bacteria 1962
47 Ga0070694_100300913 3300005444 Bacteria 1229
48 Ga0070708_100000804 3300005445 Bacteria 23664
49 Ga0070708_100019210 3300005445 Bacteria 5738
50 Ga0070708_100041219 3300005445 Bacteria 4047
51 Ga0070708_100058732 3300005445 Bacteria 3428
52 Ga0070708_100059040 3300005445 Bacteria 3419
53 Ga0070708_100151361 3300005445 Bacteria 2158
54 Ga0070708_100338182 3300005445 Bacteria 1418
55 Ga0070708_100347264 3300005445 Unclassified 1398
56 Ga0070708_100433380 3300005445 Bacteria 1240
57 Ga0070708_100519957 3300005445 Bacteria 1122
58 Ga0070708_100716547 3300005445 Bacteria 941
59 Ga0070708_100858196 3300005445 Unclassified 853
60 Ga0070708_101294247 3300005445 Unclassified 681
61 Ga0070681_10119110 3300005458 Bacteria 2576
62 Ga0070681_10207881 3300005458 Bacteria 1874
63 Ga0070681_10282259 3300005458 Bacteria 1571
64 Ga0070706_100001312 3300005467 Bacteria 26425
65 Ga0070706_100013096 3300005467 Bacteria 7674
66 Ga0070706_100021105 3300005467 Bacteria 5996
67 Ga0070706_100074467 3300005467 Bacteria 3142
68 Ga0070706_100088740 3300005467 Bacteria 2867
69 Ga0070706_100095769 3300005467 Unclassified 2756
70 Ga0070706_100138617 3300005467 Bacteria 2270
71 Ga0070706_100323542 3300005467 Bacteria 1438
72 Ga0070706_100403000 3300005467 Bacteria 1273
73 Ga0070706_100543034 3300005467 Bacteria 1081
74 Ga0070706_100817439 3300005467 Unclassified 862
75 Ga0070707_100002670 3300005468 Bacteria 16959
76 Ga0070707_100014625 3300005468 Bacteria 7357
77 Ga0070707_100017537 3300005468 Bacteria 6733
78 Ga0070707_100217919 3300005468 Bacteria 1860
79 Ga0070707_100227582 3300005468 Bacteria 1816
80 Ga0070707_100352292 3300005468 Bacteria 1430
81 Ga0070707_100583223 3300005468 Unclassified 1080
82 Ga0070698_100000147 3300005471 Bacteria 63668
83 Ga0070698_100007117 3300005471 Bacteria 12116
84 Ga0070698_100027658 3300005471 Bacteria 5896
85 Ga0070698_100037968 3300005471 Bacteria 4965
86 Ga0070698_100056226 3300005471 Bacteria 3988
87 Ga0070698_100086074 3300005471 Bacteria 3129
88 Ga0070698_100168553 3300005471 Bacteria 2131
89 Ga0070698_100177996 3300005471 Bacteria 2065
90 Ga0070698_100444318 3300005471 Bacteria 1232
91 Ga0070699_100006700 3300005518 Bacteria 10017
92 Ga0070699_100017820 3300005518 Bacteria 6098
93 Ga0070699_100223953 3300005518 Bacteria 1676
94 Ga0070699_100250003 3300005518 Bacteria 1584
95 Ga0070699_100481699 3300005518 Bacteria 1126
96 Ga0070699_100656559 3300005518 Unclassified 957
97 Ga0070699_100738524 3300005518 Unclassified 900
98 Ga0070684_100143489 3300005535 Unclassified 2160
99 Ga0070684_100339732 3300005535 Bacteria 1380
100 Ga0070697_100000503 3300005536 Bacteria 29653
101 Ga0070697_100001609 3300005536 Bacteria 17215
102 Ga0070697_100019114 3300005536 Bacteria 5408
103 Ga0070697_100062988 3300005536 Bacteria 3028
104 Ga0070697_100067155 3300005536 Bacteria 2933
105 Ga0070697_100209663 3300005536 Unclassified 1658
106 Ga0070697_100640440 3300005536 Unclassified 936
107 Ga0070697_100716192 3300005536 Unclassified 883
108 Ga0070697_100962029 3300005536 Unclassified 758
109 Ga0070697_101133061 3300005536 Bacteria 697
110 Ga0068853_100537071 3300005539 Bacteria 1107
111 Ga0070695_100423848 3300005545 Unclassified 1014
112 Ga0070696_100013400 3300005546 Bacteria 5501
113 Ga0070696_100122469 3300005546 Bacteria 1884
114 Ga0070696_100189492 3300005546 Bacteria 1530
115 Ga0070696_100504075 3300005546 Unclassified 963
116 Ga0070696_100560802 3300005546 Bacteria 916
117 Ga0070693_100065007 3300005547 Bacteria 2131
118 Ga0070693_100129346 3300005547 Bacteria 1576
119 Ga0070665_100046630 3300005548 Bacteria 4352
120 Ga0070704_100095811 3300005549 Bacteria 2223
121 Ga0070704_100172231 3300005549 Bacteria 1723
122 Ga0070704_100278550 3300005549 Bacteria 1384
123 Ga0068855_100147679 3300005563 Bacteria 2675
124 Ga0068855_100278695 3300005563 Bacteria 1857
125 Ga0070664_100462290 3300005564 Bacteria 1166
126 Ga0070664_101458612 3300005564 Unclassified 647
127 Ga0068857_100087618 3300005577 Bacteria 2785
128 Ga0068854_100048969 3300005578 Bacteria 3017
129 Ga0068854_100385725 3300005578 Bacteria 1156
130 Ga0068854_100581369 3300005578 Bacteria 954
131 Ga0068854_101087484 3300005578 Unclassified 712
132 Ga0068856_100066676 3300005614 Bacteria 3556
133 Ga0068856_100140380 3300005614 Bacteria 2423
134 Ga0068856_100659400 3300005614 Bacteria 1067
135 Ga0068856_100896154 3300005614 Unclassified 906
136 Ga0070702_100549276 3300005615 Bacteria 857
137 Ga0068852_101773900 3300005616 Unclassified 639
138 Ga0068859_100015320 3300005617 Bacteria 7701
139 Ga0068859_100060789 3300005617 Bacteria 3807
140 Ga0068859_100402119 3300005617 Bacteria 1465
141 Ga0068866_10213595 3300005718 Bacteria 1160
142 Ga0068861_100001804 3300005719 Bacteria 13788
143 Ga0068861_100219838 3300005719 Unclassified 1605
144 Ga0068851_10001281 3300005834 Bacteria 10969
145 Ga0068851_10327131 3300005834 Unclassified 887
146 Ga0068863_100002139 3300005841 Bacteria 19603
147 Ga0068863_100272417 3300005841 Bacteria 1639
148 Ga0068858_100033237 3300005842 Bacteria 4789
149 Ga0068860_100152899 3300005843 Unclassified 2223
150 Ga0070717_10000455 3300006028 Bacteria 25952
151 Ga0070717_10005046 3300006028 Bacteria 9617
152 Ga0070717_10408735 3300006028 Bacteria 1220
153 Ga0070717_10449867 3300006028 Bacteria 1161
154 Ga0070716_100000354 3300006173 Bacteria 18784
155 Ga0070716_100025856 3300006173 Bacteria 3138
156 Ga0070716_100049879 3300006173 Bacteria 2373
157 Ga0070716_100060639 3300006173 Bacteria 2186
158 Ga0070716_100082144 3300006173 Bacteria 1926
159 Ga0070716_100178858 3300006173 Unclassified 1391
160 Ga0070716_100339637 3300006173 Bacteria 1059
161 Ga0070716_100926939 3300006173 Unclassified 684
162 Ga0070712_100022441 3300006175 Bacteria 4159
163 Ga0070712_100067827 3300006175 Unclassified 2539
164 Ga0070712_100246835 3300006175 Unclassified 1424
165 Ga0070712_100268870 3300006175 Bacteria 1369
166 Ga0070712_100483686 3300006175 Bacteria 1035
167 Ga0070712_100668689 3300006175 Unclassified 883
168 Ga0070712_101499066 3300006175 Bacteria 589
169 Ga0097621_100007625 3300006237 Bacteria 7757
170 Ga0097621_100739142 3300006237 Bacteria 908
171 Ga0097621_101118538 3300006237 Bacteria 740
172 Ga0097621_101349032 3300006237 Unclassified 674
173 Ga0068871_100014024 3300006358 Bacteria 5962
174 Ga0068871_100487229 3300006358 Bacteria 1110
175 Ga0075428_100112935 3300006844 Bacteria 2959
176 Ga0075428_100513255 3300006844 Bacteria 1282
177 Ga0075428_101276724 3300006844 Bacteria 773
178 Ga0075430_100017968 3300006846 Bacteria 6019
179 Ga0075430_100395439 3300006846 Bacteria 1141
180 Ga0075431_100261823 3300006847 Bacteria 1755
181 Ga0075431_100434049 3300006847 Bacteria 1311
182 Ga0075433_10045361 3300006852 Bacteria 3821
183 Ga0075433_10133877 3300006852 Bacteria 2203
184 Ga0075433_10137209 3300006852 Bacteria 2174
185 Ga0075433_10378170 3300006852 Bacteria 1250
186 Ga0075433_11646831 3300006852 Unclassified 553
187 Ga0075434_100040621 3300006871 Bacteria 4607
188 Ga0075434_100184195 3300006871 Bacteria 2109
189 Ga0075434_100194092 3300006871 Bacteria 2051
190 Ga0075429_100155859 3300006880 Bacteria 2000
191 Ga0075436_100225166 3300006914 Bacteria 1331
192 Ga0075436_100990561 3300006914 Bacteria 631
193 Ga0097620_100015320 3300006931 Bacteria 7701
194 Ga0097620_100060789 3300006931 Bacteria 3807
195 Ga0097620_100402117 3300006931 Bacteria 1465
196 Ga0075435_100019129 3300007076 Bacteria 5221
197 Ga0075435_100020485 3300007076 Bacteria 5068
198 Ga0075435_100263470 3300007076 Bacteria 1469
199 Ga0075435_100345714 3300007076 Bacteria 1275
200 Ga0099794_10001839 3300007265 Bacteria 7591
201 Ga0099794_10014370 3300007265 Bacteria 3468
202 Ga0099794_10029340 3300007265 Bacteria 2562
203 Ga0099794_10042165 3300007265 Bacteria 2175
204 Ga0099794_10077501 3300007265 Bacteria 1635
205 Ga0099794_10156167 3300007265 Bacteria 1159
206 Ga0099794_10192966 3300007265 Bacteria 1042
207 Ga0099794_10402515 3300007265 Unclassified 715
208 Ga0105240_10079119 3300009093 Bacteria 4046
209 Ga0105240_10211471 3300009093 Bacteria 2266
210 Ga0105240_10400839 3300009093 Bacteria 1545
211 Ga0111539_10043923 3300009094 Bacteria 5356
212 Ga0111539_10137494 3300009094 Bacteria 2861
213 Ga0105245_10056544 3300009098 Bacteria 3527
214 Ga0114129_10012206 3300009147 Archaea 12222
215 Ga0114129_10109201 3300009147 Bacteria 3819
216 Ga0114129_10148688 3300009147 Bacteria 3207
217 Ga0114129_10193630 3300009147 Bacteria 2758
218 Ga0114129_10206023 3300009147 Bacteria 2661
219 Ga0114129_10365526 3300009147 Bacteria 1908
220 Ga0114129_10669749 3300009147 Bacteria 1337
221 Ga0114129_10673335 3300009147 Bacteria 1333
222 Ga0114129_10895897 3300009147 Unclassified 1124
223 Ga0114129_12732352 3300009147 Unclassified 588
224 Ga0105243_10631128 3300009148 Unclassified 1036
225 Ga0105241_10005683 3300009174 Bacteria 9204
226 Ga0105241_10054403 3300009174 Bacteria 3064
227 Ga0105241_10109721 3300009174 Bacteria 2207
228 Ga0105241_10369620 3300009174 Bacteria 1250
229 Ga0105242_10296024 3300009176 Bacteria 1475
230 Ga0105248_10055043 3300009177 Bacteria 4462
231 Ga0105237_10000521 3300009545 Bacteria 54240
232 Ga0105237_10027642 3300009545 Bacteria 5786
233 Ga0105237_10453720 3300009545 Unclassified 1288
234 Ga0105238_10044642 3300009551 Unclassified 4480
235 Ga0105238_10379951 3300009551 Bacteria 1404
236 Ga0105238_10455473 3300009551 Bacteria 1277
237 Ga0105238_10769152 3300009551 Bacteria 978
238 Ga0105238_11546844 3300009551 Unclassified 693
239 Ga0099796_10337921 3300010159 Unclassified 646
240 Ga0105239_11434933 3300010375 Bacteria 797
241 Ga0105239_11542686 3300010375 Bacteria 768
242 Ga0105246_10217307 3300011119 Bacteria 1496
243 Ga0157373_10001043 3300013100 Bacteria 21359
244 Ga0157373_10031158 3300013100 Bacteria 3838
245 Ga0157369_10114132 3300013105 Bacteria 2869
246 Ga0157369_10540131 3300013105 Bacteria 1205
247 Ga0157369_11645794 3300013105 Bacteria 653
248 Ga0157374_10073338 3300013296 Bacteria 3231
249 Ga0157378_10387619 3300013297 Bacteria 1374
250 Ga0157378_10680687 3300013297 Bacteria 1046
251 Ga0157378_11022841 3300013297 Unclassified 861
252 Ga0163162_10010856 3300013306 Bacteria 8865
253 Ga0163162_10805994 3300013306 Bacteria 1056
254 Ga0163162_11963013 3300013306 Unclassified 670
255 Ga0157372_10001998 3300013307 Bacteria 22149
256 Ga0157372_10018945 3300013307 Bacteria 7406
257 Ga0157372_10365272 3300013307 Bacteria 1682
258 Ga0157372_10531889 3300013307 Bacteria 1370
259 Ga0157372_11137588 3300013307 Bacteria 903
260 Ga0157377_10524615 3300014745 Unclassified 832
261 Ga0157379_10113500 3300014968 Bacteria 2435
262 Ga0157379_10163947 3300014968 Bacteria 2006
263 Ga0157379_10254717 3300014968 Bacteria 1594
264 Ga0157379_10347287 3300014968 Bacteria 1358
265 Ga0157376_10000032 3300014969 Bacteria 167294
266 Ga0157376_10999561 3300014969 Bacteria 859
267 Ga0163161_10416941 3300017792 Unclassified 1079
268 Ga0206356_10892166 3300020070 Unclassified 700
269 Ga0206352_10874994 3300020078 Bacteria 869
270 Ga0213876_10014671 3300021384 Bacteria 4151
271 Ga0207656_10011099 3300025321 Bacteria 3395
272 Ga0207653_10000530 3300025885 Bacteria 14360
273 Ga0207692_10079937 3300025898 Bacteria 1746
274 Ga0207647_10224776 3300025904 Unclassified 1081
275 Ga0207685_10463647 3300025905 Unclassified 661
276 Ga0207699_10297246 3300025906 Bacteria 1127
277 Ga0207699_10397267 3300025906 Bacteria 981
278 Ga0207699_11070787 3300025906 Bacteria 597
279 Ga0207684_10000373 3300025910 Bacteria 60635
280 Ga0207684_10002181 3300025910 Bacteria 20037
281 Ga0207684_10040550 3300025910 Bacteria 3947
282 Ga0207684_10050883 3300025910 Bacteria 3515
283 Ga0207684_10053416 3300025910 Bacteria 3429
284 Ga0207684_10064718 3300025910 Bacteria 3104
285 Ga0207684_10116675 3300025910 Bacteria 2288
286 Ga0207684_10175982 3300025910 Unclassified 1845
287 Ga0207684_10256872 3300025910 Bacteria 1508
288 Ga0207684_10332327 3300025910 Bacteria 1309
289 Ga0207684_10376942 3300025910 Bacteria 1220
290 Ga0207654_10081092 3300025911 Bacteria 1953
291 Ga0207654_10210807 3300025911 Bacteria 1284
292 Ga0207654_10284838 3300025911 Unclassified 1119
293 Ga0207707_10071541 3300025912 Bacteria 3022
294 Ga0207695_10043791 3300025913 Bacteria 4766
295 Ga0207695_10535392 3300025913 Bacteria 1053
296 Ga0207695_10631845 3300025913 Bacteria 952
297 Ga0207695_10653254 3300025913 Bacteria 933
298 Ga0207671_10013662 3300025914 Bacteria 6453
299 Ga0207693_10023368 3300025915 Bacteria 4909
300 Ga0207693_10031095 3300025915 Bacteria 4218
301 Ga0207693_10361937 3300025915 Bacteria 1135
302 Ga0207693_10731111 3300025915 Bacteria 765
303 Ga0207663_10032127 3300025916 Bacteria 3114
304 Ga0207663_10100027 3300025916 Bacteria 1945
305 Ga0207663_10124834 3300025916 Bacteria 1769
306 Ga0207663_10636848 3300025916 Bacteria 840
307 Ga0207660_11111804 3300025917 Unclassified 644
308 Ga0207662_10044147 3300025918 Bacteria 2631
309 Ga0207646_10000959 3300025922 Bacteria 37166
310 Ga0207646_10001982 3300025922 Bacteria 24583
311 Ga0207646_10287409 3300025922 Bacteria 1486
312 Ga0207646_10295941 3300025922 Bacteria 1462
313 Ga0207646_10688784 3300025922 Unclassified 914
314 Ga0207646_10876018 3300025922 Unclassified 797
315 Ga0207687_10025793 3300025927 Bacteria 3933
316 Ga0207700_10022410 3300025928 Bacteria 4335
317 Ga0207700_10110483 3300025928 Bacteria 2211
318 Ga0207700_10217333 3300025928 Bacteria 1618
319 Ga0207700_10335378 3300025928 Bacteria 1313
320 Ga0207700_10641646 3300025928 Unclassified 946
321 Ga0207700_11291114 3300025928 Unclassified 650
322 Ga0207664_10011058 3300025929 Bacteria 6395
323 Ga0207664_10386086 3300025929 Bacteria 1244
324 Ga0207664_10476501 3300025929 Bacteria 1116
325 Ga0207664_11128933 3300025929 Unclassified 700
326 Ga0207709_10288646 3300025935 Bacteria 1215
327 Ga0207665_10003170 3300025939 Bacteria 11018
328 Ga0207665_10018500 3300025939 Bacteria 4577
329 Ga0207665_10037521 3300025939 Bacteria 3225
330 Ga0207689_10155127 3300025942 Bacteria 1887
331 Ga0207661_10109141 3300025944 Bacteria 2337
332 Ga0207661_10133491 3300025944 Bacteria 2129
333 Ga0207679_10550665 3300025945 Bacteria 1035
334 Ga0207667_10056807 3300025949 Bacteria 4110
335 Ga0207651_10345784 3300025960 Bacteria 1251
336 Ga0207640_10434538 3300025981 Bacteria 1078
337 Ga0207677_10307445 3300026023 Bacteria 1312
338 Ga0207703_10039208 3300026035 Bacteria 3785
339 Ga0207639_10043391 3300026041 Unclassified 3376
340 Ga0207639_11193245 3300026041 Unclassified 714
341 Ga0207708_10026996 3300026075 Bacteria 4347
342 Ga0207708_10500766 3300026075 Bacteria 1018
343 Ga0207702_10009116 3300026078 Bacteria 8354
344 Ga0207702_10103311 3300026078 Bacteria 2520
345 Ga0207702_10443050 3300026078 Bacteria 1259
346 Ga0207641_10001136 3300026088 Bacteria 26731
347 Ga0207641_10810300 3300026088 Bacteria 927
348 Ga0207641_10975878 3300026088 Bacteria 843
349 Ga0207674_10314226 3300026116 Bacteria 1516
350 Ga0207675_100002978 3300026118 Bacteria 16662
351 Ga0209179_1003839 3300027512 Unclassified 2209
352 Ga0209588_1002598 3300027671 Bacteria 4915
353 Ga0209588_1011244 3300027671 Bacteria 2702
354 Ga0209588_1065911 3300027671 Bacteria 1170
355 Ga0209588_1133564 3300027671 Unclassified 791
356 Ga0268266_10008376 3300028379 Bacteria 9195
357 Ga0268265_10016405 3300028380 Bacteria 5088
358 Ga0268265_10508016 3300028380 Unclassified 1137
359 Ga0268264_10867890 3300028381 Unclassified 904
360 Ga0316178_1175528 3300030735 Bacteria 1448
361 Ga0265770_1087203 3300030878 Unclassified 618
362 Ga0307416_100276054 3300032002 Bacteria 1654
363 Ga0316212_1013866 3300033547 Bacteria 1143
364 Ga0373930_0135275 3300034816 Bacteria 609
365 Ga0373929_0027262 3300035085 Bacteria 1199
366 Ga0373923_0338667 3300035111 Unclassified 717
367 Ga0373936_0117961 3300035113 Unclassified 1131
368 Ga0373956_0023528 3300035119 Bacteria 2645
369 Ga0373960_0020851 3300035121 Bacteria 1737
370 Ga0373943_0010493 3300035170 Bacteria 4151
371 Ga0373942_0033831 3300035207 Bacteria 1365
372 Ga0373961_0078019 3300035241 Bacteria 1037
373 Ga0373931_0282689 3300035691 Unclassified 1019
374 Ga0373927_0006162 3300035695 Bacteria 8197
375 Ga0373933_0158368 3300035724 Bacteria 1437
376 Ga0373947_0582029 3300035725 Bacteria 762
377 Ga0373937_0000410 3300036401 Bacteria 40016
378 Ga0373937_0081359 3300036401 Bacteria 2996
379 Ga0373937_0084603 3300036401 Bacteria 2935
380 Ga0373925_0002912 3300037068 Bacteria 13499
381 Ga0373925_0024809 3300037068 Bacteria 4379
382 Ga0395900_0037969 3300037418 Bacteria 4966
383 Ga0395900_0169977 3300037418 Bacteria 2220
384 Ga0395900_0527371 3300037418 Bacteria 1128
385 Ga0395898_0526760 3300037466 Bacteria 1123
386 Ga0436364_0853195 3300037853 Bacteria 1436
387 Ga0395901_0624755 3300038443 Unclassified 1084
388 Ga0395901_0884831 3300038443 Bacteria 876
389 Ga0436365_1305691 3300039437 Unclassified 909
390 Ga0436365_1497431 3300039437 Bacteria 7141
391 Ga0436362_0832356 3300039453 Bacteria 892
392 Ga0439453_0010758 3300041408 Bacteria 1515
393 Ga0439431_0189442 3300041997 Unclassified 596
394 Ga0451577_0000265 3300042876 Bacteria 103615
395 Ga0453683_0005122 3300044673 Bacteria 9190
396 Ga0453683_0408024 3300044673 Bacteria 876
397 Ga0453684_0001198 3300044712 Bacteria 80046
398 Ga0453684_0249019 3300044712 Bacteria 2041
399 Ga0451576_0008841 3300045051 Bacteria 11764
400 Ga0451576_0210666 3300045051 Bacteria 2030
401 Ga0451576_0282240 3300045051 Bacteria 1736
402 Ga0451576_1246338 3300045051 Unclassified 776
403 Ga0466967_0019984 3300045976 Bacteria 5400
404 Ga0495592_0453450 3300046454 Bacteria 803
405 Ga0495603_0049337 3300046455 Bacteria 2506
406 Ga0495580_0045689 3300046472 Bacteria 3110
407 Ga0495580_0054395 3300046472 Bacteria 2824
408 Ga0495580_0108067 3300046472 Bacteria 1932
409 Ga0495580_0111011 3300046472 Bacteria 1904
410 Ga0495580_0154075 3300046472 Unclassified 1592
411 Ga0495582_0004323 3300046473 Bacteria 7987
412 Ga0495664_0073236 3300046477 Bacteria 2048
413 Ga0495628_0234847 3300046516 Bacteria 1373
414 Ga0495622_0221454 3300046557 Unclassified 838
415 Ga0495658_0010523 3300046683 Bacteria 4629
416 Ga0495674_0088874 3300047319 Bacteria 2642
417 Ga0495672_0041620 3300047320 Bacteria 2777
418 Ga0495684_0563469 3300047471 Bacteria 774
419 Ga0496100_0049555 3300048903 Bacteria 2717
420 Ga0496103_0775300 3300048906 Unclassified 605
421 Ga0496112_0184976 3300048915 Bacteria 2047
422 Ga0496112_0874557 3300048915 Bacteria 821
423 Ga0496113_0123202 3300048916 Bacteria 2029
424 Ga0496114_0047666 3300048917 Bacteria 3564
425 Ga0496115_0226543 3300048918 Bacteria 1542
426 Ga0496115_0256865 3300048918 Bacteria 1437
427 Ga0496115_0328362 3300048918 Bacteria 1250
428 Ga0496115_0414074 3300048918 Unclassified 1092
429 Ga0496126_0665764 3300048929 Bacteria 813
430 Ga0501291_035295 3300049514 Unclassified 859
431 Ga0501076_1026980 3300049592 Unclassified 679
432 Ga0501198_002881 3300049649 Bacteria 2339
433 Ga0501202_017518 3300049652 Bacteria 1400
434 Ga0501217_003765 3300049661 Bacteria 3082
435 Ga0501223_047232 3300049663 Unclassified 835
436 Ga0501235_014145 3300049669 Bacteria 1759
437 Ga0501240_000995 3300049673 Bacteria 2612
438 Ga0501243_006877 3300049675 Bacteria 1731
439 Ga0501249_047545 3300049679 Bacteria 981
440 Ga0501260_030490 3300049689 Unclassified 620
441 Ga0501261_009949 3300049690 Unclassified 1246
442 Ga0501219_017283 3300049703 Unclassified 599
443 Ga0501225_0141404 3300049705 Unclassified 728
444 Ga0501079_0244610 3300049741 Unclassified 1402
445 Ga0501273_029305 3300049770 Unclassified 778
446 Ga0501212_021878 3300049851 Bacteria 994
447 nmdc:mga05p37_17082_c1 3300050507 Bacteria 8752
448 nmdc:mga05p37_17182_c1 3300050507 Bacteria 8728
449 nmdc:mga05p37_188358_c1 3300050507 Bacteria 2507
450 nmdc:mga05p37_602584_c1 3300050507 Bacteria 1240
451 nmdc:mga05p37_820286_c1 3300050507 Unclassified 1015
452 nmdc:mga05p37_898571_c1 3300050507 Unclassified 955
453 nmdc:mga09592_119870_c1 3300050508 Bacteria 2259
454 nmdc:mga0qj67_124771_c1 3300050509 Bacteria 2083
455 nmdc:mga0qj67_926406_c1 3300050509 Unclassified 686
456 nmdc:mga06r32_128688_c1 3300050510 Bacteria 2502
457 nmdc:mga06r32_332044_c1 3300050510 Bacteria 1505
458 nmdc:mga08y16_360096_c1 3300050511 Bacteria 1493
459 nmdc:mga08y16_49305_c1 3300050511 Bacteria 4407
460 nmdc:mga0n895_171129_c1 3300050512 Bacteria 2204
461 nmdc:mga0n895_52830_c1 3300050512 Bacteria 3990
462 nmdc:mga0rr50_261977_c1 3300050513 Bacteria 1438
463 nmdc:mga0rr50_8259_c1 3300050513 Bacteria 6471
464 nmdc:mga08x19_227806_c1 3300050514 Bacteria 1282
465 nmdc:mga08x19_343337_c1 3300050514 Bacteria 1041
466 nmdc:mga0a205_20233_c1 3300050515 Bacteria 6277
467 nmdc:mga0a205_251721_c1 3300050515 Bacteria 1646
468 nmdc:mga0a205_272848_c1 3300050515 Bacteria 1568
469 nmdc:mga0a205_359085_c1 3300050515 Bacteria 1324
470 nmdc:mga0a205_404095_c1 3300050515 Bacteria 1229
471 Ga0495601_0049132 3300053077 Bacteria 2659
472 nmdc:mga0n895_1083554_c1
473 MBSR1b_contig_7951254
474 CNAas_1000348
475 Ga0058862_12666939
476 Ga0065704_10332820
477 Ga0065712_10074827
478 Ga0065715_10006557
479 Ga0065707_10132841
480 Ga0070676_10481321
481 Ga0070683_100064866
482 Ga0068869_100130656
483 Ga0068869_100372509
484 Ga0070682_100026648
485 Ga0068868_100064373
486 Ga0070661_101178526
487 Ga0070692_10007732
488 Ga0070692_10640107
489 Ga0070703_10005580
490 Ga0070709_10133073
491 Ga0070709_10425744
492 Ga0070709_10579226
493 Ga0070709_10713291
494 Ga0070709_10840284
495 Ga0070714_100631721
496 Ga0070714_100729841
497 Ga0070714_101142249
498 Ga0070713_100035065
499 Ga0070713_100043539
500 Ga0070713_100254476
501 Ga0070713_100621862
502 Ga0070713_101225496
503 Ga0070710_10103543
504 Ga0070710_10158432
505 Ga0070711_100034165
506 Ga0070711_100049982
507 Ga0070711_100116203
508 Ga0070711_100443457
509 Ga0070711_101215876
510 Ga0070705_100010850
511 Ga0070705_100887117
512 Ga0070700_100465666
513 Ga0070694_100014946
514 Ga0070694_100016823
515 Ga0070694_100046610
516 Ga0070694_100064866
517 Ga0070694_100110026
518 Ga0070694_100300913
519 Ga0070708_100000804
520 Ga0070708_100019210
521 Ga0070708_100041219
522 Ga0070708_100058732
523 Ga0070708_100059040
524 Ga0070708_100151361
525 Ga0070708_100338182
526 Ga0070708_100347264
527 Ga0070708_100433380
528 Ga0070708_100519957
529 Ga0070708_100716547
530 Ga0070708_100858196
531 Ga0070708_101294247
532 Ga0070681_10119110
533 Ga0070681_10207881
534 Ga0070681_10282259
535 Ga0070706_100001312
536 Ga0070706_100013096
537 Ga0070706_100021105
538 Ga0070706_100074467
539 Ga0070706_100088740
540 Ga0070706_100095769
541 Ga0070706_100138617
542 Ga0070706_100323542
543 Ga0070706_100403000
544 Ga0070706_100543034
545 Ga0070706_100817439
546 Ga0070707_100002670
547 Ga0070707_100014625
548 Ga0070707_100017537
549 Ga0070707_100217919
550 Ga0070707_100227582
551 Ga0070707_100352292
552 Ga0070707_100583223
553 Ga0070698_100000147
554 Ga0070698_100007117
555 Ga0070698_100027658
556 Ga0070698_100037968
557 Ga0070698_100056226
558 Ga0070698_100086074
559 Ga0070698_100168553
560 Ga0070698_100177996
561 Ga0070698_100444318
562 Ga0070699_100006700
563 Ga0070699_100017820
564 Ga0070699_100223953
565 Ga0070699_100250003
566 Ga0070699_100481699
567 Ga0070699_100656559
568 Ga0070699_100738524
569 Ga0070684_100143489
570 Ga0070684_100339732
571 Ga0070697_100000503
572 Ga0070697_100001609
573 Ga0070697_100019114
574 Ga0070697_100062988
575 Ga0070697_100067155
576 Ga0070697_100209663
577 Ga0070697_100640440
578 Ga0070697_100716192
579 Ga0070697_100962029
580 Ga0070697_101133061
581 Ga0068853_100537071
582 Ga0070695_100423848
583 Ga0070696_100013400
584 Ga0070696_100122469
585 Ga0070696_100189492
586 Ga0070696_100504075
587 Ga0070696_100560802
588 Ga0070693_100065007
589 Ga0070693_100129346
590 Ga0070665_100046630
591 Ga0070704_100095811
592 Ga0070704_100172231
593 Ga0070704_100278550
594 Ga0068855_100147679
595 Ga0068855_100278695
596 Ga0070664_100462290
597 Ga0070664_101458612
598 Ga0068857_100087618
599 Ga0068854_100048969
600 Ga0068854_100385725
601 Ga0068854_100581369
602 Ga0068854_101087484
603 Ga0068856_100066676
604 Ga0068856_100140380
605 Ga0068856_100659400
606 Ga0068856_100896154
607 Ga0070702_100549276
608 Ga0068852_101773900
609 Ga0068859_100015320
610 Ga0068859_100060789
611 Ga0068859_100402119
612 Ga0068866_10213595
613 Ga0068861_100001804
614 Ga0068861_100219838
615 Ga0068851_10001281
616 Ga0068851_10327131
617 Ga0068863_100002139
618 Ga0068863_100272417
619 Ga0068858_100033237
620 Ga0068860_100152899
621 Ga0070717_10000455
622 Ga0070717_10005046
623 Ga0070717_10408735
624 Ga0070717_10449867
625 Ga0070716_100000354
626 Ga0070716_100025856
627 Ga0070716_100049879
628 Ga0070716_100060639
629 Ga0070716_100082144
630 Ga0070716_100178858
631 Ga0070716_100339637
632 Ga0070716_100926939
633 Ga0070712_100022441
634 Ga0070712_100067827
635 Ga0070712_100246835
636 Ga0070712_100268870
637 Ga0070712_100483686
638 Ga0070712_100668689
639 Ga0070712_101499066
640 Ga0097621_100007625
641 Ga0097621_100739142
642 Ga0097621_101118538
643 Ga0097621_101349032
644 Ga0068871_100014024
645 Ga0068871_100487229
646 Ga0075428_100112935
647 Ga0075428_100513255
648 Ga0075428_101276724
649 Ga0075430_100017968
650 Ga0075430_100395439
651 Ga0075431_100261823
652 Ga0075431_100434049
653 Ga0075433_10045361
654 Ga0075433_10133877
655 Ga0075433_10137209
656 Ga0075433_10378170
657 Ga0075433_11646831
658 Ga0075434_100040621
659 Ga0075434_100184195
660 Ga0075434_100194092
661 Ga0075429_100155859
662 Ga0075436_100225166
663 Ga0075436_100990561
664 Ga0097620_100015320
665 Ga0097620_100060789
666 Ga0097620_100402117
667 Ga0075435_100019129
668 Ga0075435_100020485
669 Ga0075435_100263470
670 Ga0075435_100345714
671 Ga0099794_10001839
672 Ga0099794_10014370
673 Ga0099794_10029340
674 Ga0099794_10042165
675 Ga0099794_10077501
676 Ga0099794_10156167
677 Ga0099794_10192966
678 Ga0099794_10402515
679 Ga0105240_10079119
680 Ga0105240_10211471
681 Ga0105240_10400839
682 Ga0111539_10043923
683 Ga0111539_10137494
684 Ga0105245_10056544
685 Ga0114129_10012206
686 Ga0114129_10109201
687 Ga0114129_10148688
688 Ga0114129_10193630
689 Ga0114129_10206023
690 Ga0114129_10365526
691 Ga0114129_10669749
692 Ga0114129_10673335
693 Ga0114129_10895897
694 Ga0114129_12732352
695 Ga0105243_10631128
696 Ga0105241_10005683
697 Ga0105241_10054403
698 Ga0105241_10109721
699 Ga0105241_10369620
700 Ga0105242_10296024
701 Ga0105248_10055043
702 Ga0105237_10000521
703 Ga0105237_10027642
704 Ga0105237_10453720
705 Ga0105238_10044642
706 Ga0105238_10379951
707 Ga0105238_10455473
708 Ga0105238_10769152
709 Ga0105238_11546844
710 Ga0099796_10337921
711 Ga0105239_11434933
712 Ga0105239_11542686
713 Ga0105246_10217307
714 Ga0157373_10001043
715 Ga0157373_10031158
716 Ga0157369_10114132
717 Ga0157369_10540131
718 Ga0157369_11645794
719 Ga0157374_10073338
720 Ga0157378_10387619
721 Ga0157378_10680687
722 Ga0157378_11022841
723 Ga0163162_10010856
724 Ga0163162_10805994
725 Ga0163162_11963013
726 Ga0157372_10001998
727 Ga0157372_10018945
728 Ga0157372_10365272
729 Ga0157372_10531889
730 Ga0157372_11137588
731 Ga0157377_10524615
732 Ga0157379_10113500
733 Ga0157379_10163947
734 Ga0157379_10254717
735 Ga0157379_10347287
736 Ga0157376_10000032
737 Ga0157376_10999561
738 Ga0163161_10416941
739 Ga0206356_10892166
740 Ga0206352_10874994
741 Ga0213876_10014671
742 Ga0207656_10011099
743 Ga0207653_10000530
744 Ga0207692_10079937
745 Ga0207647_10224776
746 Ga0207685_10463647
747 Ga0207699_10297246
748 Ga0207699_10397267
749 Ga0207699_11070787
750 Ga0207684_10000373
751 Ga0207684_10002181
752 Ga0207684_10040550
753 Ga0207684_10050883
754 Ga0207684_10053416
755 Ga0207684_10064718
756 Ga0207684_10116675
757 Ga0207684_10175982
758 Ga0207684_10256872
759 Ga0207684_10332327
760 Ga0207684_10376942
761 Ga0207654_10081092
762 Ga0207654_10210807
763 Ga0207654_10284838
764 Ga0207707_10071541
765 Ga0207695_10043791
766 Ga0207695_10535392
767 Ga0207695_10631845
768 Ga0207695_10653254
769 Ga0207671_10013662
770 Ga0207693_10023368
771 Ga0207693_10031095
772 Ga0207693_10361937
773 Ga0207693_10731111
774 Ga0207663_10032127
775 Ga0207663_10100027
776 Ga0207663_10124834
777 Ga0207663_10636848
778 Ga0207660_11111804
779 Ga0207662_10044147
780 Ga0207646_10000959
781 Ga0207646_10001982
782 Ga0207646_10287409
783 Ga0207646_10295941
784 Ga0207646_10688784
785 Ga0207646_10876018
786 Ga0207687_10025793
787 Ga0207700_10022410
788 Ga0207700_10110483
789 Ga0207700_10217333
790 Ga0207700_10335378
791 Ga0207700_10641646
792 Ga0207700_11291114
793 Ga0207664_10011058
794 Ga0207664_10386086
795 Ga0207664_10476501
796 Ga0207664_11128933
797 Ga0207709_10288646
798 Ga0207665_10003170
799 Ga0207665_10018500
800 Ga0207665_10037521
801 Ga0207689_10155127
802 Ga0207661_10109141
803 Ga0207661_10133491
804 Ga0207679_10550665
805 Ga0207667_10056807
806 Ga0207651_10345784
807 Ga0207640_10434538
808 Ga0207677_10307445
809 Ga0207703_10039208
810 Ga0207639_10043391
811 Ga0207639_11193245
812 Ga0207708_10026996
813 Ga0207708_10500766
814 Ga0207702_10009116
815 Ga0207702_10103311
816 Ga0207702_10443050
817 Ga0207641_10001136
818 Ga0207641_10810300
819 Ga0207641_10975878
820 Ga0207674_10314226
821 Ga0207675_100002978
822 Ga0209179_1003839
823 Ga0209588_1002598
824 Ga0209588_1011244
825 Ga0209588_1065911
826 Ga0209588_1133564
827 Ga0268266_10008376
828 Ga0268265_10016405
829 Ga0268265_10508016
830 Ga0268264_10867890
831 Ga0316178_1175528
832 Ga0265770_1087203
833 Ga0307416_100276054
834 Ga0316212_1013866
835 Ga0373930_0135275
836 Ga0373929_0027262
837 Ga0373923_0338667
838 Ga0373936_0117961
839 Ga0373956_0023528
840 Ga0373960_0020851
841 Ga0373943_0010493
842 Ga0373942_0033831
843 Ga0373961_0078019
844 Ga0373931_0282689
845 Ga0373927_0006162
846 Ga0373933_0158368
847 Ga0373947_0582029
848 Ga0373937_0000410
849 Ga0373937_0081359
850 Ga0373937_0084603
851 Ga0373925_0002912
852 Ga0373925_0024809
853 Ga0395900_0037969
854 Ga0395900_0169977
855 Ga0395900_0527371
856 Ga0395898_0526760
857 Ga0436364_0853195
858 Ga0395901_0624755
859 Ga0395901_0884831
860 Ga0436365_1305691
861 Ga0436365_1497431
862 Ga0436362_0832356
863 Ga0439453_0010758
864 Ga0439431_0189442
865 Ga0451577_0000265
866 Ga0453683_0005122
867 Ga0453683_0408024
868 Ga0453684_0001198
869 Ga0453684_0249019
870 Ga0451576_0008841
871 Ga0451576_0210666
872 Ga0451576_0282240
873 Ga0451576_1246338
874 Ga0466967_0019984
875 Ga0495592_0453450
876 Ga0495603_0049337
877 Ga0495580_0045689
878 Ga0495580_0054395
879 Ga0495580_0108067
880 Ga0495580_0111011
881 Ga0495580_0154075
882 Ga0495582_0004323
883 Ga0495664_0073236
884 Ga0495628_0234847
885 Ga0495622_0221454
886 Ga0495658_0010523
887 Ga0495674_0088874
888 Ga0495672_0041620
889 Ga0495684_0563469
890 Ga0496100_0049555
891 Ga0496103_0775300
892 Ga0496112_0184976
893 Ga0496112_0874557
894 Ga0496113_0123202
895 Ga0496114_0047666
896 Ga0496115_0226543
897 Ga0496115_0256865
898 Ga0496115_0328362
899 Ga0496115_0414074
900 Ga0496126_0665764
901 Ga0501291_035295
902 Ga0501076_1026980
903 Ga0501198_002881
904 Ga0501202_017518
905 Ga0501217_003765
906 Ga0501223_047232
907 Ga0501235_014145
908 Ga0501240_000995
909 Ga0501243_006877
910 Ga0501249_047545
911 Ga0501260_030490
912 Ga0501261_009949
913 Ga0501219_017283
914 Ga0501225_0141404
915 Ga0501079_0244610
916 Ga0501273_029305
917 Ga0501212_021878
918 nmdc:mga05p37_17082_c1
919 nmdc:mga05p37_17182_c1
920 nmdc:mga05p37_188358_c1
921 nmdc:mga05p37_602584_c1
922 nmdc:mga05p37_820286_c1
923 nmdc:mga05p37_898571_c1
924 nmdc:mga09592_119870_c1
925 nmdc:mga0qj67_124771_c1
926 nmdc:mga0qj67_926406_c1
927 nmdc:mga06r32_128688_c1
928 nmdc:mga06r32_332044_c1
929 nmdc:mga08y16_360096_c1
930 nmdc:mga08y16_49305_c1
931 nmdc:mga0n895_171129_c1
932 nmdc:mga0n895_52830_c1
933 nmdc:mga0rr50_261977_c1
934 nmdc:mga0rr50_8259_c1
935 nmdc:mga08x19_227806_c1
936 nmdc:mga08x19_343337_c1
937 nmdc:mga0a205_20233_c1
938 nmdc:mga0a205_251721_c1
939 nmdc:mga0a205_272848_c1
940 nmdc:mga0a205_359085_c1
941 nmdc:mga0a205_404095_c1
942 Ga0495601_0049132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dti-assembly1.cif.gz_B cryo-em structure of arabidopsis spy in complex with gdp-fucose 0.8006 12 144
2wqh-assembly1.cif.gz_A-2 crystal structure of ctpr3y3 0.7919 13 129
7qij-assembly2.cif.gz_LC complex of the yersinia enterocolitica type iii secretion export gate yscv with substrate:chaperone complex yscx:yscy 0.7907 8 129
1na3-assembly1.cif.gz_A design of stable alpha-helical arrays from an idealized tpr motif 0.7899 11 98
3cvq-assembly1.cif.gz_A structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to pts1 peptide (7-skl) 0.7829 13 146
ID Description Score Start End Superfamily
af_A4I5Y0_716_784_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9428 14 78 1.25.40.10
af_Q58741_243_314_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9385 13 78 1.25.40.10
af_K7KS32_371_483_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9038 8 78 1.25.40.10
af_Q7K4B6_500_587_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9007 13 78 1.25.40.10
af_E9PV48_132_190_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.899 4 60 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A1Q7L1G1-F1-model_v4 Tetratricopeptide repeat protein 0.9976 28 147
AF-A0A7W1H631-F1-model_v4 Tetratricopeptide repeat protein 0.9938 1 149
AF-A0A4Q7YQ27-F1-model_v4 Tetratricopeptide repeat protein 0.9914 1 147
AF-A0A534SXJ4-F1-model_v4 Tetratricopeptide repeat protein 0.9799 1 148
AF-A0A849Z4Y5-F1-model_v4 Tetratricopeptide repeat protein 0.9756 2 150

Map