F450680
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 471 | 250 | 471 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_606533_c1|nmdc:mga05p37_606533_c1_87_1157 |
| Length | 356 |
| Sequence | VSKSAIRISKSEQTKDHPTDEIRNAFVSKFWFVDGLNLMETQNVSDGSNERLSSTRPSRHRWWQRFCRIGKFAFWLIVIYMIVQQILGPYWTNAARASVLDQFQQQRKSRVIAMIHRQETISLFGVPVSSYIDIEDSEAVLRAIRLTPPDQPIDMILHTPGGLVLAAEQIAKALVEHKGKVTVFVPHYAMSGGTLIALAADEIVMDANAVLGPVDPQIGDMPAASILRVLNLKQVNRIKDETLELADVAAKARLQVASFVTELLLSRLPKDKAVSLATVLTEGRWTHDFPITVELARQLGLSVSTEMPRIVYELMDLFPQGGADRPSVLYVPLHRSPAGRDEAPASAPAAPTKTKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 166 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 167 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 168 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 170 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 185 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 186 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 232 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.06 |
| Rhizosphere | 98.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10013851 | 3300005295 | Bacteria | 2544 |
| 2 | Ga0070676_10068779 | 3300005328 | Bacteria | 2120 |
| 3 | Ga0070683_100000797 | 3300005329 | Bacteria | 23295 |
| 4 | Ga0070690_100022598 | 3300005330 | Bacteria | 3848 |
| 5 | Ga0070670_100000847 | 3300005331 | Bacteria | 23922 |
| 6 | Ga0070670_100127205 | 3300005331 | Bacteria | 2199 |
| 7 | Ga0068869_100000136 | 3300005334 | Bacteria | 35581 |
| 8 | Ga0068869_100000362 | 3300005334 | Bacteria | 24432 |
| 9 | Ga0070680_100000125 | 3300005336 | Bacteria | 45537 |
| 10 | Ga0070680_100016572 | 3300005336 | Bacteria | 5799 |
| 11 | Ga0070682_100000189 | 3300005337 | Bacteria | 46408 |
| 12 | Ga0070682_100005691 | 3300005337 | Bacteria | 6945 |
| 13 | Ga0068868_100003571 | 3300005338 | Bacteria | 10831 |
| 14 | Ga0068868_100008898 | 3300005338 | Bacteria | 7197 |
| 15 | Ga0068868_100053284 | 3300005338 | Bacteria | 3187 |
| 16 | Ga0070660_100001383 | 3300005339 | Bacteria | 16493 |
| 17 | Ga0070689_100009703 | 3300005340 | Bacteria | 6830 |
| 18 | Ga0070689_100012506 | 3300005340 | Bacteria | 6116 |
| 19 | Ga0070691_10000756 | 3300005341 | Bacteria | 12780 |
| 20 | Ga0070691_10025299 | 3300005341 | Bacteria | 2764 |
| 21 | Ga0070687_100001869 | 3300005343 | Bacteria | 7636 |
| 22 | Ga0070661_100001580 | 3300005344 | Bacteria | 15799 |
| 23 | Ga0070661_100007535 | 3300005344 | Bacteria | 7509 |
| 24 | Ga0070692_10019995 | 3300005345 | Bacteria | 3239 |
| 25 | Ga0070669_100370718 | 3300005353 | Bacteria | 1166 |
| 26 | Ga0070675_100184726 | 3300005354 | Bacteria | 1804 |
| 27 | Ga0070671_100108722 | 3300005355 | Bacteria | 2328 |
| 28 | Ga0070673_100059774 | 3300005364 | Bacteria | 3018 |
| 29 | Ga0070659_100000654 | 3300005366 | Bacteria | 25209 |
| 30 | Ga0070703_10002746 | 3300005406 | Bacteria | 5051 |
| 31 | Ga0070703_10005900 | 3300005406 | Bacteria | 3430 |
| 32 | Ga0070703_10025416 | 3300005406 | Bacteria | 1757 |
| 33 | Ga0070713_100557732 | 3300005436 | Unclassified | 1085 |
| 34 | Ga0070701_10000076 | 3300005438 | Bacteria | 27089 |
| 35 | Ga0070711_100009995 | 3300005439 | Bacteria | 5855 |
| 36 | Ga0070705_100003134 | 3300005440 | Bacteria | 8131 |
| 37 | Ga0070705_100029182 | 3300005440 | Bacteria | 3030 |
| 38 | Ga0070705_100271582 | 3300005440 | Bacteria | 1201 |
| 39 | Ga0070700_100000605 | 3300005441 | Bacteria | 17941 |
| 40 | Ga0070694_100000248 | 3300005444 | Bacteria | 28528 |
| 41 | Ga0070694_100000270 | 3300005444 | Bacteria | 27446 |
| 42 | Ga0070694_100070795 | 3300005444 | Bacteria | 2402 |
| 43 | Ga0070708_100033291 | 3300005445 | Bacteria | 4478 |
| 44 | Ga0070708_100103044 | 3300005445 | Bacteria | 2616 |
| 45 | Ga0070708_100148088 | 3300005445 | Bacteria | 2182 |
| 46 | Ga0070708_100318212 | 3300005445 | Bacteria | 1466 |
| 47 | Ga0070708_100350443 | 3300005445 | Bacteria | 1391 |
| 48 | Ga0070708_100464657 | 3300005445 | Bacteria | 1194 |
| 49 | Ga0070663_100027659 | 3300005455 | Bacteria | 3853 |
| 50 | Ga0070678_100013614 | 3300005456 | Bacteria | 5109 |
| 51 | Ga0070662_100012746 | 3300005457 | Bacteria | 5581 |
| 52 | Ga0070681_10003675 | 3300005458 | Bacteria | 14391 |
| 53 | Ga0070681_10005555 | 3300005458 | Bacteria | 12179 |
| 54 | Ga0070681_10023396 | 3300005458 | Bacteria | 6212 |
| 55 | Ga0068867_100000406 | 3300005459 | Bacteria | 29006 |
| 56 | Ga0068867_100013675 | 3300005459 | Bacteria | 5747 |
| 57 | Ga0068867_100021905 | 3300005459 | Bacteria | 4564 |
| 58 | Ga0070706_100020186 | 3300005467 | Bacteria | 6139 |
| 59 | Ga0070706_100043145 | 3300005467 | Bacteria | 4166 |
| 60 | Ga0070706_100052281 | 3300005467 | Bacteria | 3771 |
| 61 | Ga0070706_100110987 | 3300005467 | Unclassified | 2552 |
| 62 | Ga0070707_100032615 | 3300005468 | Bacteria | 4963 |
| 63 | Ga0070707_100077693 | 3300005468 | Bacteria | 3203 |
| 64 | Ga0070707_100123849 | 3300005468 | Bacteria | 2511 |
| 65 | Ga0070707_100485201 | 3300005468 | Unclassified | 1197 |
| 66 | Ga0070707_100494389 | 3300005468 | Bacteria | 1185 |
| 67 | Ga0070698_100013021 | 3300005471 | Bacteria | 8805 |
| 68 | Ga0070698_100043095 | 3300005471 | Bacteria | 4628 |
| 69 | Ga0070698_100081478 | 3300005471 | Unclassified | 3230 |
| 70 | Ga0070698_100235784 | 3300005471 | Bacteria | 1763 |
| 71 | Ga0070698_100401976 | 3300005471 | Bacteria | 1303 |
| 72 | Ga0070699_100009468 | 3300005518 | Bacteria | 8438 |
| 73 | Ga0070699_100038197 | 3300005518 | Bacteria | 4157 |
| 74 | Ga0070699_100039648 | 3300005518 | Bacteria | 4078 |
| 75 | Ga0070679_100023995 | 3300005530 | Bacteria | 5974 |
| 76 | Ga0070679_100051577 | 3300005530 | Bacteria | 4097 |
| 77 | Ga0070679_100101310 | 3300005530 | Bacteria | 2867 |
| 78 | Ga0070697_100014600 | 3300005536 | Bacteria | 6167 |
| 79 | Ga0068853_100003423 | 3300005539 | Bacteria | 12130 |
| 80 | Ga0070672_100038612 | 3300005543 | Bacteria | 3650 |
| 81 | Ga0070672_100052921 | 3300005543 | Bacteria | 3172 |
| 82 | Ga0070686_100004039 | 3300005544 | Bacteria | 8070 |
| 83 | Ga0070686_100018143 | 3300005544 | Bacteria | 4124 |
| 84 | Ga0070695_100002250 | 3300005545 | Bacteria | 11049 |
| 85 | Ga0070695_100027024 | 3300005545 | Bacteria | 3553 |
| 86 | Ga0070696_100000114 | 3300005546 | Bacteria | 41488 |
| 87 | Ga0070696_100001321 | 3300005546 | Bacteria | 16168 |
| 88 | Ga0070696_100009753 | 3300005546 | Bacteria | 6426 |
| 89 | Ga0070693_100000119 | 3300005547 | Bacteria | 35136 |
| 90 | Ga0070693_100000483 | 3300005547 | Bacteria | 17830 |
| 91 | Ga0070704_100000068 | 3300005549 | Bacteria | 34169 |
| 92 | Ga0070704_100000769 | 3300005549 | Bacteria | 15800 |
| 93 | Ga0068855_100000315 | 3300005563 | Bacteria | 60189 |
| 94 | Ga0068855_100002155 | 3300005563 | Bacteria | 24332 |
| 95 | Ga0070664_100005044 | 3300005564 | Bacteria | 10585 |
| 96 | Ga0070664_100028520 | 3300005564 | Bacteria | 4644 |
| 97 | Ga0068857_100002336 | 3300005577 | Bacteria | 15430 |
| 98 | Ga0068854_100004237 | 3300005578 | Bacteria | 9032 |
| 99 | Ga0068854_100014574 | 3300005578 | Bacteria | 5186 |
| 100 | Ga0068856_100010613 | 3300005614 | Bacteria | 8950 |
| 101 | Ga0068856_100013069 | 3300005614 | Bacteria | 8041 |
| 102 | Ga0070702_100000140 | 3300005615 | Bacteria | 22411 |
| 103 | Ga0070702_100022920 | 3300005615 | Bacteria | 3310 |
| 104 | Ga0068852_100062299 | 3300005616 | Unclassified | 3244 |
| 105 | Ga0068852_100167092 | 3300005616 | Bacteria | 2059 |
| 106 | Ga0068859_100000543 | 3300005617 | Bacteria | 37386 |
| 107 | Ga0068859_100008108 | 3300005617 | Bacteria | 10654 |
| 108 | Ga0068864_100004337 | 3300005618 | Bacteria | 11648 |
| 109 | Ga0068864_100039691 | 3300005618 | Bacteria | 4023 |
| 110 | Ga0068866_10000166 | 3300005718 | Bacteria | 30436 |
| 111 | Ga0068861_100002341 | 3300005719 | Bacteria | 12319 |
| 112 | Ga0068861_100112243 | 3300005719 | Bacteria | 2185 |
| 113 | Ga0068851_10034044 | 3300005834 | Bacteria | 2541 |
| 114 | Ga0068870_10001528 | 3300005840 | Bacteria | 9394 |
| 115 | Ga0068863_100158316 | 3300005841 | Bacteria | 2169 |
| 116 | Ga0068863_100329500 | 3300005841 | Bacteria | 1484 |
| 117 | Ga0068863_100359349 | 3300005841 | Bacteria | 1419 |
| 118 | Ga0068858_100001484 | 3300005842 | Bacteria | 24147 |
| 119 | Ga0068858_100199251 | 3300005842 | Bacteria | 1893 |
| 120 | Ga0068860_100005557 | 3300005843 | Bacteria | 12752 |
| 121 | Ga0068860_100330825 | 3300005843 | Bacteria | 1496 |
| 122 | Ga0068862_100004960 | 3300005844 | Bacteria | 11206 |
| 123 | Ga0068862_100095963 | 3300005844 | Bacteria | 2587 |
| 124 | Ga0081455_10000601 | 3300005937 | Bacteria | 46589 |
| 125 | Ga0081455_10006241 | 3300005937 | Bacteria | 12833 |
| 126 | Ga0081539_10002956 | 3300005985 | Bacteria | 22338 |
| 127 | Ga0070717_10203145 | 3300006028 | Unclassified | 1736 |
| 128 | Ga0070716_100001154 | 3300006173 | Bacteria | 11646 |
| 129 | Ga0070716_100062453 | 3300006173 | Bacteria | 2160 |
| 130 | Ga0070716_100157976 | 3300006173 | Bacteria | 1466 |
| 131 | Ga0070712_100032396 | 3300006175 | Bacteria | 3529 |
| 132 | Ga0097621_100000836 | 3300006237 | Bacteria | 21659 |
| 133 | Ga0097621_100010805 | 3300006237 | Bacteria | 6699 |
| 134 | Ga0097621_100023939 | 3300006237 | Bacteria | 4760 |
| 135 | Ga0068871_100001789 | 3300006358 | Bacteria | 14490 |
| 136 | Ga0068871_100002227 | 3300006358 | Bacteria | 13174 |
| 137 | Ga0075428_100028947 | 3300006844 | Bacteria | 6130 |
| 138 | Ga0075428_100288345 | 3300006844 | Unclassified | 1766 |
| 139 | Ga0075428_100707462 | 3300006844 | Bacteria | 1073 |
| 140 | Ga0075428_100798209 | 3300006844 | Bacteria | 1003 |
| 141 | Ga0075430_100008721 | 3300006846 | Bacteria | 8557 |
| 142 | Ga0075430_100234633 | 3300006846 | Bacteria | 1521 |
| 143 | Ga0075431_100020660 | 3300006847 | Bacteria | 6728 |
| 144 | Ga0075431_100030375 | 3300006847 | Bacteria | 5565 |
| 145 | Ga0075431_100398099 | 3300006847 | Bacteria | 1378 |
| 146 | Ga0075431_100431554 | 3300006847 | Bacteria | 1316 |
| 147 | Ga0075431_100563675 | 3300006847 | Bacteria | 1125 |
| 148 | Ga0075433_10003626 | 3300006852 | Bacteria | 11927 |
| 149 | Ga0075433_10007931 | 3300006852 | Bacteria | 8450 |
| 150 | Ga0075433_10030096 | 3300006852 | Bacteria | 4630 |
| 151 | Ga0075433_10127128 | 3300006852 | Bacteria | 2263 |
| 152 | Ga0075433_10129833 | 3300006852 | Bacteria | 2239 |
| 153 | Ga0075434_100002226 | 3300006871 | Bacteria | 16934 |
| 154 | Ga0075434_100167057 | 3300006871 | Bacteria | 2220 |
| 155 | Ga0075434_100346033 | 3300006871 | Unclassified | 1508 |
| 156 | Ga0075434_100468172 | 3300006871 | Bacteria | 1281 |
| 157 | Ga0075429_100006285 | 3300006880 | Bacteria | 10283 |
| 158 | Ga0075429_100039798 | 3300006880 | Bacteria | 4091 |
| 159 | Ga0075429_100061009 | 3300006880 | Unclassified | 3285 |
| 160 | Ga0075429_100169413 | 3300006880 | Bacteria | 1913 |
| 161 | Ga0075429_100312989 | 3300006880 | Unclassified | 1374 |
| 162 | Ga0068865_100000254 | 3300006881 | Bacteria | 29586 |
| 163 | Ga0075436_100002173 | 3300006914 | Bacteria | 13516 |
| 164 | Ga0075436_100006027 | 3300006914 | Bacteria | 8321 |
| 165 | Ga0075436_100047451 | 3300006914 | Unclassified | 2963 |
| 166 | Ga0075436_100091616 | 3300006914 | Bacteria | 2113 |
| 167 | Ga0075436_100151569 | 3300006914 | Bacteria | 1632 |
| 168 | Ga0075436_100173879 | 3300006914 | Bacteria | 1521 |
| 169 | Ga0097620_100000543 | 3300006931 | Bacteria | 37386 |
| 170 | Ga0097620_100008107 | 3300006931 | Bacteria | 10654 |
| 171 | Ga0075435_100000806 | 3300007076 | Bacteria | 19514 |
| 172 | Ga0075435_100132207 | 3300007076 | Bacteria | 2088 |
| 173 | Ga0075435_100417319 | 3300007076 | Bacteria | 1155 |
| 174 | Ga0099794_10006410 | 3300007265 | Bacteria | 4763 |
| 175 | Ga0099794_10018238 | 3300007265 | Bacteria | 3144 |
| 176 | Ga0111539_10063797 | 3300009094 | Unclassified | 4359 |
| 177 | Ga0111539_10091260 | 3300009094 | Bacteria | 3579 |
| 178 | Ga0111539_10302487 | 3300009094 | Bacteria | 1861 |
| 179 | Ga0105245_10001077 | 3300009098 | Bacteria | 24735 |
| 180 | Ga0114129_10000730 | 3300009147 | Bacteria | 41752 |
| 181 | Ga0114129_10043047 | 3300009147 | Bacteria | 6356 |
| 182 | Ga0114129_10059177 | 3300009147 | Bacteria | 5356 |
| 183 | Ga0114129_10150641 | 3300009147 | Bacteria | 3184 |
| 184 | Ga0114129_10192348 | 3300009147 | Bacteria | 2770 |
| 185 | Ga0114129_10625450 | 3300009147 | Bacteria | 1392 |
| 186 | Ga0114129_10710854 | 3300009147 | Unclassified | 1290 |
| 187 | Ga0114129_10802243 | 3300009147 | Bacteria | 1201 |
| 188 | Ga0105243_10000508 | 3300009148 | Bacteria | 39703 |
| 189 | Ga0105241_10013593 | 3300009174 | Bacteria | 5966 |
| 190 | Ga0105242_10000746 | 3300009176 | Bacteria | 25338 |
| 191 | Ga0105242_10091145 | 3300009176 | Bacteria | 2566 |
| 192 | Ga0105248_10068978 | 3300009177 | Bacteria | 3970 |
| 193 | Ga0105248_10352371 | 3300009177 | Bacteria | 1657 |
| 194 | Ga0105249_10004637 | 3300009553 | Bacteria | 11878 |
| 195 | Ga0105249_10109271 | 3300009553 | Unclassified | 2612 |
| 196 | Ga0105239_10017858 | 3300010375 | Bacteria | 7846 |
| 197 | Ga0105246_10236606 | 3300011119 | Bacteria | 1441 |
| 198 | Ga0157373_10001185 | 3300013100 | Bacteria | 19935 |
| 199 | Ga0157371_10098715 | 3300013102 | Bacteria | 2071 |
| 200 | Ga0157370_10249714 | 3300013104 | Bacteria | 1641 |
| 201 | Ga0157369_10004085 | 3300013105 | Bacteria | 17279 |
| 202 | Ga0157374_10002050 | 3300013296 | Bacteria | 16944 |
| 203 | Ga0157378_10000714 | 3300013297 | Bacteria | 31062 |
| 204 | Ga0157378_10023436 | 3300013297 | Bacteria | 5434 |
| 205 | Ga0157378_10273649 | 3300013297 | Bacteria | 1625 |
| 206 | Ga0163162_10025577 | 3300013306 | Bacteria | 5834 |
| 207 | Ga0163162_10177334 | 3300013306 | Archaea | 2257 |
| 208 | Ga0157372_10004865 | 3300013307 | Bacteria | 14273 |
| 209 | Ga0157375_10001207 | 3300013308 | Bacteria | 22301 |
| 210 | Ga0157375_10245384 | 3300013308 | Bacteria | 1951 |
| 211 | Ga0163163_10090117 | 3300014325 | Bacteria | 3080 |
| 212 | Ga0182008_10064267 | 3300014497 | Bacteria | 1807 |
| 213 | Ga0157377_10182315 | 3300014745 | Bacteria | 1321 |
| 214 | Ga0157376_10020785 | 3300014969 | Bacteria | 5088 |
| 215 | Ga0182007_10023877 | 3300015262 | Bacteria | 2146 |
| 216 | Ga0207656_10037461 | 3300025321 | Bacteria | 2041 |
| 217 | Ga0207653_10003370 | 3300025885 | Bacteria | 5044 |
| 218 | Ga0207653_10012545 | 3300025885 | Bacteria | 2647 |
| 219 | Ga0207642_10005820 | 3300025899 | Bacteria | 4055 |
| 220 | Ga0207680_10091171 | 3300025903 | Bacteria | 1939 |
| 221 | Ga0207680_10116278 | 3300025903 | Bacteria | 1743 |
| 222 | Ga0207645_10005247 | 3300025907 | Bacteria | 9439 |
| 223 | Ga0207643_10000296 | 3300025908 | Bacteria | 34571 |
| 224 | Ga0207684_10015309 | 3300025910 | Bacteria | 6603 |
| 225 | Ga0207684_10027482 | 3300025910 | Bacteria | 4848 |
| 226 | Ga0207684_10067983 | 3300025910 | Unclassified | 3028 |
| 227 | Ga0207684_10383259 | 3300025910 | Unclassified | 1209 |
| 228 | Ga0207654_10025012 | 3300025911 | Bacteria | 3216 |
| 229 | Ga0207654_10084278 | 3300025911 | Bacteria | 1921 |
| 230 | Ga0207707_10000443 | 3300025912 | Bacteria | 43041 |
| 231 | Ga0207707_10014358 | 3300025912 | Bacteria | 6898 |
| 232 | Ga0207707_10069976 | 3300025912 | Bacteria | 3058 |
| 233 | Ga0207693_10017227 | 3300025915 | Bacteria | 5761 |
| 234 | Ga0207660_10000830 | 3300025917 | Bacteria | 20366 |
| 235 | Ga0207660_10002832 | 3300025917 | Bacteria | 11370 |
| 236 | Ga0207662_10000364 | 3300025918 | Bacteria | 20389 |
| 237 | Ga0207657_10000095 | 3300025919 | Bacteria | 85098 |
| 238 | Ga0207649_10008213 | 3300025920 | Bacteria | 5685 |
| 239 | Ga0207649_10023423 | 3300025920 | Bacteria | 3576 |
| 240 | Ga0207652_10023191 | 3300025921 | Bacteria | 5140 |
| 241 | Ga0207652_10023639 | 3300025921 | Bacteria | 5092 |
| 242 | Ga0207646_10003336 | 3300025922 | Bacteria | 18235 |
| 243 | Ga0207646_10044429 | 3300025922 | Bacteria | 3988 |
| 244 | Ga0207646_10063931 | 3300025922 | Bacteria | 3285 |
| 245 | Ga0207646_10169847 | 3300025922 | Bacteria | 1969 |
| 246 | Ga0207646_10557791 | 3300025922 | Bacteria | 1030 |
| 247 | Ga0207681_10085841 | 3300025923 | Bacteria | 2235 |
| 248 | Ga0207650_10000686 | 3300025925 | Bacteria | 26590 |
| 249 | Ga0207650_10009474 | 3300025925 | Bacteria | 6653 |
| 250 | Ga0207659_10008182 | 3300025926 | Bacteria | 6479 |
| 251 | Ga0207659_10138056 | 3300025926 | Bacteria | 1889 |
| 252 | Ga0207687_10002931 | 3300025927 | Bacteria | 11589 |
| 253 | Ga0207700_10004346 | 3300025928 | Bacteria | 8339 |
| 254 | Ga0207644_10060157 | 3300025931 | Bacteria | 2748 |
| 255 | Ga0207690_10133301 | 3300025932 | Bacteria | 1821 |
| 256 | Ga0207706_10001514 | 3300025933 | Bacteria | 23029 |
| 257 | Ga0207706_10172175 | 3300025933 | Bacteria | 1902 |
| 258 | Ga0207686_10000852 | 3300025934 | Bacteria | 18528 |
| 259 | Ga0207709_10003152 | 3300025935 | Bacteria | 9912 |
| 260 | Ga0207670_10003105 | 3300025936 | Bacteria | 8789 |
| 261 | Ga0207670_10045286 | 3300025936 | Bacteria | 2916 |
| 262 | Ga0207704_10004527 | 3300025938 | Bacteria | 6357 |
| 263 | Ga0207665_10007315 | 3300025939 | Bacteria | 7304 |
| 264 | Ga0207665_10013049 | 3300025939 | Bacteria | 5460 |
| 265 | Ga0207691_10009442 | 3300025940 | Bacteria | 9367 |
| 266 | Ga0207691_10052557 | 3300025940 | Bacteria | 3721 |
| 267 | Ga0207711_10055546 | 3300025941 | Bacteria | 3399 |
| 268 | Ga0207689_10000121 | 3300025942 | Bacteria | 65023 |
| 269 | Ga0207689_10001501 | 3300025942 | Bacteria | 22293 |
| 270 | Ga0207661_10251120 | 3300025944 | Unclassified | 1572 |
| 271 | Ga0207679_10048224 | 3300025945 | Bacteria | 3099 |
| 272 | Ga0207679_10094078 | 3300025945 | Bacteria | 2326 |
| 273 | Ga0207667_10018908 | 3300025949 | Bacteria | 7706 |
| 274 | Ga0207667_10153262 | 3300025949 | Bacteria | 2371 |
| 275 | Ga0207651_10033315 | 3300025960 | Bacteria | 3322 |
| 276 | Ga0207640_10069822 | 3300025981 | Bacteria | 2360 |
| 277 | Ga0207658_10059329 | 3300025986 | Bacteria | 2851 |
| 278 | Ga0207677_10001272 | 3300026023 | Bacteria | 13553 |
| 279 | Ga0207677_10013776 | 3300026023 | Unclassified | 4697 |
| 280 | Ga0207677_10052636 | 3300026023 | Bacteria | 2767 |
| 281 | Ga0207703_10006646 | 3300026035 | Bacteria | 9223 |
| 282 | Ga0207703_10159728 | 3300026035 | Bacteria | 1973 |
| 283 | Ga0207639_10004035 | 3300026041 | Bacteria | 9907 |
| 284 | Ga0207678_10103762 | 3300026067 | Bacteria | 2426 |
| 285 | Ga0207708_10000327 | 3300026075 | Bacteria | 37451 |
| 286 | Ga0207708_10149160 | 3300026075 | Bacteria | 1839 |
| 287 | Ga0207702_10277242 | 3300026078 | Bacteria | 1584 |
| 288 | Ga0207702_10408726 | 3300026078 | Bacteria | 1310 |
| 289 | Ga0207648_10000706 | 3300026089 | Bacteria | 37476 |
| 290 | Ga0207648_10002571 | 3300026089 | Bacteria | 19440 |
| 291 | Ga0207648_10055825 | 3300026089 | Unclassified | 3447 |
| 292 | Ga0207676_10012123 | 3300026095 | Bacteria | 6171 |
| 293 | Ga0207676_10061393 | 3300026095 | Bacteria | 2976 |
| 294 | Ga0207674_10000307 | 3300026116 | Bacteria | 62207 |
| 295 | Ga0207675_100000616 | 3300026118 | Bacteria | 34778 |
| 296 | Ga0207683_10007259 | 3300026121 | Bacteria | 9498 |
| 297 | Ga0207698_10073920 | 3300026142 | Unclassified | 2716 |
| 298 | Ga0209974_10070956 | 3300027876 | Bacteria | 1188 |
| 299 | Ga0207428_10015350 | 3300027907 | Bacteria | 6628 |
| 300 | Ga0207428_10228278 | 3300027907 | Bacteria | 1394 |
| 301 | Ga0268265_10011375 | 3300028380 | Bacteria | 6017 |
| 302 | Ga0268265_10039644 | 3300028380 | Bacteria | 3473 |
| 303 | Ga0268264_10001855 | 3300028381 | Bacteria | 19216 |
| 304 | Ga0268264_10168991 | 3300028381 | Bacteria | 1976 |
| 305 | Ga0307405_10140278 | 3300031731 | Bacteria | 1684 |
| 306 | Ga0307413_10115426 | 3300031824 | Bacteria | 1807 |
| 307 | Ga0307410_10131505 | 3300031852 | Bacteria | 1839 |
| 308 | Ga0307412_10045555 | 3300031911 | Bacteria | 2868 |
| 309 | Ga0307416_100040765 | 3300032002 | Bacteria | 3611 |
| 310 | Ga0307416_100064068 | 3300032002 | Bacteria | 3014 |
| 311 | Ga0307416_100277750 | 3300032002 | Bacteria | 1649 |
| 312 | Ga0373930_0001189 | 3300034816 | Bacteria | 3821 |
| 313 | Ga0373938_0039920 | 3300034957 | Bacteria | 1039 |
| 314 | Ga0373926_0004693 | 3300035083 | Bacteria | 4493 |
| 315 | Ga0373926_0017853 | 3300035083 | Bacteria | 2438 |
| 316 | Ga0373928_0003602 | 3300035084 | Bacteria | 2953 |
| 317 | Ga0373929_0009791 | 3300035085 | Bacteria | 1782 |
| 318 | Ga0373940_0009277 | 3300035088 | Bacteria | 2284 |
| 319 | Ga0373949_0007534 | 3300035090 | Bacteria | 2383 |
| 320 | Ga0373932_0004419 | 3300035112 | Bacteria | 3327 |
| 321 | Ga0373939_0009085 | 3300035114 | Bacteria | 2456 |
| 322 | Ga0373945_0006055 | 3300035116 | Bacteria | 3889 |
| 323 | Ga0373945_0050553 | 3300035116 | Bacteria | 1528 |
| 324 | Ga0373960_0015943 | 3300035121 | Unclassified | 1926 |
| 325 | Ga0373943_0131804 | 3300035170 | Bacteria | 1338 |
| 326 | Ga0373955_0071399 | 3300035172 | Bacteria | 1942 |
| 327 | Ga0373961_0015152 | 3300035241 | Bacteria | 1967 |
| 328 | Ga0373924_0004192 | 3300035410 | Bacteria | 5022 |
| 329 | Ga0373931_0000901 | 3300035691 | Bacteria | 12578 |
| 330 | Ga0373931_0008118 | 3300035691 | Bacteria | 4972 |
| 331 | Ga0373931_0013394 | 3300035691 | Bacteria | 3993 |
| 332 | Ga0373935_0254281 | 3300035692 | Bacteria | 1230 |
| 333 | Ga0373927_0030971 | 3300035695 | Bacteria | 3489 |
| 334 | Ga0373933_0001890 | 3300035724 | Bacteria | 12080 |
| 335 | Ga0373947_0006446 | 3300035725 | Bacteria | 6815 |
| 336 | Ga0436360_1095714 | 3300039438 | Bacteria | 1632 |
| 337 | Ga0439459_0002732 | 3300042438 | Bacteria | 2745 |
| 338 | Ga0451577_0005046 | 3300042876 | Bacteria | 13638 |
| 339 | Ga0451577_0129831 | 3300042876 | Bacteria | 2260 |
| 340 | Ga0451577_0139125 | 3300042876 | Bacteria | 2181 |
| 341 | Ga0451577_0165267 | 3300042876 | Bacteria | 1993 |
| 342 | Ga0453683_0016610 | 3300044673 | Bacteria | 4746 |
| 343 | Ga0453684_0093828 | 3300044712 | Bacteria | 3695 |
| 344 | Ga0453684_0263390 | 3300044712 | Bacteria | 1973 |
| 345 | Ga0451576_0006407 | 3300045051 | Bacteria | 14439 |
| 346 | Ga0451576_0007141 | 3300045051 | Bacteria | 13476 |
| 347 | Ga0451576_0008099 | 3300045051 | Bacteria | 12386 |
| 348 | Ga0451576_0011180 | 3300045051 | Bacteria | 10231 |
| 349 | Ga0451576_0059352 | 3300045051 | Bacteria | 3993 |
| 350 | Ga0451576_0062155 | 3300045051 | Bacteria | 3894 |
| 351 | Ga0451576_0376136 | 3300045051 | Bacteria | 1488 |
| 352 | Ga0466967_0015112 | 3300045976 | Bacteria | 6042 |
| 353 | Ga0495580_0070767 | 3300046472 | Bacteria | 2437 |
| 354 | Ga0495662_0042285 | 3300046476 | Bacteria | 2199 |
| 355 | Ga0495594_0044714 | 3300046499 | Bacteria | 2430 |
| 356 | Ga0495608_0017221 | 3300046511 | Bacteria | 5001 |
| 357 | Ga0495665_0102698 | 3300046531 | Bacteria | 1500 |
| 358 | Ga0495586_0028808 | 3300046535 | Bacteria | 2971 |
| 359 | Ga0495645_0089276 | 3300046543 | Bacteria | 2204 |
| 360 | Ga0495667_0039689 | 3300046559 | Bacteria | 3129 |
| 361 | Ga0495656_0005384 | 3300046615 | Bacteria | 4415 |
| 362 | Ga0495659_0121441 | 3300046664 | Bacteria | 1029 |
| 363 | Ga0495659_0126327 | 3300046664 | Bacteria | 1011 |
| 364 | Ga0495588_0075654 | 3300046674 | Bacteria | 1754 |
| 365 | Ga0495658_0003979 | 3300046683 | Bacteria | 7283 |
| 366 | Ga0495613_0075590 | 3300046689 | Bacteria | 2452 |
| 367 | Ga0495604_0102763 | 3300047317 | Bacteria | 2097 |
| 368 | Ga0495676_0305194 | 3300047321 | Bacteria | 1072 |
| 369 | Ga0496102_0152604 | 3300048905 | Bacteria | 2171 |
| 370 | Ga0496108_0005021 | 3300048911 | Bacteria | 10693 |
| 371 | Ga0496110_0002625 | 3300048913 | Bacteria | 13534 |
| 372 | Ga0496111_0057525 | 3300048914 | Bacteria | 2815 |
| 373 | Ga0496112_0377056 | 3300048915 | Bacteria | 1360 |
| 374 | Ga0501299_003674 | 3300049522 | Bacteria | 2242 |
| 375 | Ga0501033_0123702 | 3300049570 | Bacteria | 1876 |
| 376 | Ga0501036_0014617 | 3300049572 | Bacteria | 6539 |
| 377 | Ga0501036_0114658 | 3300049572 | Bacteria | 2277 |
| 378 | Ga0501038_0082333 | 3300049574 | Bacteria | 2710 |
| 379 | Ga0501039_0009182 | 3300049575 | Bacteria | 7535 |
| 380 | Ga0501040_0014334 | 3300049576 | Bacteria | 5222 |
| 381 | Ga0501040_0015684 | 3300049576 | Bacteria | 5009 |
| 382 | Ga0501041_0005149 | 3300049577 | Bacteria | 7629 |
| 383 | Ga0501041_0012108 | 3300049577 | Bacteria | 5107 |
| 384 | Ga0501042_0001736 | 3300049578 | Bacteria | 13042 |
| 385 | Ga0501042_0034883 | 3300049578 | Bacteria | 3569 |
| 386 | Ga0501043_0061296 | 3300049579 | Bacteria | 2954 |
| 387 | Ga0501043_0206754 | 3300049579 | Bacteria | 1522 |
| 388 | Ga0501046_0000526 | 3300049580 | Bacteria | 37973 |
| 389 | Ga0501047_0044990 | 3300049581 | Bacteria | 4267 |
| 390 | Ga0501048_0039904 | 3300049582 | Bacteria | 3365 |
| 391 | Ga0501048_0046790 | 3300049582 | Bacteria | 3088 |
| 392 | Ga0501067_0065105 | 3300049583 | Bacteria | 2018 |
| 393 | Ga0501069_0117603 | 3300049585 | Bacteria | 1517 |
| 394 | Ga0501069_0182947 | 3300049585 | Bacteria | 1212 |
| 395 | Ga0501071_0009255 | 3300049587 | Bacteria | 6552 |
| 396 | Ga0501071_0074510 | 3300049587 | Bacteria | 2477 |
| 397 | Ga0501072_0003151 | 3300049588 | Bacteria | 12411 |
| 398 | Ga0501072_0069551 | 3300049588 | Bacteria | 2780 |
| 399 | Ga0501075_0000272 | 3300049591 | Bacteria | 28414 |
| 400 | Ga0501075_0021678 | 3300049591 | Bacteria | 4686 |
| 401 | Ga0501076_0001079 | 3300049592 | Bacteria | 17925 |
| 402 | Ga0501076_0058924 | 3300049592 | Bacteria | 3053 |
| 403 | Ga0501077_0042963 | 3300049593 | Bacteria | 2872 |
| 404 | Ga0501077_0106138 | 3300049593 | Bacteria | 1780 |
| 405 | Ga0501233_036131 | 3300049668 | Bacteria | 1141 |
| 406 | Ga0501235_009670 | 3300049669 | Bacteria | 2107 |
| 407 | Ga0501079_0000917 | 3300049741 | Bacteria | 20233 |
| 408 | Ga0501079_0002303 | 3300049741 | Bacteria | 13814 |
| 409 | Ga0501080_0007120 | 3300049742 | Bacteria | 10099 |
| 410 | Ga0501080_0042517 | 3300049742 | Bacteria | 4231 |
| 411 | Ga0501080_0575253 | 3300049742 | Bacteria | 1002 |
| 412 | Ga0501081_0001663 | 3300049743 | Bacteria | 13751 |
| 413 | Ga0501081_0007001 | 3300049743 | Bacteria | 7334 |
| 414 | Ga0501081_0209565 | 3300049743 | Bacteria | 1415 |
| 415 | Ga0501035_0094056 | 3300049822 | Bacteria | 2636 |
| 416 | Ga0501035_0333346 | 3300049822 | Bacteria | 1273 |
| 417 | Ga0501045_0000387 | 3300049824 | Bacteria | 26619 |
| 418 | nmdc:mga05p37_144620_c1 | 3300050507 | Bacteria | 2912 |
| 419 | nmdc:mga05p37_167073_c1 | 3300050507 | Bacteria | 2685 |
| 420 | nmdc:mga05p37_319257_c1 | 3300050507 | Bacteria | 1839 |
| 421 | nmdc:mga05p37_348906_c1 | 3300050507 | Bacteria | 1743 |
| 422 | nmdc:mga05p37_41356_c1 | 3300050507 | Bacteria | 5659 |
| 423 | nmdc:mga05p37_44160_c1 | 3300050507 | Bacteria | 5483 |
| 424 | nmdc:mga05p37_606533_c1 | 3300050507 | Bacteria | 1235 |
| 425 | nmdc:mga05p37_72459_c1 | 3300050507 | Unclassified | 4239 |
| 426 | nmdc:mga05p37_9963_c1 | 3300050507 | Bacteria | 11286 |
| 427 | nmdc:mga09592_16244_c1 | 3300050508 | Bacteria | 6084 |
| 428 | nmdc:mga09592_21699_c1 | 3300050508 | Bacteria | 5294 |
| 429 | nmdc:mga09592_506_c1 | 3300050508 | Bacteria | 29447 |
| 430 | nmdc:mga09592_652203_c1 | 3300050508 | Archaea | 899 |
| 431 | nmdc:mga0qj67_12843_c1 | 3300050509 | Bacteria | 6319 |
| 432 | nmdc:mga0qj67_43337_c1 | 3300050509 | Bacteria | 3544 |
| 433 | nmdc:mga06r32_184055_c1 | 3300050510 | Bacteria | 2075 |
| 434 | nmdc:mga06r32_28562_c1 | 3300050510 | Bacteria | 5222 |
| 435 | nmdc:mga06r32_38506_c1 | 3300050510 | Unclassified | 4531 |
| 436 | nmdc:mga06r32_93932_c1 | 3300050510 | Bacteria | 2935 |
| 437 | nmdc:mga08y16_103066_c1 | 3300050511 | Bacteria | 2971 |
| 438 | nmdc:mga08y16_150125_c1 | 3300050511 | Bacteria | 2423 |
| 439 | nmdc:mga08y16_16845_c1 | 3300050511 | Bacteria | 7694 |
| 440 | nmdc:mga08y16_550486_c1 | 3300050511 | Bacteria | 1168 |
| 441 | nmdc:mga08y16_88172_c1 | 3300050511 | Bacteria | 3233 |
| 442 | nmdc:mga0n895_113884_c1 | 3300050512 | Bacteria | 2723 |
| 443 | nmdc:mga0n895_14255_c1 | 3300050512 | Bacteria | 7213 |
| 444 | nmdc:mga0n895_235853_c1 | 3300050512 | Bacteria | 1857 |
| 445 | nmdc:mga0n895_297344_c1 | 3300050512 | Bacteria | 1637 |
| 446 | nmdc:mga0n895_703975_c1 | 3300050512 | Bacteria | 1006 |
| 447 | nmdc:mga0n895_98912_c1 | 3300050512 | Bacteria | 2925 |
| 448 | nmdc:mga0rr50_135987_c1 | 3300050513 | Bacteria | 1973 |
| 449 | nmdc:mga0rr50_49413_c1 | 3300050513 | Bacteria | 3114 |
| 450 | nmdc:mga0rr50_82801_c1 | 3300050513 | Bacteria | 2479 |
| 451 | nmdc:mga0rr50_88527_c1 | 3300050513 | Bacteria | 2406 |
| 452 | nmdc:mga08x19_144175_c1 | 3300050514 | Bacteria | 1610 |
| 453 | nmdc:mga08x19_16770_c1 | 3300050514 | Bacteria | 4472 |
| 454 | nmdc:mga08x19_21181_c1 | 3300050514 | Bacteria | 4009 |
| 455 | nmdc:mga08x19_57028_c1 | 3300050514 | Bacteria | 2523 |
| 456 | nmdc:mga08x19_74744_c1 | 3300050514 | Bacteria | 2215 |
| 457 | nmdc:mga08x19_9328_c1 | 3300050514 | Bacteria | 4600 |
| 458 | nmdc:mga0a205_159970_c1 | 3300050515 | Bacteria | 2149 |
| 459 | nmdc:mga0a205_161571_c1 | 3300050515 | Bacteria | 2137 |
| 460 | nmdc:mga0a205_218677_c1 | 3300050515 | Unclassified | 1791 |
| 461 | nmdc:mga0a205_22313_c1 | 3300050515 | Bacteria | 5994 |
| 462 | nmdc:mga0a205_246399_c1 | 3300050515 | Bacteria | 1667 |
| 463 | nmdc:mga0a205_279689_c1 | 3300050515 | Unclassified | 1544 |
| 464 | nmdc:mga0a205_46297_c1 | 3300050515 | Bacteria | 4195 |
| 465 | Ga0495601_0071087 | 3300053077 | Bacteria | 2222 |
| 466 | Ga0501084_0004620 | 3300054114 | Bacteria | 11248 |
| 467 | Ga0501084_0038112 | 3300054114 | Bacteria | 4018 |
| 468 | Ga0501082_0006609 | 3300060353 | Bacteria | 10032 |
| 469 | Ga0501082_0007493 | 3300060353 | Bacteria | 9417 |
| 470 | Ga0501082_0277829 | 3300060353 | Bacteria | 1458 |
| 471 | Ga0530510_0000641 | 3300061734 | Bacteria | 22513 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025944 | Ga0207661_10251120 | Ga0207661_102511202 | 258 |
| 2 | 3300005471 | Ga0070698_100401976 | Ga0070698_1004019761 | 271 |
| 3 | 3300013306 | Ga0163162_10025577 | Ga0163162_100255773 | 271 |
| 4 | 3300005439 | Ga0070711_100009995 | Ga0070711_1000099957 | 272 |
| 5 | 3300005985 | Ga0081539_10002956 | Ga0081539_100029563 | 272 |
| 6 | 3300006028 | Ga0070717_10203145 | Ga0070717_102031452 | 272 |
| 7 | 3300006175 | Ga0070712_100032396 | Ga0070712_1000323965 | 272 |
| 8 | 3300006847 | Ga0075431_100431554 | Ga0075431_1004315541 | 272 |
| 9 | 3300006880 | Ga0075429_100039798 | Ga0075429_1000397982 | 272 |
| 10 | 3300006880 | Ga0075429_100312989 | Ga0075429_1003129892 | 272 |
| 11 | 3300025915 | Ga0207693_10017227 | Ga0207693_100172276 | 272 |
| 12 | 3300025928 | Ga0207700_10004346 | Ga0207700_100043461 | 272 |
| 13 | 3300050507 | nmdc:mga05p37_167073_c1 | nmdc:mga05p37_167073_c1_924_1787 | 272 |
| 14 | 3300050508 | nmdc:mga09592_652203_c1 | nmdc:mga09592_652203_c1_20_883 | 272 |
| 15 | 3300050511 | nmdc:mga08y16_550486_c1 | nmdc:mga08y16_550486_c1_230_1090 | 272 |
| 16 | 3300050512 | nmdc:mga0n895_703975_c1 | nmdc:mga0n895_703975_c1_79_942 | 272 |
| 17 | 3300005468 | Ga0070707_100123849 | Ga0070707_1001238492 | 273 |
| 18 | 3300049743 | Ga0501081_0209565 | Ga0501081_0209565_25_894 | 273 |
| 19 | 3300006844 | Ga0075428_100288345 | Ga0075428_1002883452 | 274 |
| 20 | 3300006871 | Ga0075434_100346033 | Ga0075434_1003460332 | 274 |
| 21 | 3300025910 | Ga0207684_10383259 | Ga0207684_103832592 | 274 |
| 22 | 3300006846 | Ga0075430_100008721 | Ga0075430_1000087214 | 275 |
| 23 | 3300006846 | Ga0075430_100234633 | Ga0075430_1002346332 | 275 |
| 24 | 3300006847 | Ga0075431_100020660 | Ga0075431_1000206602 | 275 |
| 25 | 3300006880 | Ga0075429_100169413 | Ga0075429_1001694132 | 275 |
| 26 | 3300009147 | Ga0114129_10192348 | Ga0114129_101923481 | 275 |
| 27 | 3300009147 | Ga0114129_10710854 | Ga0114129_107108542 | 275 |
| 28 | 3300049742 | Ga0501080_0575253 | Ga0501080_0575253_127_990 | 275 |
| 29 | 3300050507 | nmdc:mga05p37_72459_c1 | nmdc:mga05p37_72459_c1_2960_3835 | 275 |
| 30 | 3300050509 | nmdc:mga0qj67_12843_c1 | nmdc:mga0qj67_12843_c1_1383_2258 | 275 |
| 31 | 3300050510 | nmdc:mga06r32_38506_c1 | nmdc:mga06r32_38506_c1_3568_4443 | 275 |
| 32 | 3300005436 | Ga0070713_100557732 | Ga0070713_1005577321 | 276 |
| 33 | 3300006871 | Ga0075434_100468172 | Ga0075434_1004681722 | 276 |
| 34 | 3300006914 | Ga0075436_100151569 | Ga0075436_1001515692 | 276 |
| 35 | 3300007076 | Ga0075435_100132207 | Ga0075435_1001322073 | 276 |
| 36 | 3300013306 | Ga0163162_10177334 | Ga0163162_101773342 | 276 |
| 37 | 3300049570 | Ga0501033_0123702 | Ga0501033_0123702_113_1042 | 276 |
| 38 | 3300049572 | Ga0501036_0014617 | Ga0501036_0014617_2638_3567 | 276 |
| 39 | 3300049574 | Ga0501038_0082333 | Ga0501038_0082333_96_1025 | 276 |
| 40 | 3300049576 | Ga0501040_0015684 | Ga0501040_0015684_3040_3969 | 276 |
| 41 | 3300049577 | Ga0501041_0012108 | Ga0501041_0012108_2867_3796 | 276 |
| 42 | 3300049578 | Ga0501042_0034883 | Ga0501042_0034883_1277_2206 | 276 |
| 43 | 3300049579 | Ga0501043_0206754 | Ga0501043_0206754_568_1497 | 276 |
| 44 | 3300049582 | Ga0501048_0039904 | Ga0501048_0039904_944_1873 | 276 |
| 45 | 3300049585 | Ga0501069_0182947 | Ga0501069_0182947_101_1030 | 276 |
| 46 | 3300049587 | Ga0501071_0009255 | Ga0501071_0009255_1248_2177 | 276 |
| 47 | 3300049588 | Ga0501072_0003151 | Ga0501072_0003151_11186_12115 | 276 |
| 48 | 3300049591 | Ga0501075_0000272 | Ga0501075_0000272_5926_6855 | 276 |
| 49 | 3300049592 | Ga0501076_0001079 | Ga0501076_0001079_12619_13548 | 276 |
| 50 | 3300049593 | Ga0501077_0106138 | Ga0501077_0106138_325_1254 | 276 |
| 51 | 3300049741 | Ga0501079_0002303 | Ga0501079_0002303_8933_9862 | 276 |
| 52 | 3300049742 | Ga0501080_0007120 | Ga0501080_0007120_6564_7493 | 276 |
| 53 | 3300049743 | Ga0501081_0001663 | Ga0501081_0001663_6792_7721 | 276 |
| 54 | 3300049822 | Ga0501035_0094056 | Ga0501035_0094056_1285_2214 | 276 |
| 55 | 3300050512 | nmdc:mga0n895_297344_c1 | nmdc:mga0n895_297344_c1_361_1272 | 276 |
| 56 | 3300050513 | nmdc:mga0rr50_135987_c1 | nmdc:mga0rr50_135987_c1_895_1806 | 276 |
| 57 | 3300060353 | Ga0501082_0006609 | Ga0501082_0006609_2048_2977 | 276 |
| 58 | 3300061734 | Ga0530510_0000641 | Ga0530510_0000641_4538_5467 | 276 |
| 59 | 3300006847 | Ga0075431_100398099 | Ga0075431_1003980992 | 277 |
| 60 | 3300006880 | Ga0075429_100006285 | Ga0075429_1000062853 | 277 |
| 61 | 3300009147 | Ga0114129_10043047 | Ga0114129_100430478 | 277 |
| 62 | 3300050507 | nmdc:mga05p37_144620_c1 | nmdc:mga05p37_144620_c1_1122_1994 | 277 |
| 63 | 3300050508 | nmdc:mga09592_16244_c1 | nmdc:mga09592_16244_c1_3139_4011 | 277 |
| 64 | 3300050509 | nmdc:mga0qj67_43337_c1 | nmdc:mga0qj67_43337_c1_1552_2424 | 277 |
| 65 | 3300050510 | nmdc:mga06r32_93932_c1 | nmdc:mga06r32_93932_c1_639_1511 | 277 |
| 66 | 3300054114 | Ga0501084_0038112 | Ga0501084_0038112_13_942 | 277 |
| 67 | 3300005458 | Ga0070681_10003675 | Ga0070681_100036759 | 278 |
| 68 | 3300005530 | Ga0070679_100051577 | Ga0070679_1000515774 | 278 |
| 69 | 3300006852 | Ga0075433_10127128 | Ga0075433_101271284 | 278 |
| 70 | 3300009147 | Ga0114129_10625450 | Ga0114129_106254501 | 278 |
| 71 | 3300025912 | Ga0207707_10014358 | Ga0207707_100143588 | 278 |
| 72 | 3300025921 | Ga0207652_10023191 | Ga0207652_100231915 | 278 |
| 73 | 3300050513 | nmdc:mga0rr50_82801_c1 | nmdc:mga0rr50_82801_c1_796_1716 | 278 |
| 74 | 3300050514 | nmdc:mga08x19_57028_c1 | nmdc:mga08x19_57028_c1_1114_2034 | 278 |
| 75 | 3300005445 | Ga0070708_100033291 | Ga0070708_1000332915 | 279 |
| 76 | 3300005445 | Ga0070708_100103044 | Ga0070708_1001030444 | 279 |
| 77 | 3300005467 | Ga0070706_100110987 | Ga0070706_1001109872 | 279 |
| 78 | 3300005468 | Ga0070707_100485201 | Ga0070707_1004852012 | 279 |
| 79 | 3300005471 | Ga0070698_100081478 | Ga0070698_1000814782 | 279 |
| 80 | 3300005518 | Ga0070699_100009468 | Ga0070699_1000094688 | 279 |
| 81 | 3300025910 | Ga0207684_10067983 | Ga0207684_100679833 | 279 |
| 82 | 3300025922 | Ga0207646_10044429 | Ga0207646_100444292 | 279 |
| 83 | 3300050514 | nmdc:mga08x19_144175_c1 | nmdc:mga08x19_144175_c1_139_1047 | 279 |
| 84 | 3300005329 | Ga0070683_100000797 | Ga0070683_10000079716 | 280 |
| 85 | 3300005331 | Ga0070670_100000847 | Ga0070670_1000008478 | 280 |
| 86 | 3300005338 | Ga0068868_100008898 | Ga0068868_1000088985 | 280 |
| 87 | 3300005344 | Ga0070661_100007535 | Ga0070661_1000075356 | 280 |
| 88 | 3300005355 | Ga0070671_100108722 | Ga0070671_1001087222 | 280 |
| 89 | 3300005364 | Ga0070673_100059774 | Ga0070673_1000597742 | 280 |
| 90 | 3300005445 | Ga0070708_100350443 | Ga0070708_1003504431 | 280 |
| 91 | 3300005456 | Ga0070678_100013614 | Ga0070678_1000136142 | 280 |
| 92 | 3300005459 | Ga0068867_100013675 | Ga0068867_1000136755 | 280 |
| 93 | 3300005467 | Ga0070706_100043145 | Ga0070706_1000431453 | 280 |
| 94 | 3300005467 | Ga0070706_100052281 | Ga0070706_1000522812 | 280 |
| 95 | 3300005468 | Ga0070707_100077693 | Ga0070707_1000776933 | 280 |
| 96 | 3300005471 | Ga0070698_100043095 | Ga0070698_1000430953 | 280 |
| 97 | 3300005518 | Ga0070699_100038197 | Ga0070699_1000381973 | 280 |
| 98 | 3300005543 | Ga0070672_100052921 | Ga0070672_1000529212 | 280 |
| 99 | 3300005564 | Ga0070664_100005044 | Ga0070664_1000050449 | 280 |
| 100 | 3300005616 | Ga0068852_100062299 | Ga0068852_1000622992 | 280 |
| 101 | 3300005618 | Ga0068864_100004337 | Ga0068864_1000043376 | 280 |
| 102 | 3300005834 | Ga0068851_10034044 | Ga0068851_100340442 | 280 |
| 103 | 3300005841 | Ga0068863_100329500 | Ga0068863_1003295002 | 280 |
| 104 | 3300006237 | Ga0097621_100010805 | Ga0097621_1000108053 | 280 |
| 105 | 3300006358 | Ga0068871_100002227 | Ga0068871_1000022277 | 280 |
| 106 | 3300006844 | Ga0075428_100798209 | Ga0075428_1007982091 | 280 |
| 107 | 3300009176 | Ga0105242_10091145 | Ga0105242_100911453 | 280 |
| 108 | 3300009177 | Ga0105248_10068978 | Ga0105248_100689782 | 280 |
| 109 | 3300013296 | Ga0157374_10002050 | Ga0157374_1000205012 | 280 |
| 110 | 3300013297 | Ga0157378_10023436 | Ga0157378_100234363 | 280 |
| 111 | 3300013308 | Ga0157375_10001207 | Ga0157375_1000120722 | 280 |
| 112 | 3300025321 | Ga0207656_10037461 | Ga0207656_100374612 | 280 |
| 113 | 3300025903 | Ga0207680_10116278 | Ga0207680_101162782 | 280 |
| 114 | 3300025910 | Ga0207684_10015309 | Ga0207684_100153094 | 280 |
| 115 | 3300025910 | Ga0207684_10027482 | Ga0207684_100274826 | 280 |
| 116 | 3300025920 | Ga0207649_10008213 | Ga0207649_100082131 | 280 |
| 117 | 3300025922 | Ga0207646_10003336 | Ga0207646_1000333616 | 280 |
| 118 | 3300025922 | Ga0207646_10063931 | Ga0207646_100639313 | 280 |
| 119 | 3300025925 | Ga0207650_10000686 | Ga0207650_1000068611 | 280 |
| 120 | 3300025926 | Ga0207659_10008182 | Ga0207659_100081822 | 280 |
| 121 | 3300025931 | Ga0207644_10060157 | Ga0207644_100601572 | 280 |
| 122 | 3300025940 | Ga0207691_10009442 | Ga0207691_100094427 | 280 |
| 123 | 3300025941 | Ga0207711_10055546 | Ga0207711_100555463 | 280 |
| 124 | 3300025945 | Ga0207679_10094078 | Ga0207679_100940782 | 280 |
| 125 | 3300025986 | Ga0207658_10059329 | Ga0207658_100593292 | 280 |
| 126 | 3300026023 | Ga0207677_10013776 | Ga0207677_100137762 | 280 |
| 127 | 3300026089 | Ga0207648_10055825 | Ga0207648_100558254 | 280 |
| 128 | 3300026095 | Ga0207676_10012123 | Ga0207676_100121232 | 280 |
| 129 | 3300026121 | Ga0207683_10007259 | Ga0207683_100072598 | 280 |
| 130 | 3300026142 | Ga0207698_10073920 | Ga0207698_100739202 | 280 |
| 131 | 3300042876 | Ga0451577_0165267 | Ga0451577_0165267_780_1664 | 280 |
| 132 | 3300044673 | Ga0453683_0016610 | Ga0453683_0016610_2059_2943 | 280 |
| 133 | 3300044712 | Ga0453684_0263390 | Ga0453684_0263390_946_1830 | 280 |
| 134 | 3300045051 | Ga0451576_0062155 | Ga0451576_0062155_124_1008 | 280 |
| 135 | 3300048911 | Ga0496108_0005021 | Ga0496108_0005021_7211_8110 | 280 |
| 136 | 3300048913 | Ga0496110_0002625 | Ga0496110_0002625_3362_4261 | 280 |
| 137 | 3300048914 | Ga0496111_0057525 | Ga0496111_0057525_1099_1998 | 280 |
| 138 | 3300048915 | Ga0496112_0377056 | Ga0496112_0377056_144_1043 | 280 |
| 139 | 3300050515 | nmdc:mga0a205_279689_c1 | nmdc:mga0a205_279689_c1_359_1240 | 280 |
| 140 | 3300005471 | Ga0070698_100235784 | Ga0070698_1002357842 | 281 |
| 141 | 3300005937 | Ga0081455_10006241 | Ga0081455_100062419 | 281 |
| 142 | 3300049572 | Ga0501036_0114658 | Ga0501036_0114658_94_987 | 281 |
| 143 | 3300049575 | Ga0501039_0009182 | Ga0501039_0009182_1908_2801 | 281 |
| 144 | 3300049576 | Ga0501040_0014334 | Ga0501040_0014334_1197_2090 | 281 |
| 145 | 3300049577 | Ga0501041_0005149 | Ga0501041_0005149_1602_2495 | 281 |
| 146 | 3300049578 | Ga0501042_0001736 | Ga0501042_0001736_9393_10286 | 281 |
| 147 | 3300049579 | Ga0501043_0061296 | Ga0501043_0061296_527_1420 | 281 |
| 148 | 3300049580 | Ga0501046_0000526 | Ga0501046_0000526_1143_2036 | 281 |
| 149 | 3300049581 | Ga0501047_0044990 | Ga0501047_0044990_1542_2435 | 281 |
| 150 | 3300049582 | Ga0501048_0046790 | Ga0501048_0046790_1169_2062 | 281 |
| 151 | 3300049583 | Ga0501067_0065105 | Ga0501067_0065105_505_1404 | 281 |
| 152 | 3300049587 | Ga0501071_0074510 | Ga0501071_0074510_656_1549 | 281 |
| 153 | 3300049588 | Ga0501072_0069551 | Ga0501072_0069551_1600_2493 | 281 |
| 154 | 3300049591 | Ga0501075_0021678 | Ga0501075_0021678_2627_3520 | 281 |
| 155 | 3300049592 | Ga0501076_0058924 | Ga0501076_0058924_1317_2210 | 281 |
| 156 | 3300049593 | Ga0501077_0042963 | Ga0501077_0042963_1133_2026 | 281 |
| 157 | 3300049741 | Ga0501079_0000917 | Ga0501079_0000917_13738_14631 | 281 |
| 158 | 3300049742 | Ga0501080_0042517 | Ga0501080_0042517_942_1835 | 281 |
| 159 | 3300049743 | Ga0501081_0007001 | Ga0501081_0007001_1184_2077 | 281 |
| 160 | 3300049822 | Ga0501035_0333346 | Ga0501035_0333346_273_1166 | 281 |
| 161 | 3300049824 | Ga0501045_0000387 | Ga0501045_0000387_18372_19265 | 281 |
| 162 | 3300054114 | Ga0501084_0004620 | Ga0501084_0004620_5246_6139 | 281 |
| 163 | 3300060353 | Ga0501082_0007493 | Ga0501082_0007493_1164_2057 | 281 |
| 164 | 3300060353 | Ga0501082_0277829 | Ga0501082_0277829_450_1343 | 281 |
| 165 | 3300009094 | Ga0111539_10302487 | Ga0111539_103024871 | 282 |
| 166 | 3300035172 | Ga0373955_0071399 | Ga0373955_0071399_410_1306 | 282 |
| 167 | 3300035410 | Ga0373924_0004192 | Ga0373924_0004192_3779_4675 | 282 |
| 168 | 3300035724 | Ga0373933_0001890 | Ga0373933_0001890_191_1087 | 282 |
| 169 | 3300045976 | Ga0466967_0015112 | Ga0466967_0015112_1007_1918 | 282 |
| 170 | 3300026075 | Ga0207708_10149160 | Ga0207708_101491603 | 283 |
| 171 | 3300027907 | Ga0207428_10228278 | Ga0207428_102282782 | 283 |
| 172 | 3300046615 | Ga0495656_0005384 | Ga0495656_0005384_26_940 | 283 |
| 173 | 3300050511 | nmdc:mga08y16_88172_c1 | nmdc:mga08y16_88172_c1_173_1099 | 283 |
| 174 | 3300005445 | Ga0070708_100318212 | Ga0070708_1003182122 | 284 |
| 175 | 3300009147 | Ga0114129_10802243 | Ga0114129_108022431 | 284 |
| 176 | 3300032002 | Ga0307416_100064068 | Ga0307416_1000640682 | 284 |
| 177 | 3300032002 | Ga0307416_100277750 | Ga0307416_1002777502 | 284 |
| 178 | 3300049522 | Ga0501299_003674 | Ga0501299_003674_926_1831 | 284 |
| 179 | 3300049668 | Ga0501233_036131 | Ga0501233_036131_110_1015 | 284 |
| 180 | 3300049669 | Ga0501235_009670 | Ga0501235_009670_535_1440 | 284 |
| 181 | 3300050515 | nmdc:mga0a205_218677_c1 | nmdc:mga0a205_218677_c1_720_1631 | 284 |
| 182 | 3300005336 | Ga0070680_100016572 | Ga0070680_1000165727 | 285 |
| 183 | 3300005353 | Ga0070669_100370718 | Ga0070669_1003707181 | 285 |
| 184 | 3300006852 | Ga0075433_10003626 | Ga0075433_100036265 | 285 |
| 185 | 3300009098 | Ga0105245_10001077 | Ga0105245_1000107717 | 285 |
| 186 | 3300009148 | Ga0105243_10000508 | Ga0105243_1000050834 | 285 |
| 187 | 3300009177 | Ga0105248_10352371 | Ga0105248_103523712 | 285 |
| 188 | 3300009553 | Ga0105249_10004637 | Ga0105249_100046377 | 285 |
| 189 | 3300013297 | Ga0157378_10000714 | Ga0157378_1000071417 | 285 |
| 190 | 3300013308 | Ga0157375_10245384 | Ga0157375_102453842 | 285 |
| 191 | 3300014745 | Ga0157377_10182315 | Ga0157377_101823152 | 285 |
| 192 | 3300014969 | Ga0157376_10020785 | Ga0157376_100207853 | 285 |
| 193 | 3300035691 | Ga0373931_0008118 | Ga0373931_0008118_1035_1940 | 285 |
| 194 | 3300042876 | Ga0451577_0139125 | Ga0451577_0139125_281_1180 | 285 |
| 195 | 3300045051 | Ga0451576_0011180 | Ga0451576_0011180_6829_7728 | 285 |
| 196 | 3300050513 | nmdc:mga0rr50_88527_c1 | nmdc:mga0rr50_88527_c1_489_1403 | 285 |
| 197 | 3300050514 | nmdc:mga08x19_74744_c1 | nmdc:mga08x19_74744_c1_813_1727 | 285 |
| 198 | 3300050515 | nmdc:mga0a205_46297_c1 | nmdc:mga0a205_46297_c1_489_1403 | 285 |
| 199 | 3300005328 | Ga0070676_10068779 | Ga0070676_100687793 | 286 |
| 200 | 3300005331 | Ga0070670_100127205 | Ga0070670_1001272053 | 286 |
| 201 | 3300005334 | Ga0068869_100000136 | Ga0068869_10000013616 | 286 |
| 202 | 3300005336 | Ga0070680_100000125 | Ga0070680_10000012516 | 286 |
| 203 | 3300005337 | Ga0070682_100000189 | Ga0070682_10000018941 | 286 |
| 204 | 3300005338 | Ga0068868_100053284 | Ga0068868_1000532842 | 286 |
| 205 | 3300005339 | Ga0070660_100001383 | Ga0070660_10000138314 | 286 |
| 206 | 3300005340 | Ga0070689_100009703 | Ga0070689_1000097033 | 286 |
| 207 | 3300005341 | Ga0070691_10025299 | Ga0070691_100252993 | 286 |
| 208 | 3300005344 | Ga0070661_100001580 | Ga0070661_10000158015 | 286 |
| 209 | 3300005366 | Ga0070659_100000654 | Ga0070659_1000006547 | 286 |
| 210 | 3300005406 | Ga0070703_10002746 | Ga0070703_100027463 | 286 |
| 211 | 3300005406 | Ga0070703_10025416 | Ga0070703_100254161 | 286 |
| 212 | 3300005440 | Ga0070705_100029182 | Ga0070705_1000291823 | 286 |
| 213 | 3300005444 | Ga0070694_100000248 | Ga0070694_10000024822 | 286 |
| 214 | 3300005444 | Ga0070694_100070795 | Ga0070694_1000707952 | 286 |
| 215 | 3300005445 | Ga0070708_100148088 | Ga0070708_1001480883 | 286 |
| 216 | 3300005455 | Ga0070663_100027659 | Ga0070663_1000276593 | 286 |
| 217 | 3300005457 | Ga0070662_100012746 | Ga0070662_1000127464 | 286 |
| 218 | 3300005458 | Ga0070681_10005555 | Ga0070681_1000555511 | 286 |
| 219 | 3300005459 | Ga0068867_100021905 | Ga0068867_1000219053 | 286 |
| 220 | 3300005530 | Ga0070679_100023995 | Ga0070679_1000239958 | 286 |
| 221 | 3300005539 | Ga0068853_100003423 | Ga0068853_1000034237 | 286 |
| 222 | 3300005543 | Ga0070672_100038612 | Ga0070672_1000386123 | 286 |
| 223 | 3300005545 | Ga0070695_100027024 | Ga0070695_1000270242 | 286 |
| 224 | 3300005546 | Ga0070696_100000114 | Ga0070696_10000011411 | 286 |
| 225 | 3300005547 | Ga0070693_100000119 | Ga0070693_1000001193 | 286 |
| 226 | 3300005549 | Ga0070704_100000769 | Ga0070704_1000007691 | 286 |
| 227 | 3300005563 | Ga0068855_100000315 | Ga0068855_10000031539 | 286 |
| 228 | 3300005564 | Ga0070664_100028520 | Ga0070664_1000285204 | 286 |
| 229 | 3300005577 | Ga0068857_100002336 | Ga0068857_10000233610 | 286 |
| 230 | 3300005578 | Ga0068854_100004237 | Ga0068854_1000042373 | 286 |
| 231 | 3300005614 | Ga0068856_100010613 | Ga0068856_1000106134 | 286 |
| 232 | 3300005615 | Ga0070702_100022920 | Ga0070702_1000229204 | 286 |
| 233 | 3300005616 | Ga0068852_100167092 | Ga0068852_1001670922 | 286 |
| 234 | 3300005617 | Ga0068859_100008108 | Ga0068859_1000081089 | 286 |
| 235 | 3300005618 | Ga0068864_100039691 | Ga0068864_1000396913 | 286 |
| 236 | 3300005719 | Ga0068861_100112243 | Ga0068861_1001122432 | 286 |
| 237 | 3300005840 | Ga0068870_10001528 | Ga0068870_100015282 | 286 |
| 238 | 3300005842 | Ga0068858_100199251 | Ga0068858_1001992512 | 286 |
| 239 | 3300005843 | Ga0068860_100330825 | Ga0068860_1003308252 | 286 |
| 240 | 3300005844 | Ga0068862_100095963 | Ga0068862_1000959632 | 286 |
| 241 | 3300006844 | Ga0075428_100707462 | Ga0075428_1007074622 | 286 |
| 242 | 3300006852 | Ga0075433_10129833 | Ga0075433_101298332 | 286 |
| 243 | 3300006871 | Ga0075434_100167057 | Ga0075434_1001670572 | 286 |
| 244 | 3300006914 | Ga0075436_100091616 | Ga0075436_1000916163 | 286 |
| 245 | 3300006931 | Ga0097620_100008107 | Ga0097620_1000081079 | 286 |
| 246 | 3300007265 | Ga0099794_10006410 | Ga0099794_100064104 | 286 |
| 247 | 3300009147 | Ga0114129_10059177 | Ga0114129_100591776 | 286 |
| 248 | 3300009174 | Ga0105241_10013593 | Ga0105241_100135934 | 286 |
| 249 | 3300011119 | Ga0105246_10236606 | Ga0105246_102366061 | 286 |
| 250 | 3300013100 | Ga0157373_10001185 | Ga0157373_100011856 | 286 |
| 251 | 3300013102 | Ga0157371_10098715 | Ga0157371_100987153 | 286 |
| 252 | 3300013104 | Ga0157370_10249714 | Ga0157370_102497142 | 286 |
| 253 | 3300013105 | Ga0157369_10004085 | Ga0157369_100040853 | 286 |
| 254 | 3300013297 | Ga0157378_10273649 | Ga0157378_102736492 | 286 |
| 255 | 3300013307 | Ga0157372_10004865 | Ga0157372_1000486515 | 286 |
| 256 | 3300014325 | Ga0163163_10090117 | Ga0163163_100901173 | 286 |
| 257 | 3300014497 | Ga0182008_10064267 | Ga0182008_100642672 | 286 |
| 258 | 3300015262 | Ga0182007_10023877 | Ga0182007_100238772 | 286 |
| 259 | 3300025885 | Ga0207653_10003370 | Ga0207653_100033703 | 286 |
| 260 | 3300025907 | Ga0207645_10005247 | Ga0207645_100052477 | 286 |
| 261 | 3300025908 | Ga0207643_10000296 | Ga0207643_1000029617 | 286 |
| 262 | 3300025911 | Ga0207654_10025012 | Ga0207654_100250122 | 286 |
| 263 | 3300025912 | Ga0207707_10000443 | Ga0207707_1000044327 | 286 |
| 264 | 3300025917 | Ga0207660_10002832 | Ga0207660_1000283213 | 286 |
| 265 | 3300025919 | Ga0207657_10000095 | Ga0207657_1000009543 | 286 |
| 266 | 3300025920 | Ga0207649_10023423 | Ga0207649_100234232 | 286 |
| 267 | 3300025922 | Ga0207646_10169847 | Ga0207646_101698472 | 286 |
| 268 | 3300025923 | Ga0207681_10085841 | Ga0207681_100858412 | 286 |
| 269 | 3300025925 | Ga0207650_10009474 | Ga0207650_100094743 | 286 |
| 270 | 3300025932 | Ga0207690_10133301 | Ga0207690_101333012 | 286 |
| 271 | 3300025933 | Ga0207706_10001514 | Ga0207706_100015143 | 286 |
| 272 | 3300025936 | Ga0207670_10045286 | Ga0207670_100452864 | 286 |
| 273 | 3300025940 | Ga0207691_10052557 | Ga0207691_100525573 | 286 |
| 274 | 3300025942 | Ga0207689_10000121 | Ga0207689_1000012119 | 286 |
| 275 | 3300025945 | Ga0207679_10048224 | Ga0207679_100482244 | 286 |
| 276 | 3300025949 | Ga0207667_10153262 | Ga0207667_101532621 | 286 |
| 277 | 3300025960 | Ga0207651_10033315 | Ga0207651_100333153 | 286 |
| 278 | 3300025981 | Ga0207640_10069822 | Ga0207640_100698223 | 286 |
| 279 | 3300026023 | Ga0207677_10052636 | Ga0207677_100526363 | 286 |
| 280 | 3300026035 | Ga0207703_10159728 | Ga0207703_101597282 | 286 |
| 281 | 3300026041 | Ga0207639_10004035 | Ga0207639_100040358 | 286 |
| 282 | 3300026067 | Ga0207678_10103762 | Ga0207678_101037622 | 286 |
| 283 | 3300026078 | Ga0207702_10408726 | Ga0207702_104087262 | 286 |
| 284 | 3300026089 | Ga0207648_10002571 | Ga0207648_100025713 | 286 |
| 285 | 3300026095 | Ga0207676_10061393 | Ga0207676_100613931 | 286 |
| 286 | 3300026116 | Ga0207674_10000307 | Ga0207674_1000030717 | 286 |
| 287 | 3300027876 | Ga0209974_10070956 | Ga0209974_100709561 | 286 |
| 288 | 3300028380 | Ga0268265_10039644 | Ga0268265_100396443 | 286 |
| 289 | 3300028381 | Ga0268264_10168991 | Ga0268264_101689912 | 286 |
| 290 | 3300035085 | Ga0373929_0009791 | Ga0373929_0009791_343_1260 | 286 |
| 291 | 3300035090 | Ga0373949_0007534 | Ga0373949_0007534_89_1006 | 286 |
| 292 | 3300035121 | Ga0373960_0015943 | Ga0373960_0015943_885_1802 | 286 |
| 293 | 3300035241 | Ga0373961_0015152 | Ga0373961_0015152_172_1089 | 286 |
| 294 | 3300042438 | Ga0439459_0002732 | Ga0439459_0002732_1227_2144 | 286 |
| 295 | 3300042876 | Ga0451577_0005046 | Ga0451577_0005046_1188_2105 | 286 |
| 296 | 3300042876 | Ga0451577_0129831 | Ga0451577_0129831_148_1065 | 286 |
| 297 | 3300045051 | Ga0451576_0006407 | Ga0451576_0006407_686_1603 | 286 |
| 298 | 3300045051 | Ga0451576_0059352 | Ga0451576_0059352_1473_2393 | 286 |
| 299 | 3300045051 | Ga0451576_0376136 | Ga0451576_0376136_220_1137 | 286 |
| 300 | 3300046472 | Ga0495580_0070767 | Ga0495580_0070767_1049_1969 | 286 |
| 301 | 3300048905 | Ga0496102_0152604 | Ga0496102_0152604_49_966 | 286 |
| 302 | 3300050507 | nmdc:mga05p37_348906_c1 | nmdc:mga05p37_348906_c1_391_1308 | 286 |
| 303 | 3300050512 | nmdc:mga0n895_235853_c1 | nmdc:mga0n895_235853_c1_813_1730 | 286 |
| 304 | 3300050512 | nmdc:mga0n895_98912_c1 | nmdc:mga0n895_98912_c1_1836_2753 | 286 |
| 305 | 3300050515 | nmdc:mga0a205_161571_c1 | nmdc:mga0a205_161571_c1_1035_1952 | 286 |
| 306 | 3300005467 | Ga0070706_100020186 | Ga0070706_1000201862 | 287 |
| 307 | 3300005468 | Ga0070707_100032615 | Ga0070707_1000326152 | 287 |
| 308 | 3300005471 | Ga0070698_100013021 | Ga0070698_1000130212 | 287 |
| 309 | 3300005536 | Ga0070697_100014600 | Ga0070697_1000146006 | 287 |
| 310 | 3300006173 | Ga0070716_100062453 | Ga0070716_1000624532 | 287 |
| 311 | 3300006173 | Ga0070716_100157976 | Ga0070716_1001579761 | 287 |
| 312 | 3300006844 | Ga0075428_100028947 | Ga0075428_1000289475 | 287 |
| 313 | 3300006847 | Ga0075431_100030375 | Ga0075431_1000303753 | 287 |
| 314 | 3300006852 | Ga0075433_10030096 | Ga0075433_100300967 | 287 |
| 315 | 3300006880 | Ga0075429_100061009 | Ga0075429_1000610093 | 287 |
| 316 | 3300006914 | Ga0075436_100047451 | Ga0075436_1000474511 | 287 |
| 317 | 3300009094 | Ga0111539_10063797 | Ga0111539_100637975 | 287 |
| 318 | 3300009147 | Ga0114129_10150641 | Ga0114129_101506413 | 287 |
| 319 | 3300009553 | Ga0105249_10109271 | Ga0105249_101092711 | 287 |
| 320 | 3300025939 | Ga0207665_10013049 | Ga0207665_100130494 | 287 |
| 321 | 3300027907 | Ga0207428_10015350 | Ga0207428_100153503 | 287 |
| 322 | 3300044712 | Ga0453684_0093828 | Ga0453684_0093828_90_1016 | 287 |
| 323 | 3300046664 | Ga0495659_0121441 | Ga0495659_0121441_68_1003 | 287 |
| 324 | 3300050507 | nmdc:mga05p37_41356_c1 | nmdc:mga05p37_41356_c1_4404_5324 | 287 |
| 325 | 3300050507 | nmdc:mga05p37_44160_c1 | nmdc:mga05p37_44160_c1_1233_2150 | 287 |
| 326 | 3300050512 | nmdc:mga0n895_113884_c1 | nmdc:mga0n895_113884_c1_1778_2698 | 287 |
| 327 | 3300050515 | nmdc:mga0a205_159970_c1 | nmdc:mga0a205_159970_c1_1189_2124 | 287 |
| 328 | 3300005440 | Ga0070705_100271582 | Ga0070705_1002715821 | 288 |
| 329 | 3300005544 | Ga0070686_100018143 | Ga0070686_1000181434 | 288 |
| 330 | 3300006237 | Ga0097621_100023939 | Ga0097621_1000239394 | 288 |
| 331 | 3300031731 | Ga0307405_10140278 | Ga0307405_101402781 | 288 |
| 332 | 3300031824 | Ga0307413_10115426 | Ga0307413_101154263 | 288 |
| 333 | 3300031852 | Ga0307410_10131505 | Ga0307410_101315051 | 288 |
| 334 | 3300031911 | Ga0307412_10045555 | Ga0307412_100455555 | 288 |
| 335 | 3300032002 | Ga0307416_100040765 | Ga0307416_1000407653 | 288 |
| 336 | 3300034957 | Ga0373938_0039920 | Ga0373938_0039920_72_968 | 288 |
| 337 | 3300035691 | Ga0373931_0013394 | Ga0373931_0013394_2003_2899 | 288 |
| 338 | 3300046476 | Ga0495662_0042285 | Ga0495662_0042285_739_1647 | 289 |
| 339 | 3300046511 | Ga0495608_0017221 | Ga0495608_0017221_2778_3686 | 289 |
| 340 | 3300046535 | Ga0495586_0028808 | Ga0495586_0028808_224_1132 | 289 |
| 341 | 3300046543 | Ga0495645_0089276 | Ga0495645_0089276_583_1491 | 289 |
| 342 | 3300046559 | Ga0495667_0039689 | Ga0495667_0039689_1401_2309 | 289 |
| 343 | 3300046689 | Ga0495613_0075590 | Ga0495613_0075590_311_1219 | 289 |
| 344 | 3300047317 | Ga0495604_0102763 | Ga0495604_0102763_232_1140 | 289 |
| 345 | 3300053077 | Ga0495601_0071087 | Ga0495601_0071087_311_1219 | 289 |
| 346 | 3300005330 | Ga0070690_100022598 | Ga0070690_1000225983 | 290 |
| 347 | 3300006852 | Ga0075433_10007931 | Ga0075433_100079319 | 290 |
| 348 | 3300006871 | Ga0075434_100002226 | Ga0075434_1000022269 | 290 |
| 349 | 3300006914 | Ga0075436_100002173 | Ga0075436_10000217317 | 290 |
| 350 | 3300007076 | Ga0075435_100000806 | Ga0075435_10000080617 | 290 |
| 351 | 3300009094 | Ga0111539_10091260 | Ga0111539_100912604 | 290 |
| 352 | 3300050511 | nmdc:mga08y16_103066_c1 | nmdc:mga08y16_103066_c1_1739_2662 | 290 |
| 353 | 3300050512 | nmdc:mga0n895_14255_c1 | nmdc:mga0n895_14255_c1_772_1695 | 290 |
| 354 | 3300050513 | nmdc:mga0rr50_49413_c1 | nmdc:mga0rr50_49413_c1_1985_2908 | 290 |
| 355 | 3300050514 | nmdc:mga08x19_16770_c1 | nmdc:mga08x19_16770_c1_1857_2780 | 290 |
| 356 | 3300050515 | nmdc:mga0a205_22313_c1 | nmdc:mga0a205_22313_c1_772_1695 | 290 |
| 357 | 3300005937 | Ga0081455_10000601 | Ga0081455_1000060134 | 291 |
| 358 | 3300006173 | Ga0070716_100001154 | Ga0070716_10000115411 | 291 |
| 359 | 3300006914 | Ga0075436_100173879 | Ga0075436_1001738792 | 291 |
| 360 | 3300025939 | Ga0207665_10007315 | Ga0207665_100073156 | 291 |
| 361 | 3300050514 | nmdc:mga08x19_9328_c1 | nmdc:mga08x19_9328_c1_2879_3796 | 291 |
| 362 | 3300005468 | Ga0070707_100494389 | Ga0070707_1004943891 | 292 |
| 363 | 3300007076 | Ga0075435_100417319 | Ga0075435_1004173192 | 292 |
| 364 | 3300007265 | Ga0099794_10018238 | Ga0099794_100182381 | 292 |
| 365 | 3300009147 | Ga0114129_10000730 | Ga0114129_1000073045 | 293 |
| 366 | 3300025911 | Ga0207654_10084278 | Ga0207654_100842782 | 293 |
| 367 | 3300035083 | Ga0373926_0017853 | Ga0373926_0017853_572_1540 | 293 |
| 368 | 3300035116 | Ga0373945_0050553 | Ga0373945_0050553_341_1309 | 293 |
| 369 | 3300035170 | Ga0373943_0131804 | Ga0373943_0131804_329_1297 | 293 |
| 370 | 3300035692 | Ga0373935_0254281 | Ga0373935_0254281_180_1148 | 293 |
| 371 | 3300045051 | Ga0451576_0007141 | Ga0451576_0007141_4219_5145 | 293 |
| 372 | 3300046499 | Ga0495594_0044714 | Ga0495594_0044714_237_1205 | 293 |
| 373 | 3300047321 | Ga0495676_0305194 | Ga0495676_0305194_31_957 | 293 |
| 374 | 3300050507 | nmdc:mga05p37_319257_c1 | nmdc:mga05p37_319257_c1_542_1510 | 293 |
| 375 | 3300050507 | nmdc:mga05p37_606533_c1 | nmdc:mga05p37_606533_c1_87_1157 | 293 |
| 376 | 3300050507 | nmdc:mga05p37_9963_c1 | nmdc:mga05p37_9963_c1_1794_2720 | 293 |
| 377 | 3300050508 | nmdc:mga09592_21699_c1 | nmdc:mga09592_21699_c1_985_1953 | 293 |
| 378 | 3300050508 | nmdc:mga09592_506_c1 | nmdc:mga09592_506_c1_8012_8938 | 293 |
| 379 | 3300050510 | nmdc:mga06r32_184055_c1 | nmdc:mga06r32_184055_c1_721_1647 | 293 |
| 380 | 3300050510 | nmdc:mga06r32_28562_c1 | nmdc:mga06r32_28562_c1_2038_3006 | 293 |
| 381 | 3300050511 | nmdc:mga08y16_150125_c1 | nmdc:mga08y16_150125_c1_1348_2274 | 293 |
| 382 | 3300050511 | nmdc:mga08y16_16845_c1 | nmdc:mga08y16_16845_c1_3706_4674 | 293 |
| 383 | 3300050515 | nmdc:mga0a205_246399_c1 | nmdc:mga0a205_246399_c1_526_1452 | 293 |
| 384 | 3300005445 | Ga0070708_100464657 | Ga0070708_1004646571 | 294 |
| 385 | 3300005518 | Ga0070699_100039648 | Ga0070699_1000396484 | 294 |
| 386 | 3300005546 | Ga0070696_100009753 | Ga0070696_1000097535 | 294 |
| 387 | 3300006914 | Ga0075436_100006027 | Ga0075436_1000060276 | 294 |
| 388 | 3300009176 | Ga0105242_10000746 | Ga0105242_1000074624 | 294 |
| 389 | 3300010375 | Ga0105239_10017858 | Ga0105239_100178583 | 294 |
| 390 | 3300025922 | Ga0207646_10557791 | Ga0207646_105577911 | 294 |
| 391 | 3300034816 | Ga0373930_0001189 | Ga0373930_0001189_1728_2654 | 294 |
| 392 | 3300035083 | Ga0373926_0004693 | Ga0373926_0004693_1782_2711 | 294 |
| 393 | 3300035084 | Ga0373928_0003602 | Ga0373928_0003602_1220_2146 | 294 |
| 394 | 3300035088 | Ga0373940_0009277 | Ga0373940_0009277_1237_2163 | 294 |
| 395 | 3300035112 | Ga0373932_0004419 | Ga0373932_0004419_1119_2045 | 294 |
| 396 | 3300035114 | Ga0373939_0009085 | Ga0373939_0009085_174_1100 | 294 |
| 397 | 3300035116 | Ga0373945_0006055 | Ga0373945_0006055_2803_3732 | 294 |
| 398 | 3300035691 | Ga0373931_0000901 | Ga0373931_0000901_1199_2125 | 294 |
| 399 | 3300035695 | Ga0373927_0030971 | Ga0373927_0030971_1962_2891 | 294 |
| 400 | 3300035725 | Ga0373947_0006446 | Ga0373947_0006446_3592_4521 | 294 |
| 401 | 3300045051 | Ga0451576_0008099 | Ga0451576_0008099_2172_3098 | 294 |
| 402 | 3300046531 | Ga0495665_0102698 | Ga0495665_0102698_546_1475 | 294 |
| 403 | 3300046664 | Ga0495659_0126327 | Ga0495659_0126327_42_956 | 294 |
| 404 | 3300046674 | Ga0495588_0075654 | Ga0495588_0075654_34_963 | 294 |
| 405 | 3300046683 | Ga0495658_0003979 | Ga0495658_0003979_472_1401 | 294 |
| 406 | 3300049585 | Ga0501069_0117603 | Ga0501069_0117603_150_1076 | 294 |
| 407 | 3300050514 | nmdc:mga08x19_21181_c1 | nmdc:mga08x19_21181_c1_1159_2085 | 294 |
| 408 | 3300039438 | Ga0436360_1095714 | Ga0436360_1095714_558_1502 | 299 |
| 409 | 3300005295 | Ga0065707_10013851 | Ga0065707_100138511 | 300 |
| 410 | 3300005334 | Ga0068869_100000362 | Ga0068869_10000036216 | 300 |
| 411 | 3300005337 | Ga0070682_100005691 | Ga0070682_1000056912 | 300 |
| 412 | 3300005338 | Ga0068868_100003571 | Ga0068868_1000035715 | 300 |
| 413 | 3300005340 | Ga0070689_100012506 | Ga0070689_1000125067 | 300 |
| 414 | 3300005341 | Ga0070691_10000756 | Ga0070691_1000075618 | 300 |
| 415 | 3300005343 | Ga0070687_100001869 | Ga0070687_1000018692 | 300 |
| 416 | 3300005345 | Ga0070692_10019995 | Ga0070692_100199952 | 300 |
| 417 | 3300005354 | Ga0070675_100184726 | Ga0070675_1001847262 | 300 |
| 418 | 3300005406 | Ga0070703_10005900 | Ga0070703_100059002 | 300 |
| 419 | 3300005438 | Ga0070701_10000076 | Ga0070701_100000767 | 300 |
| 420 | 3300005440 | Ga0070705_100003134 | Ga0070705_1000031342 | 300 |
| 421 | 3300005441 | Ga0070700_100000605 | Ga0070700_10000060510 | 300 |
| 422 | 3300005444 | Ga0070694_100000270 | Ga0070694_1000002702 | 300 |
| 423 | 3300005458 | Ga0070681_10023396 | Ga0070681_100233964 | 300 |
| 424 | 3300005459 | Ga0068867_100000406 | Ga0068867_10000040617 | 300 |
| 425 | 3300005530 | Ga0070679_100101310 | Ga0070679_1001013103 | 300 |
| 426 | 3300005544 | Ga0070686_100004039 | Ga0070686_1000040392 | 300 |
| 427 | 3300005545 | Ga0070695_100002250 | Ga0070695_1000022502 | 300 |
| 428 | 3300005546 | Ga0070696_100001321 | Ga0070696_10000132118 | 300 |
| 429 | 3300005547 | Ga0070693_100000483 | Ga0070693_10000048321 | 300 |
| 430 | 3300005549 | Ga0070704_100000068 | Ga0070704_10000006831 | 300 |
| 431 | 3300005563 | Ga0068855_100002155 | Ga0068855_10000215512 | 300 |
| 432 | 3300005578 | Ga0068854_100014574 | Ga0068854_1000145743 | 300 |
| 433 | 3300005614 | Ga0068856_100013069 | Ga0068856_1000130697 | 300 |
| 434 | 3300005615 | Ga0070702_100000140 | Ga0070702_10000014022 | 300 |
| 435 | 3300005617 | Ga0068859_100000543 | Ga0068859_10000054334 | 300 |
| 436 | 3300005718 | Ga0068866_10000166 | Ga0068866_1000016622 | 300 |
| 437 | 3300005719 | Ga0068861_100002341 | Ga0068861_1000023412 | 300 |
| 438 | 3300005841 | Ga0068863_100158316 | Ga0068863_1001583162 | 300 |
| 439 | 3300005841 | Ga0068863_100359349 | Ga0068863_1003593492 | 300 |
| 440 | 3300005842 | Ga0068858_100001484 | Ga0068858_10000148418 | 300 |
| 441 | 3300005843 | Ga0068860_100005557 | Ga0068860_10000555718 | 300 |
| 442 | 3300005844 | Ga0068862_100004960 | Ga0068862_10000496018 | 300 |
| 443 | 3300006237 | Ga0097621_100000836 | Ga0097621_10000083621 | 300 |
| 444 | 3300006358 | Ga0068871_100001789 | Ga0068871_1000017895 | 300 |
| 445 | 3300006847 | Ga0075431_100563675 | Ga0075431_1005636752 | 300 |
| 446 | 3300006881 | Ga0068865_100000254 | Ga0068865_10000025417 | 300 |
| 447 | 3300006931 | Ga0097620_100000543 | Ga0097620_10000054334 | 300 |
| 448 | 3300025885 | Ga0207653_10012545 | Ga0207653_100125452 | 300 |
| 449 | 3300025899 | Ga0207642_10005820 | Ga0207642_100058203 | 300 |
| 450 | 3300025903 | Ga0207680_10091171 | Ga0207680_100911712 | 300 |
| 451 | 3300025912 | Ga0207707_10069976 | Ga0207707_100699762 | 300 |
| 452 | 3300025917 | Ga0207660_10000830 | Ga0207660_1000083018 | 300 |
| 453 | 3300025918 | Ga0207662_10000364 | Ga0207662_100003648 | 300 |
| 454 | 3300025921 | Ga0207652_10023639 | Ga0207652_100236392 | 300 |
| 455 | 3300025926 | Ga0207659_10138056 | Ga0207659_101380562 | 300 |
| 456 | 3300025927 | Ga0207687_10002931 | Ga0207687_1000293111 | 300 |
| 457 | 3300025933 | Ga0207706_10172175 | Ga0207706_101721752 | 300 |
| 458 | 3300025934 | Ga0207686_10000852 | Ga0207686_1000085212 | 300 |
| 459 | 3300025935 | Ga0207709_10003152 | Ga0207709_1000315211 | 300 |
| 460 | 3300025936 | Ga0207670_10003105 | Ga0207670_1000310512 | 300 |
| 461 | 3300025938 | Ga0207704_10004527 | Ga0207704_100045272 | 300 |
| 462 | 3300025942 | Ga0207689_10001501 | Ga0207689_1000150119 | 300 |
| 463 | 3300025949 | Ga0207667_10018908 | Ga0207667_100189082 | 300 |
| 464 | 3300026023 | Ga0207677_10001272 | Ga0207677_1000127210 | 300 |
| 465 | 3300026035 | Ga0207703_10006646 | Ga0207703_1000664614 | 300 |
| 466 | 3300026075 | Ga0207708_10000327 | Ga0207708_1000032732 | 300 |
| 467 | 3300026078 | Ga0207702_10277242 | Ga0207702_102772422 | 300 |
| 468 | 3300026089 | Ga0207648_10000706 | Ga0207648_1000070634 | 300 |
| 469 | 3300026118 | Ga0207675_100000616 | Ga0207675_10000061631 | 300 |
| 470 | 3300028380 | Ga0268265_10011375 | Ga0268265_100113752 | 300 |
| 471 | 3300028381 | Ga0268264_10001855 | Ga0268264_1000185519 | 300 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4l6w-assembly1.cif.gz_A | carboxyltransferase subunit (accd6) of mycobacterium tuberculosis acetyl-coa carboxylase | 0.8131 | 71 | 154 |
| 1y7o-assembly1.cif.gz_A | the structure of streptococcus pneumoniae a153p clpp | 0.7882 | 43 | 251 |
| 5ini-assembly1.cif.gz_A | structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics | 0.769 | 71 | 154 |
| 5inf-assembly1.cif.gz_F | structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics | 0.7667 | 71 | 154 |
| 5inf-assembly1.cif.gz_A | structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics | 0.7658 | 71 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58890_51_250_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.946 | 47 | 246 | 3.90.226.10 |
| af_Q58890_51_250_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9369 | 47 | 246 | 3.90.226.10 |
| 4lk5B01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8107 | 74 | 154 | 3.90.226.10 |
| 3p5mE01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8028 | 78 | 165 | 3.90.226.10 |
| 5iniB02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7684 | 71 | 154 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0XVQ9-F1-model_v4 | Serine protease | 0.9491 | 36 | 256 |
GO:0016020
|
| AF-A0A7V0JRC4-F1-model_v4 | Serine protease | 0.9294 | 35 | 270 |
GO:0016020
|
| AF-A0A099T3D4-F1-model_v4 | Serine protease | 0.9252 | 38 | 274 |
GO:0016020
|
| AF-A0A0P7ZFL6-F1-model_v4 | Serine dehydrogenase proteinase | 0.9239 | 35 | 272 |
GO:0016020
|
| AF-X0XVQ9-F1-model_v4 | Serine protease | 0.9132 | 36 | 256 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar