F450680

General Info

Members Datasets Scaffolds Average Seq Length
471 250 471 301

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_606533_c1|nmdc:mga05p37_606533_c1_87_1157
Length 356
Sequence VSKSAIRISKSEQTKDHPTDEIRNAFVSKFWFVDGLNLMETQNVSDGSNERLSSTRPSRHRWWQRFCRIGKFAFWLIVIYMIVQQILGPYWTNAARASVLDQFQQQRKSRVIAMIHRQETISLFGVPVSSYIDIEDSEAVLRAIRLTPPDQPIDMILHTPGGLVLAAEQIAKALVEHKGKVTVFVPHYAMSGGTLIALAADEIVMDANAVLGPVDPQIGDMPAASILRVLNLKQVNRIKDETLELADVAAKARLQVASFVTELLLSRLPKDKAVSLATVLTEGRWTHDFPITVELARQLGLSVSTEMPRIVYELMDLFPQGGADRPSVLYVPLHRSPAGRDEAPASAPAAPTKTKP

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.06
Rhizosphere 98.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10013851 3300005295 Bacteria 2544
2 Ga0070676_10068779 3300005328 Bacteria 2120
3 Ga0070683_100000797 3300005329 Bacteria 23295
4 Ga0070690_100022598 3300005330 Bacteria 3848
5 Ga0070670_100000847 3300005331 Bacteria 23922
6 Ga0070670_100127205 3300005331 Bacteria 2199
7 Ga0068869_100000136 3300005334 Bacteria 35581
8 Ga0068869_100000362 3300005334 Bacteria 24432
9 Ga0070680_100000125 3300005336 Bacteria 45537
10 Ga0070680_100016572 3300005336 Bacteria 5799
11 Ga0070682_100000189 3300005337 Bacteria 46408
12 Ga0070682_100005691 3300005337 Bacteria 6945
13 Ga0068868_100003571 3300005338 Bacteria 10831
14 Ga0068868_100008898 3300005338 Bacteria 7197
15 Ga0068868_100053284 3300005338 Bacteria 3187
16 Ga0070660_100001383 3300005339 Bacteria 16493
17 Ga0070689_100009703 3300005340 Bacteria 6830
18 Ga0070689_100012506 3300005340 Bacteria 6116
19 Ga0070691_10000756 3300005341 Bacteria 12780
20 Ga0070691_10025299 3300005341 Bacteria 2764
21 Ga0070687_100001869 3300005343 Bacteria 7636
22 Ga0070661_100001580 3300005344 Bacteria 15799
23 Ga0070661_100007535 3300005344 Bacteria 7509
24 Ga0070692_10019995 3300005345 Bacteria 3239
25 Ga0070669_100370718 3300005353 Bacteria 1166
26 Ga0070675_100184726 3300005354 Bacteria 1804
27 Ga0070671_100108722 3300005355 Bacteria 2328
28 Ga0070673_100059774 3300005364 Bacteria 3018
29 Ga0070659_100000654 3300005366 Bacteria 25209
30 Ga0070703_10002746 3300005406 Bacteria 5051
31 Ga0070703_10005900 3300005406 Bacteria 3430
32 Ga0070703_10025416 3300005406 Bacteria 1757
33 Ga0070713_100557732 3300005436 Unclassified 1085
34 Ga0070701_10000076 3300005438 Bacteria 27089
35 Ga0070711_100009995 3300005439 Bacteria 5855
36 Ga0070705_100003134 3300005440 Bacteria 8131
37 Ga0070705_100029182 3300005440 Bacteria 3030
38 Ga0070705_100271582 3300005440 Bacteria 1201
39 Ga0070700_100000605 3300005441 Bacteria 17941
40 Ga0070694_100000248 3300005444 Bacteria 28528
41 Ga0070694_100000270 3300005444 Bacteria 27446
42 Ga0070694_100070795 3300005444 Bacteria 2402
43 Ga0070708_100033291 3300005445 Bacteria 4478
44 Ga0070708_100103044 3300005445 Bacteria 2616
45 Ga0070708_100148088 3300005445 Bacteria 2182
46 Ga0070708_100318212 3300005445 Bacteria 1466
47 Ga0070708_100350443 3300005445 Bacteria 1391
48 Ga0070708_100464657 3300005445 Bacteria 1194
49 Ga0070663_100027659 3300005455 Bacteria 3853
50 Ga0070678_100013614 3300005456 Bacteria 5109
51 Ga0070662_100012746 3300005457 Bacteria 5581
52 Ga0070681_10003675 3300005458 Bacteria 14391
53 Ga0070681_10005555 3300005458 Bacteria 12179
54 Ga0070681_10023396 3300005458 Bacteria 6212
55 Ga0068867_100000406 3300005459 Bacteria 29006
56 Ga0068867_100013675 3300005459 Bacteria 5747
57 Ga0068867_100021905 3300005459 Bacteria 4564
58 Ga0070706_100020186 3300005467 Bacteria 6139
59 Ga0070706_100043145 3300005467 Bacteria 4166
60 Ga0070706_100052281 3300005467 Bacteria 3771
61 Ga0070706_100110987 3300005467 Unclassified 2552
62 Ga0070707_100032615 3300005468 Bacteria 4963
63 Ga0070707_100077693 3300005468 Bacteria 3203
64 Ga0070707_100123849 3300005468 Bacteria 2511
65 Ga0070707_100485201 3300005468 Unclassified 1197
66 Ga0070707_100494389 3300005468 Bacteria 1185
67 Ga0070698_100013021 3300005471 Bacteria 8805
68 Ga0070698_100043095 3300005471 Bacteria 4628
69 Ga0070698_100081478 3300005471 Unclassified 3230
70 Ga0070698_100235784 3300005471 Bacteria 1763
71 Ga0070698_100401976 3300005471 Bacteria 1303
72 Ga0070699_100009468 3300005518 Bacteria 8438
73 Ga0070699_100038197 3300005518 Bacteria 4157
74 Ga0070699_100039648 3300005518 Bacteria 4078
75 Ga0070679_100023995 3300005530 Bacteria 5974
76 Ga0070679_100051577 3300005530 Bacteria 4097
77 Ga0070679_100101310 3300005530 Bacteria 2867
78 Ga0070697_100014600 3300005536 Bacteria 6167
79 Ga0068853_100003423 3300005539 Bacteria 12130
80 Ga0070672_100038612 3300005543 Bacteria 3650
81 Ga0070672_100052921 3300005543 Bacteria 3172
82 Ga0070686_100004039 3300005544 Bacteria 8070
83 Ga0070686_100018143 3300005544 Bacteria 4124
84 Ga0070695_100002250 3300005545 Bacteria 11049
85 Ga0070695_100027024 3300005545 Bacteria 3553
86 Ga0070696_100000114 3300005546 Bacteria 41488
87 Ga0070696_100001321 3300005546 Bacteria 16168
88 Ga0070696_100009753 3300005546 Bacteria 6426
89 Ga0070693_100000119 3300005547 Bacteria 35136
90 Ga0070693_100000483 3300005547 Bacteria 17830
91 Ga0070704_100000068 3300005549 Bacteria 34169
92 Ga0070704_100000769 3300005549 Bacteria 15800
93 Ga0068855_100000315 3300005563 Bacteria 60189
94 Ga0068855_100002155 3300005563 Bacteria 24332
95 Ga0070664_100005044 3300005564 Bacteria 10585
96 Ga0070664_100028520 3300005564 Bacteria 4644
97 Ga0068857_100002336 3300005577 Bacteria 15430
98 Ga0068854_100004237 3300005578 Bacteria 9032
99 Ga0068854_100014574 3300005578 Bacteria 5186
100 Ga0068856_100010613 3300005614 Bacteria 8950
101 Ga0068856_100013069 3300005614 Bacteria 8041
102 Ga0070702_100000140 3300005615 Bacteria 22411
103 Ga0070702_100022920 3300005615 Bacteria 3310
104 Ga0068852_100062299 3300005616 Unclassified 3244
105 Ga0068852_100167092 3300005616 Bacteria 2059
106 Ga0068859_100000543 3300005617 Bacteria 37386
107 Ga0068859_100008108 3300005617 Bacteria 10654
108 Ga0068864_100004337 3300005618 Bacteria 11648
109 Ga0068864_100039691 3300005618 Bacteria 4023
110 Ga0068866_10000166 3300005718 Bacteria 30436
111 Ga0068861_100002341 3300005719 Bacteria 12319
112 Ga0068861_100112243 3300005719 Bacteria 2185
113 Ga0068851_10034044 3300005834 Bacteria 2541
114 Ga0068870_10001528 3300005840 Bacteria 9394
115 Ga0068863_100158316 3300005841 Bacteria 2169
116 Ga0068863_100329500 3300005841 Bacteria 1484
117 Ga0068863_100359349 3300005841 Bacteria 1419
118 Ga0068858_100001484 3300005842 Bacteria 24147
119 Ga0068858_100199251 3300005842 Bacteria 1893
120 Ga0068860_100005557 3300005843 Bacteria 12752
121 Ga0068860_100330825 3300005843 Bacteria 1496
122 Ga0068862_100004960 3300005844 Bacteria 11206
123 Ga0068862_100095963 3300005844 Bacteria 2587
124 Ga0081455_10000601 3300005937 Bacteria 46589
125 Ga0081455_10006241 3300005937 Bacteria 12833
126 Ga0081539_10002956 3300005985 Bacteria 22338
127 Ga0070717_10203145 3300006028 Unclassified 1736
128 Ga0070716_100001154 3300006173 Bacteria 11646
129 Ga0070716_100062453 3300006173 Bacteria 2160
130 Ga0070716_100157976 3300006173 Bacteria 1466
131 Ga0070712_100032396 3300006175 Bacteria 3529
132 Ga0097621_100000836 3300006237 Bacteria 21659
133 Ga0097621_100010805 3300006237 Bacteria 6699
134 Ga0097621_100023939 3300006237 Bacteria 4760
135 Ga0068871_100001789 3300006358 Bacteria 14490
136 Ga0068871_100002227 3300006358 Bacteria 13174
137 Ga0075428_100028947 3300006844 Bacteria 6130
138 Ga0075428_100288345 3300006844 Unclassified 1766
139 Ga0075428_100707462 3300006844 Bacteria 1073
140 Ga0075428_100798209 3300006844 Bacteria 1003
141 Ga0075430_100008721 3300006846 Bacteria 8557
142 Ga0075430_100234633 3300006846 Bacteria 1521
143 Ga0075431_100020660 3300006847 Bacteria 6728
144 Ga0075431_100030375 3300006847 Bacteria 5565
145 Ga0075431_100398099 3300006847 Bacteria 1378
146 Ga0075431_100431554 3300006847 Bacteria 1316
147 Ga0075431_100563675 3300006847 Bacteria 1125
148 Ga0075433_10003626 3300006852 Bacteria 11927
149 Ga0075433_10007931 3300006852 Bacteria 8450
150 Ga0075433_10030096 3300006852 Bacteria 4630
151 Ga0075433_10127128 3300006852 Bacteria 2263
152 Ga0075433_10129833 3300006852 Bacteria 2239
153 Ga0075434_100002226 3300006871 Bacteria 16934
154 Ga0075434_100167057 3300006871 Bacteria 2220
155 Ga0075434_100346033 3300006871 Unclassified 1508
156 Ga0075434_100468172 3300006871 Bacteria 1281
157 Ga0075429_100006285 3300006880 Bacteria 10283
158 Ga0075429_100039798 3300006880 Bacteria 4091
159 Ga0075429_100061009 3300006880 Unclassified 3285
160 Ga0075429_100169413 3300006880 Bacteria 1913
161 Ga0075429_100312989 3300006880 Unclassified 1374
162 Ga0068865_100000254 3300006881 Bacteria 29586
163 Ga0075436_100002173 3300006914 Bacteria 13516
164 Ga0075436_100006027 3300006914 Bacteria 8321
165 Ga0075436_100047451 3300006914 Unclassified 2963
166 Ga0075436_100091616 3300006914 Bacteria 2113
167 Ga0075436_100151569 3300006914 Bacteria 1632
168 Ga0075436_100173879 3300006914 Bacteria 1521
169 Ga0097620_100000543 3300006931 Bacteria 37386
170 Ga0097620_100008107 3300006931 Bacteria 10654
171 Ga0075435_100000806 3300007076 Bacteria 19514
172 Ga0075435_100132207 3300007076 Bacteria 2088
173 Ga0075435_100417319 3300007076 Bacteria 1155
174 Ga0099794_10006410 3300007265 Bacteria 4763
175 Ga0099794_10018238 3300007265 Bacteria 3144
176 Ga0111539_10063797 3300009094 Unclassified 4359
177 Ga0111539_10091260 3300009094 Bacteria 3579
178 Ga0111539_10302487 3300009094 Bacteria 1861
179 Ga0105245_10001077 3300009098 Bacteria 24735
180 Ga0114129_10000730 3300009147 Bacteria 41752
181 Ga0114129_10043047 3300009147 Bacteria 6356
182 Ga0114129_10059177 3300009147 Bacteria 5356
183 Ga0114129_10150641 3300009147 Bacteria 3184
184 Ga0114129_10192348 3300009147 Bacteria 2770
185 Ga0114129_10625450 3300009147 Bacteria 1392
186 Ga0114129_10710854 3300009147 Unclassified 1290
187 Ga0114129_10802243 3300009147 Bacteria 1201
188 Ga0105243_10000508 3300009148 Bacteria 39703
189 Ga0105241_10013593 3300009174 Bacteria 5966
190 Ga0105242_10000746 3300009176 Bacteria 25338
191 Ga0105242_10091145 3300009176 Bacteria 2566
192 Ga0105248_10068978 3300009177 Bacteria 3970
193 Ga0105248_10352371 3300009177 Bacteria 1657
194 Ga0105249_10004637 3300009553 Bacteria 11878
195 Ga0105249_10109271 3300009553 Unclassified 2612
196 Ga0105239_10017858 3300010375 Bacteria 7846
197 Ga0105246_10236606 3300011119 Bacteria 1441
198 Ga0157373_10001185 3300013100 Bacteria 19935
199 Ga0157371_10098715 3300013102 Bacteria 2071
200 Ga0157370_10249714 3300013104 Bacteria 1641
201 Ga0157369_10004085 3300013105 Bacteria 17279
202 Ga0157374_10002050 3300013296 Bacteria 16944
203 Ga0157378_10000714 3300013297 Bacteria 31062
204 Ga0157378_10023436 3300013297 Bacteria 5434
205 Ga0157378_10273649 3300013297 Bacteria 1625
206 Ga0163162_10025577 3300013306 Bacteria 5834
207 Ga0163162_10177334 3300013306 Archaea 2257
208 Ga0157372_10004865 3300013307 Bacteria 14273
209 Ga0157375_10001207 3300013308 Bacteria 22301
210 Ga0157375_10245384 3300013308 Bacteria 1951
211 Ga0163163_10090117 3300014325 Bacteria 3080
212 Ga0182008_10064267 3300014497 Bacteria 1807
213 Ga0157377_10182315 3300014745 Bacteria 1321
214 Ga0157376_10020785 3300014969 Bacteria 5088
215 Ga0182007_10023877 3300015262 Bacteria 2146
216 Ga0207656_10037461 3300025321 Bacteria 2041
217 Ga0207653_10003370 3300025885 Bacteria 5044
218 Ga0207653_10012545 3300025885 Bacteria 2647
219 Ga0207642_10005820 3300025899 Bacteria 4055
220 Ga0207680_10091171 3300025903 Bacteria 1939
221 Ga0207680_10116278 3300025903 Bacteria 1743
222 Ga0207645_10005247 3300025907 Bacteria 9439
223 Ga0207643_10000296 3300025908 Bacteria 34571
224 Ga0207684_10015309 3300025910 Bacteria 6603
225 Ga0207684_10027482 3300025910 Bacteria 4848
226 Ga0207684_10067983 3300025910 Unclassified 3028
227 Ga0207684_10383259 3300025910 Unclassified 1209
228 Ga0207654_10025012 3300025911 Bacteria 3216
229 Ga0207654_10084278 3300025911 Bacteria 1921
230 Ga0207707_10000443 3300025912 Bacteria 43041
231 Ga0207707_10014358 3300025912 Bacteria 6898
232 Ga0207707_10069976 3300025912 Bacteria 3058
233 Ga0207693_10017227 3300025915 Bacteria 5761
234 Ga0207660_10000830 3300025917 Bacteria 20366
235 Ga0207660_10002832 3300025917 Bacteria 11370
236 Ga0207662_10000364 3300025918 Bacteria 20389
237 Ga0207657_10000095 3300025919 Bacteria 85098
238 Ga0207649_10008213 3300025920 Bacteria 5685
239 Ga0207649_10023423 3300025920 Bacteria 3576
240 Ga0207652_10023191 3300025921 Bacteria 5140
241 Ga0207652_10023639 3300025921 Bacteria 5092
242 Ga0207646_10003336 3300025922 Bacteria 18235
243 Ga0207646_10044429 3300025922 Bacteria 3988
244 Ga0207646_10063931 3300025922 Bacteria 3285
245 Ga0207646_10169847 3300025922 Bacteria 1969
246 Ga0207646_10557791 3300025922 Bacteria 1030
247 Ga0207681_10085841 3300025923 Bacteria 2235
248 Ga0207650_10000686 3300025925 Bacteria 26590
249 Ga0207650_10009474 3300025925 Bacteria 6653
250 Ga0207659_10008182 3300025926 Bacteria 6479
251 Ga0207659_10138056 3300025926 Bacteria 1889
252 Ga0207687_10002931 3300025927 Bacteria 11589
253 Ga0207700_10004346 3300025928 Bacteria 8339
254 Ga0207644_10060157 3300025931 Bacteria 2748
255 Ga0207690_10133301 3300025932 Bacteria 1821
256 Ga0207706_10001514 3300025933 Bacteria 23029
257 Ga0207706_10172175 3300025933 Bacteria 1902
258 Ga0207686_10000852 3300025934 Bacteria 18528
259 Ga0207709_10003152 3300025935 Bacteria 9912
260 Ga0207670_10003105 3300025936 Bacteria 8789
261 Ga0207670_10045286 3300025936 Bacteria 2916
262 Ga0207704_10004527 3300025938 Bacteria 6357
263 Ga0207665_10007315 3300025939 Bacteria 7304
264 Ga0207665_10013049 3300025939 Bacteria 5460
265 Ga0207691_10009442 3300025940 Bacteria 9367
266 Ga0207691_10052557 3300025940 Bacteria 3721
267 Ga0207711_10055546 3300025941 Bacteria 3399
268 Ga0207689_10000121 3300025942 Bacteria 65023
269 Ga0207689_10001501 3300025942 Bacteria 22293
270 Ga0207661_10251120 3300025944 Unclassified 1572
271 Ga0207679_10048224 3300025945 Bacteria 3099
272 Ga0207679_10094078 3300025945 Bacteria 2326
273 Ga0207667_10018908 3300025949 Bacteria 7706
274 Ga0207667_10153262 3300025949 Bacteria 2371
275 Ga0207651_10033315 3300025960 Bacteria 3322
276 Ga0207640_10069822 3300025981 Bacteria 2360
277 Ga0207658_10059329 3300025986 Bacteria 2851
278 Ga0207677_10001272 3300026023 Bacteria 13553
279 Ga0207677_10013776 3300026023 Unclassified 4697
280 Ga0207677_10052636 3300026023 Bacteria 2767
281 Ga0207703_10006646 3300026035 Bacteria 9223
282 Ga0207703_10159728 3300026035 Bacteria 1973
283 Ga0207639_10004035 3300026041 Bacteria 9907
284 Ga0207678_10103762 3300026067 Bacteria 2426
285 Ga0207708_10000327 3300026075 Bacteria 37451
286 Ga0207708_10149160 3300026075 Bacteria 1839
287 Ga0207702_10277242 3300026078 Bacteria 1584
288 Ga0207702_10408726 3300026078 Bacteria 1310
289 Ga0207648_10000706 3300026089 Bacteria 37476
290 Ga0207648_10002571 3300026089 Bacteria 19440
291 Ga0207648_10055825 3300026089 Unclassified 3447
292 Ga0207676_10012123 3300026095 Bacteria 6171
293 Ga0207676_10061393 3300026095 Bacteria 2976
294 Ga0207674_10000307 3300026116 Bacteria 62207
295 Ga0207675_100000616 3300026118 Bacteria 34778
296 Ga0207683_10007259 3300026121 Bacteria 9498
297 Ga0207698_10073920 3300026142 Unclassified 2716
298 Ga0209974_10070956 3300027876 Bacteria 1188
299 Ga0207428_10015350 3300027907 Bacteria 6628
300 Ga0207428_10228278 3300027907 Bacteria 1394
301 Ga0268265_10011375 3300028380 Bacteria 6017
302 Ga0268265_10039644 3300028380 Bacteria 3473
303 Ga0268264_10001855 3300028381 Bacteria 19216
304 Ga0268264_10168991 3300028381 Bacteria 1976
305 Ga0307405_10140278 3300031731 Bacteria 1684
306 Ga0307413_10115426 3300031824 Bacteria 1807
307 Ga0307410_10131505 3300031852 Bacteria 1839
308 Ga0307412_10045555 3300031911 Bacteria 2868
309 Ga0307416_100040765 3300032002 Bacteria 3611
310 Ga0307416_100064068 3300032002 Bacteria 3014
311 Ga0307416_100277750 3300032002 Bacteria 1649
312 Ga0373930_0001189 3300034816 Bacteria 3821
313 Ga0373938_0039920 3300034957 Bacteria 1039
314 Ga0373926_0004693 3300035083 Bacteria 4493
315 Ga0373926_0017853 3300035083 Bacteria 2438
316 Ga0373928_0003602 3300035084 Bacteria 2953
317 Ga0373929_0009791 3300035085 Bacteria 1782
318 Ga0373940_0009277 3300035088 Bacteria 2284
319 Ga0373949_0007534 3300035090 Bacteria 2383
320 Ga0373932_0004419 3300035112 Bacteria 3327
321 Ga0373939_0009085 3300035114 Bacteria 2456
322 Ga0373945_0006055 3300035116 Bacteria 3889
323 Ga0373945_0050553 3300035116 Bacteria 1528
324 Ga0373960_0015943 3300035121 Unclassified 1926
325 Ga0373943_0131804 3300035170 Bacteria 1338
326 Ga0373955_0071399 3300035172 Bacteria 1942
327 Ga0373961_0015152 3300035241 Bacteria 1967
328 Ga0373924_0004192 3300035410 Bacteria 5022
329 Ga0373931_0000901 3300035691 Bacteria 12578
330 Ga0373931_0008118 3300035691 Bacteria 4972
331 Ga0373931_0013394 3300035691 Bacteria 3993
332 Ga0373935_0254281 3300035692 Bacteria 1230
333 Ga0373927_0030971 3300035695 Bacteria 3489
334 Ga0373933_0001890 3300035724 Bacteria 12080
335 Ga0373947_0006446 3300035725 Bacteria 6815
336 Ga0436360_1095714 3300039438 Bacteria 1632
337 Ga0439459_0002732 3300042438 Bacteria 2745
338 Ga0451577_0005046 3300042876 Bacteria 13638
339 Ga0451577_0129831 3300042876 Bacteria 2260
340 Ga0451577_0139125 3300042876 Bacteria 2181
341 Ga0451577_0165267 3300042876 Bacteria 1993
342 Ga0453683_0016610 3300044673 Bacteria 4746
343 Ga0453684_0093828 3300044712 Bacteria 3695
344 Ga0453684_0263390 3300044712 Bacteria 1973
345 Ga0451576_0006407 3300045051 Bacteria 14439
346 Ga0451576_0007141 3300045051 Bacteria 13476
347 Ga0451576_0008099 3300045051 Bacteria 12386
348 Ga0451576_0011180 3300045051 Bacteria 10231
349 Ga0451576_0059352 3300045051 Bacteria 3993
350 Ga0451576_0062155 3300045051 Bacteria 3894
351 Ga0451576_0376136 3300045051 Bacteria 1488
352 Ga0466967_0015112 3300045976 Bacteria 6042
353 Ga0495580_0070767 3300046472 Bacteria 2437
354 Ga0495662_0042285 3300046476 Bacteria 2199
355 Ga0495594_0044714 3300046499 Bacteria 2430
356 Ga0495608_0017221 3300046511 Bacteria 5001
357 Ga0495665_0102698 3300046531 Bacteria 1500
358 Ga0495586_0028808 3300046535 Bacteria 2971
359 Ga0495645_0089276 3300046543 Bacteria 2204
360 Ga0495667_0039689 3300046559 Bacteria 3129
361 Ga0495656_0005384 3300046615 Bacteria 4415
362 Ga0495659_0121441 3300046664 Bacteria 1029
363 Ga0495659_0126327 3300046664 Bacteria 1011
364 Ga0495588_0075654 3300046674 Bacteria 1754
365 Ga0495658_0003979 3300046683 Bacteria 7283
366 Ga0495613_0075590 3300046689 Bacteria 2452
367 Ga0495604_0102763 3300047317 Bacteria 2097
368 Ga0495676_0305194 3300047321 Bacteria 1072
369 Ga0496102_0152604 3300048905 Bacteria 2171
370 Ga0496108_0005021 3300048911 Bacteria 10693
371 Ga0496110_0002625 3300048913 Bacteria 13534
372 Ga0496111_0057525 3300048914 Bacteria 2815
373 Ga0496112_0377056 3300048915 Bacteria 1360
374 Ga0501299_003674 3300049522 Bacteria 2242
375 Ga0501033_0123702 3300049570 Bacteria 1876
376 Ga0501036_0014617 3300049572 Bacteria 6539
377 Ga0501036_0114658 3300049572 Bacteria 2277
378 Ga0501038_0082333 3300049574 Bacteria 2710
379 Ga0501039_0009182 3300049575 Bacteria 7535
380 Ga0501040_0014334 3300049576 Bacteria 5222
381 Ga0501040_0015684 3300049576 Bacteria 5009
382 Ga0501041_0005149 3300049577 Bacteria 7629
383 Ga0501041_0012108 3300049577 Bacteria 5107
384 Ga0501042_0001736 3300049578 Bacteria 13042
385 Ga0501042_0034883 3300049578 Bacteria 3569
386 Ga0501043_0061296 3300049579 Bacteria 2954
387 Ga0501043_0206754 3300049579 Bacteria 1522
388 Ga0501046_0000526 3300049580 Bacteria 37973
389 Ga0501047_0044990 3300049581 Bacteria 4267
390 Ga0501048_0039904 3300049582 Bacteria 3365
391 Ga0501048_0046790 3300049582 Bacteria 3088
392 Ga0501067_0065105 3300049583 Bacteria 2018
393 Ga0501069_0117603 3300049585 Bacteria 1517
394 Ga0501069_0182947 3300049585 Bacteria 1212
395 Ga0501071_0009255 3300049587 Bacteria 6552
396 Ga0501071_0074510 3300049587 Bacteria 2477
397 Ga0501072_0003151 3300049588 Bacteria 12411
398 Ga0501072_0069551 3300049588 Bacteria 2780
399 Ga0501075_0000272 3300049591 Bacteria 28414
400 Ga0501075_0021678 3300049591 Bacteria 4686
401 Ga0501076_0001079 3300049592 Bacteria 17925
402 Ga0501076_0058924 3300049592 Bacteria 3053
403 Ga0501077_0042963 3300049593 Bacteria 2872
404 Ga0501077_0106138 3300049593 Bacteria 1780
405 Ga0501233_036131 3300049668 Bacteria 1141
406 Ga0501235_009670 3300049669 Bacteria 2107
407 Ga0501079_0000917 3300049741 Bacteria 20233
408 Ga0501079_0002303 3300049741 Bacteria 13814
409 Ga0501080_0007120 3300049742 Bacteria 10099
410 Ga0501080_0042517 3300049742 Bacteria 4231
411 Ga0501080_0575253 3300049742 Bacteria 1002
412 Ga0501081_0001663 3300049743 Bacteria 13751
413 Ga0501081_0007001 3300049743 Bacteria 7334
414 Ga0501081_0209565 3300049743 Bacteria 1415
415 Ga0501035_0094056 3300049822 Bacteria 2636
416 Ga0501035_0333346 3300049822 Bacteria 1273
417 Ga0501045_0000387 3300049824 Bacteria 26619
418 nmdc:mga05p37_144620_c1 3300050507 Bacteria 2912
419 nmdc:mga05p37_167073_c1 3300050507 Bacteria 2685
420 nmdc:mga05p37_319257_c1 3300050507 Bacteria 1839
421 nmdc:mga05p37_348906_c1 3300050507 Bacteria 1743
422 nmdc:mga05p37_41356_c1 3300050507 Bacteria 5659
423 nmdc:mga05p37_44160_c1 3300050507 Bacteria 5483
424 nmdc:mga05p37_606533_c1 3300050507 Bacteria 1235
425 nmdc:mga05p37_72459_c1 3300050507 Unclassified 4239
426 nmdc:mga05p37_9963_c1 3300050507 Bacteria 11286
427 nmdc:mga09592_16244_c1 3300050508 Bacteria 6084
428 nmdc:mga09592_21699_c1 3300050508 Bacteria 5294
429 nmdc:mga09592_506_c1 3300050508 Bacteria 29447
430 nmdc:mga09592_652203_c1 3300050508 Archaea 899
431 nmdc:mga0qj67_12843_c1 3300050509 Bacteria 6319
432 nmdc:mga0qj67_43337_c1 3300050509 Bacteria 3544
433 nmdc:mga06r32_184055_c1 3300050510 Bacteria 2075
434 nmdc:mga06r32_28562_c1 3300050510 Bacteria 5222
435 nmdc:mga06r32_38506_c1 3300050510 Unclassified 4531
436 nmdc:mga06r32_93932_c1 3300050510 Bacteria 2935
437 nmdc:mga08y16_103066_c1 3300050511 Bacteria 2971
438 nmdc:mga08y16_150125_c1 3300050511 Bacteria 2423
439 nmdc:mga08y16_16845_c1 3300050511 Bacteria 7694
440 nmdc:mga08y16_550486_c1 3300050511 Bacteria 1168
441 nmdc:mga08y16_88172_c1 3300050511 Bacteria 3233
442 nmdc:mga0n895_113884_c1 3300050512 Bacteria 2723
443 nmdc:mga0n895_14255_c1 3300050512 Bacteria 7213
444 nmdc:mga0n895_235853_c1 3300050512 Bacteria 1857
445 nmdc:mga0n895_297344_c1 3300050512 Bacteria 1637
446 nmdc:mga0n895_703975_c1 3300050512 Bacteria 1006
447 nmdc:mga0n895_98912_c1 3300050512 Bacteria 2925
448 nmdc:mga0rr50_135987_c1 3300050513 Bacteria 1973
449 nmdc:mga0rr50_49413_c1 3300050513 Bacteria 3114
450 nmdc:mga0rr50_82801_c1 3300050513 Bacteria 2479
451 nmdc:mga0rr50_88527_c1 3300050513 Bacteria 2406
452 nmdc:mga08x19_144175_c1 3300050514 Bacteria 1610
453 nmdc:mga08x19_16770_c1 3300050514 Bacteria 4472
454 nmdc:mga08x19_21181_c1 3300050514 Bacteria 4009
455 nmdc:mga08x19_57028_c1 3300050514 Bacteria 2523
456 nmdc:mga08x19_74744_c1 3300050514 Bacteria 2215
457 nmdc:mga08x19_9328_c1 3300050514 Bacteria 4600
458 nmdc:mga0a205_159970_c1 3300050515 Bacteria 2149
459 nmdc:mga0a205_161571_c1 3300050515 Bacteria 2137
460 nmdc:mga0a205_218677_c1 3300050515 Unclassified 1791
461 nmdc:mga0a205_22313_c1 3300050515 Bacteria 5994
462 nmdc:mga0a205_246399_c1 3300050515 Bacteria 1667
463 nmdc:mga0a205_279689_c1 3300050515 Unclassified 1544
464 nmdc:mga0a205_46297_c1 3300050515 Bacteria 4195
465 Ga0495601_0071087 3300053077 Bacteria 2222
466 Ga0501084_0004620 3300054114 Bacteria 11248
467 Ga0501084_0038112 3300054114 Bacteria 4018
468 Ga0501082_0006609 3300060353 Bacteria 10032
469 Ga0501082_0007493 3300060353 Bacteria 9417
470 Ga0501082_0277829 3300060353 Bacteria 1458
471 Ga0530510_0000641 3300061734 Bacteria 22513

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025944 Ga0207661_10251120 Ga0207661_102511202 258
2 3300005471 Ga0070698_100401976 Ga0070698_1004019761 271
3 3300013306 Ga0163162_10025577 Ga0163162_100255773 271
4 3300005439 Ga0070711_100009995 Ga0070711_1000099957 272
5 3300005985 Ga0081539_10002956 Ga0081539_100029563 272
6 3300006028 Ga0070717_10203145 Ga0070717_102031452 272
7 3300006175 Ga0070712_100032396 Ga0070712_1000323965 272
8 3300006847 Ga0075431_100431554 Ga0075431_1004315541 272
9 3300006880 Ga0075429_100039798 Ga0075429_1000397982 272
10 3300006880 Ga0075429_100312989 Ga0075429_1003129892 272
11 3300025915 Ga0207693_10017227 Ga0207693_100172276 272
12 3300025928 Ga0207700_10004346 Ga0207700_100043461 272
13 3300050507 nmdc:mga05p37_167073_c1 nmdc:mga05p37_167073_c1_924_1787 272
14 3300050508 nmdc:mga09592_652203_c1 nmdc:mga09592_652203_c1_20_883 272
15 3300050511 nmdc:mga08y16_550486_c1 nmdc:mga08y16_550486_c1_230_1090 272
16 3300050512 nmdc:mga0n895_703975_c1 nmdc:mga0n895_703975_c1_79_942 272
17 3300005468 Ga0070707_100123849 Ga0070707_1001238492 273
18 3300049743 Ga0501081_0209565 Ga0501081_0209565_25_894 273
19 3300006844 Ga0075428_100288345 Ga0075428_1002883452 274
20 3300006871 Ga0075434_100346033 Ga0075434_1003460332 274
21 3300025910 Ga0207684_10383259 Ga0207684_103832592 274
22 3300006846 Ga0075430_100008721 Ga0075430_1000087214 275
23 3300006846 Ga0075430_100234633 Ga0075430_1002346332 275
24 3300006847 Ga0075431_100020660 Ga0075431_1000206602 275
25 3300006880 Ga0075429_100169413 Ga0075429_1001694132 275
26 3300009147 Ga0114129_10192348 Ga0114129_101923481 275
27 3300009147 Ga0114129_10710854 Ga0114129_107108542 275
28 3300049742 Ga0501080_0575253 Ga0501080_0575253_127_990 275
29 3300050507 nmdc:mga05p37_72459_c1 nmdc:mga05p37_72459_c1_2960_3835 275
30 3300050509 nmdc:mga0qj67_12843_c1 nmdc:mga0qj67_12843_c1_1383_2258 275
31 3300050510 nmdc:mga06r32_38506_c1 nmdc:mga06r32_38506_c1_3568_4443 275
32 3300005436 Ga0070713_100557732 Ga0070713_1005577321 276
33 3300006871 Ga0075434_100468172 Ga0075434_1004681722 276
34 3300006914 Ga0075436_100151569 Ga0075436_1001515692 276
35 3300007076 Ga0075435_100132207 Ga0075435_1001322073 276
36 3300013306 Ga0163162_10177334 Ga0163162_101773342 276
37 3300049570 Ga0501033_0123702 Ga0501033_0123702_113_1042 276
38 3300049572 Ga0501036_0014617 Ga0501036_0014617_2638_3567 276
39 3300049574 Ga0501038_0082333 Ga0501038_0082333_96_1025 276
40 3300049576 Ga0501040_0015684 Ga0501040_0015684_3040_3969 276
41 3300049577 Ga0501041_0012108 Ga0501041_0012108_2867_3796 276
42 3300049578 Ga0501042_0034883 Ga0501042_0034883_1277_2206 276
43 3300049579 Ga0501043_0206754 Ga0501043_0206754_568_1497 276
44 3300049582 Ga0501048_0039904 Ga0501048_0039904_944_1873 276
45 3300049585 Ga0501069_0182947 Ga0501069_0182947_101_1030 276
46 3300049587 Ga0501071_0009255 Ga0501071_0009255_1248_2177 276
47 3300049588 Ga0501072_0003151 Ga0501072_0003151_11186_12115 276
48 3300049591 Ga0501075_0000272 Ga0501075_0000272_5926_6855 276
49 3300049592 Ga0501076_0001079 Ga0501076_0001079_12619_13548 276
50 3300049593 Ga0501077_0106138 Ga0501077_0106138_325_1254 276
51 3300049741 Ga0501079_0002303 Ga0501079_0002303_8933_9862 276
52 3300049742 Ga0501080_0007120 Ga0501080_0007120_6564_7493 276
53 3300049743 Ga0501081_0001663 Ga0501081_0001663_6792_7721 276
54 3300049822 Ga0501035_0094056 Ga0501035_0094056_1285_2214 276
55 3300050512 nmdc:mga0n895_297344_c1 nmdc:mga0n895_297344_c1_361_1272 276
56 3300050513 nmdc:mga0rr50_135987_c1 nmdc:mga0rr50_135987_c1_895_1806 276
57 3300060353 Ga0501082_0006609 Ga0501082_0006609_2048_2977 276
58 3300061734 Ga0530510_0000641 Ga0530510_0000641_4538_5467 276
59 3300006847 Ga0075431_100398099 Ga0075431_1003980992 277
60 3300006880 Ga0075429_100006285 Ga0075429_1000062853 277
61 3300009147 Ga0114129_10043047 Ga0114129_100430478 277
62 3300050507 nmdc:mga05p37_144620_c1 nmdc:mga05p37_144620_c1_1122_1994 277
63 3300050508 nmdc:mga09592_16244_c1 nmdc:mga09592_16244_c1_3139_4011 277
64 3300050509 nmdc:mga0qj67_43337_c1 nmdc:mga0qj67_43337_c1_1552_2424 277
65 3300050510 nmdc:mga06r32_93932_c1 nmdc:mga06r32_93932_c1_639_1511 277
66 3300054114 Ga0501084_0038112 Ga0501084_0038112_13_942 277
67 3300005458 Ga0070681_10003675 Ga0070681_100036759 278
68 3300005530 Ga0070679_100051577 Ga0070679_1000515774 278
69 3300006852 Ga0075433_10127128 Ga0075433_101271284 278
70 3300009147 Ga0114129_10625450 Ga0114129_106254501 278
71 3300025912 Ga0207707_10014358 Ga0207707_100143588 278
72 3300025921 Ga0207652_10023191 Ga0207652_100231915 278
73 3300050513 nmdc:mga0rr50_82801_c1 nmdc:mga0rr50_82801_c1_796_1716 278
74 3300050514 nmdc:mga08x19_57028_c1 nmdc:mga08x19_57028_c1_1114_2034 278
75 3300005445 Ga0070708_100033291 Ga0070708_1000332915 279
76 3300005445 Ga0070708_100103044 Ga0070708_1001030444 279
77 3300005467 Ga0070706_100110987 Ga0070706_1001109872 279
78 3300005468 Ga0070707_100485201 Ga0070707_1004852012 279
79 3300005471 Ga0070698_100081478 Ga0070698_1000814782 279
80 3300005518 Ga0070699_100009468 Ga0070699_1000094688 279
81 3300025910 Ga0207684_10067983 Ga0207684_100679833 279
82 3300025922 Ga0207646_10044429 Ga0207646_100444292 279
83 3300050514 nmdc:mga08x19_144175_c1 nmdc:mga08x19_144175_c1_139_1047 279
84 3300005329 Ga0070683_100000797 Ga0070683_10000079716 280
85 3300005331 Ga0070670_100000847 Ga0070670_1000008478 280
86 3300005338 Ga0068868_100008898 Ga0068868_1000088985 280
87 3300005344 Ga0070661_100007535 Ga0070661_1000075356 280
88 3300005355 Ga0070671_100108722 Ga0070671_1001087222 280
89 3300005364 Ga0070673_100059774 Ga0070673_1000597742 280
90 3300005445 Ga0070708_100350443 Ga0070708_1003504431 280
91 3300005456 Ga0070678_100013614 Ga0070678_1000136142 280
92 3300005459 Ga0068867_100013675 Ga0068867_1000136755 280
93 3300005467 Ga0070706_100043145 Ga0070706_1000431453 280
94 3300005467 Ga0070706_100052281 Ga0070706_1000522812 280
95 3300005468 Ga0070707_100077693 Ga0070707_1000776933 280
96 3300005471 Ga0070698_100043095 Ga0070698_1000430953 280
97 3300005518 Ga0070699_100038197 Ga0070699_1000381973 280
98 3300005543 Ga0070672_100052921 Ga0070672_1000529212 280
99 3300005564 Ga0070664_100005044 Ga0070664_1000050449 280
100 3300005616 Ga0068852_100062299 Ga0068852_1000622992 280
101 3300005618 Ga0068864_100004337 Ga0068864_1000043376 280
102 3300005834 Ga0068851_10034044 Ga0068851_100340442 280
103 3300005841 Ga0068863_100329500 Ga0068863_1003295002 280
104 3300006237 Ga0097621_100010805 Ga0097621_1000108053 280
105 3300006358 Ga0068871_100002227 Ga0068871_1000022277 280
106 3300006844 Ga0075428_100798209 Ga0075428_1007982091 280
107 3300009176 Ga0105242_10091145 Ga0105242_100911453 280
108 3300009177 Ga0105248_10068978 Ga0105248_100689782 280
109 3300013296 Ga0157374_10002050 Ga0157374_1000205012 280
110 3300013297 Ga0157378_10023436 Ga0157378_100234363 280
111 3300013308 Ga0157375_10001207 Ga0157375_1000120722 280
112 3300025321 Ga0207656_10037461 Ga0207656_100374612 280
113 3300025903 Ga0207680_10116278 Ga0207680_101162782 280
114 3300025910 Ga0207684_10015309 Ga0207684_100153094 280
115 3300025910 Ga0207684_10027482 Ga0207684_100274826 280
116 3300025920 Ga0207649_10008213 Ga0207649_100082131 280
117 3300025922 Ga0207646_10003336 Ga0207646_1000333616 280
118 3300025922 Ga0207646_10063931 Ga0207646_100639313 280
119 3300025925 Ga0207650_10000686 Ga0207650_1000068611 280
120 3300025926 Ga0207659_10008182 Ga0207659_100081822 280
121 3300025931 Ga0207644_10060157 Ga0207644_100601572 280
122 3300025940 Ga0207691_10009442 Ga0207691_100094427 280
123 3300025941 Ga0207711_10055546 Ga0207711_100555463 280
124 3300025945 Ga0207679_10094078 Ga0207679_100940782 280
125 3300025986 Ga0207658_10059329 Ga0207658_100593292 280
126 3300026023 Ga0207677_10013776 Ga0207677_100137762 280
127 3300026089 Ga0207648_10055825 Ga0207648_100558254 280
128 3300026095 Ga0207676_10012123 Ga0207676_100121232 280
129 3300026121 Ga0207683_10007259 Ga0207683_100072598 280
130 3300026142 Ga0207698_10073920 Ga0207698_100739202 280
131 3300042876 Ga0451577_0165267 Ga0451577_0165267_780_1664 280
132 3300044673 Ga0453683_0016610 Ga0453683_0016610_2059_2943 280
133 3300044712 Ga0453684_0263390 Ga0453684_0263390_946_1830 280
134 3300045051 Ga0451576_0062155 Ga0451576_0062155_124_1008 280
135 3300048911 Ga0496108_0005021 Ga0496108_0005021_7211_8110 280
136 3300048913 Ga0496110_0002625 Ga0496110_0002625_3362_4261 280
137 3300048914 Ga0496111_0057525 Ga0496111_0057525_1099_1998 280
138 3300048915 Ga0496112_0377056 Ga0496112_0377056_144_1043 280
139 3300050515 nmdc:mga0a205_279689_c1 nmdc:mga0a205_279689_c1_359_1240 280
140 3300005471 Ga0070698_100235784 Ga0070698_1002357842 281
141 3300005937 Ga0081455_10006241 Ga0081455_100062419 281
142 3300049572 Ga0501036_0114658 Ga0501036_0114658_94_987 281
143 3300049575 Ga0501039_0009182 Ga0501039_0009182_1908_2801 281
144 3300049576 Ga0501040_0014334 Ga0501040_0014334_1197_2090 281
145 3300049577 Ga0501041_0005149 Ga0501041_0005149_1602_2495 281
146 3300049578 Ga0501042_0001736 Ga0501042_0001736_9393_10286 281
147 3300049579 Ga0501043_0061296 Ga0501043_0061296_527_1420 281
148 3300049580 Ga0501046_0000526 Ga0501046_0000526_1143_2036 281
149 3300049581 Ga0501047_0044990 Ga0501047_0044990_1542_2435 281
150 3300049582 Ga0501048_0046790 Ga0501048_0046790_1169_2062 281
151 3300049583 Ga0501067_0065105 Ga0501067_0065105_505_1404 281
152 3300049587 Ga0501071_0074510 Ga0501071_0074510_656_1549 281
153 3300049588 Ga0501072_0069551 Ga0501072_0069551_1600_2493 281
154 3300049591 Ga0501075_0021678 Ga0501075_0021678_2627_3520 281
155 3300049592 Ga0501076_0058924 Ga0501076_0058924_1317_2210 281
156 3300049593 Ga0501077_0042963 Ga0501077_0042963_1133_2026 281
157 3300049741 Ga0501079_0000917 Ga0501079_0000917_13738_14631 281
158 3300049742 Ga0501080_0042517 Ga0501080_0042517_942_1835 281
159 3300049743 Ga0501081_0007001 Ga0501081_0007001_1184_2077 281
160 3300049822 Ga0501035_0333346 Ga0501035_0333346_273_1166 281
161 3300049824 Ga0501045_0000387 Ga0501045_0000387_18372_19265 281
162 3300054114 Ga0501084_0004620 Ga0501084_0004620_5246_6139 281
163 3300060353 Ga0501082_0007493 Ga0501082_0007493_1164_2057 281
164 3300060353 Ga0501082_0277829 Ga0501082_0277829_450_1343 281
165 3300009094 Ga0111539_10302487 Ga0111539_103024871 282
166 3300035172 Ga0373955_0071399 Ga0373955_0071399_410_1306 282
167 3300035410 Ga0373924_0004192 Ga0373924_0004192_3779_4675 282
168 3300035724 Ga0373933_0001890 Ga0373933_0001890_191_1087 282
169 3300045976 Ga0466967_0015112 Ga0466967_0015112_1007_1918 282
170 3300026075 Ga0207708_10149160 Ga0207708_101491603 283
171 3300027907 Ga0207428_10228278 Ga0207428_102282782 283
172 3300046615 Ga0495656_0005384 Ga0495656_0005384_26_940 283
173 3300050511 nmdc:mga08y16_88172_c1 nmdc:mga08y16_88172_c1_173_1099 283
174 3300005445 Ga0070708_100318212 Ga0070708_1003182122 284
175 3300009147 Ga0114129_10802243 Ga0114129_108022431 284
176 3300032002 Ga0307416_100064068 Ga0307416_1000640682 284
177 3300032002 Ga0307416_100277750 Ga0307416_1002777502 284
178 3300049522 Ga0501299_003674 Ga0501299_003674_926_1831 284
179 3300049668 Ga0501233_036131 Ga0501233_036131_110_1015 284
180 3300049669 Ga0501235_009670 Ga0501235_009670_535_1440 284
181 3300050515 nmdc:mga0a205_218677_c1 nmdc:mga0a205_218677_c1_720_1631 284
182 3300005336 Ga0070680_100016572 Ga0070680_1000165727 285
183 3300005353 Ga0070669_100370718 Ga0070669_1003707181 285
184 3300006852 Ga0075433_10003626 Ga0075433_100036265 285
185 3300009098 Ga0105245_10001077 Ga0105245_1000107717 285
186 3300009148 Ga0105243_10000508 Ga0105243_1000050834 285
187 3300009177 Ga0105248_10352371 Ga0105248_103523712 285
188 3300009553 Ga0105249_10004637 Ga0105249_100046377 285
189 3300013297 Ga0157378_10000714 Ga0157378_1000071417 285
190 3300013308 Ga0157375_10245384 Ga0157375_102453842 285
191 3300014745 Ga0157377_10182315 Ga0157377_101823152 285
192 3300014969 Ga0157376_10020785 Ga0157376_100207853 285
193 3300035691 Ga0373931_0008118 Ga0373931_0008118_1035_1940 285
194 3300042876 Ga0451577_0139125 Ga0451577_0139125_281_1180 285
195 3300045051 Ga0451576_0011180 Ga0451576_0011180_6829_7728 285
196 3300050513 nmdc:mga0rr50_88527_c1 nmdc:mga0rr50_88527_c1_489_1403 285
197 3300050514 nmdc:mga08x19_74744_c1 nmdc:mga08x19_74744_c1_813_1727 285
198 3300050515 nmdc:mga0a205_46297_c1 nmdc:mga0a205_46297_c1_489_1403 285
199 3300005328 Ga0070676_10068779 Ga0070676_100687793 286
200 3300005331 Ga0070670_100127205 Ga0070670_1001272053 286
201 3300005334 Ga0068869_100000136 Ga0068869_10000013616 286
202 3300005336 Ga0070680_100000125 Ga0070680_10000012516 286
203 3300005337 Ga0070682_100000189 Ga0070682_10000018941 286
204 3300005338 Ga0068868_100053284 Ga0068868_1000532842 286
205 3300005339 Ga0070660_100001383 Ga0070660_10000138314 286
206 3300005340 Ga0070689_100009703 Ga0070689_1000097033 286
207 3300005341 Ga0070691_10025299 Ga0070691_100252993 286
208 3300005344 Ga0070661_100001580 Ga0070661_10000158015 286
209 3300005366 Ga0070659_100000654 Ga0070659_1000006547 286
210 3300005406 Ga0070703_10002746 Ga0070703_100027463 286
211 3300005406 Ga0070703_10025416 Ga0070703_100254161 286
212 3300005440 Ga0070705_100029182 Ga0070705_1000291823 286
213 3300005444 Ga0070694_100000248 Ga0070694_10000024822 286
214 3300005444 Ga0070694_100070795 Ga0070694_1000707952 286
215 3300005445 Ga0070708_100148088 Ga0070708_1001480883 286
216 3300005455 Ga0070663_100027659 Ga0070663_1000276593 286
217 3300005457 Ga0070662_100012746 Ga0070662_1000127464 286
218 3300005458 Ga0070681_10005555 Ga0070681_1000555511 286
219 3300005459 Ga0068867_100021905 Ga0068867_1000219053 286
220 3300005530 Ga0070679_100023995 Ga0070679_1000239958 286
221 3300005539 Ga0068853_100003423 Ga0068853_1000034237 286
222 3300005543 Ga0070672_100038612 Ga0070672_1000386123 286
223 3300005545 Ga0070695_100027024 Ga0070695_1000270242 286
224 3300005546 Ga0070696_100000114 Ga0070696_10000011411 286
225 3300005547 Ga0070693_100000119 Ga0070693_1000001193 286
226 3300005549 Ga0070704_100000769 Ga0070704_1000007691 286
227 3300005563 Ga0068855_100000315 Ga0068855_10000031539 286
228 3300005564 Ga0070664_100028520 Ga0070664_1000285204 286
229 3300005577 Ga0068857_100002336 Ga0068857_10000233610 286
230 3300005578 Ga0068854_100004237 Ga0068854_1000042373 286
231 3300005614 Ga0068856_100010613 Ga0068856_1000106134 286
232 3300005615 Ga0070702_100022920 Ga0070702_1000229204 286
233 3300005616 Ga0068852_100167092 Ga0068852_1001670922 286
234 3300005617 Ga0068859_100008108 Ga0068859_1000081089 286
235 3300005618 Ga0068864_100039691 Ga0068864_1000396913 286
236 3300005719 Ga0068861_100112243 Ga0068861_1001122432 286
237 3300005840 Ga0068870_10001528 Ga0068870_100015282 286
238 3300005842 Ga0068858_100199251 Ga0068858_1001992512 286
239 3300005843 Ga0068860_100330825 Ga0068860_1003308252 286
240 3300005844 Ga0068862_100095963 Ga0068862_1000959632 286
241 3300006844 Ga0075428_100707462 Ga0075428_1007074622 286
242 3300006852 Ga0075433_10129833 Ga0075433_101298332 286
243 3300006871 Ga0075434_100167057 Ga0075434_1001670572 286
244 3300006914 Ga0075436_100091616 Ga0075436_1000916163 286
245 3300006931 Ga0097620_100008107 Ga0097620_1000081079 286
246 3300007265 Ga0099794_10006410 Ga0099794_100064104 286
247 3300009147 Ga0114129_10059177 Ga0114129_100591776 286
248 3300009174 Ga0105241_10013593 Ga0105241_100135934 286
249 3300011119 Ga0105246_10236606 Ga0105246_102366061 286
250 3300013100 Ga0157373_10001185 Ga0157373_100011856 286
251 3300013102 Ga0157371_10098715 Ga0157371_100987153 286
252 3300013104 Ga0157370_10249714 Ga0157370_102497142 286
253 3300013105 Ga0157369_10004085 Ga0157369_100040853 286
254 3300013297 Ga0157378_10273649 Ga0157378_102736492 286
255 3300013307 Ga0157372_10004865 Ga0157372_1000486515 286
256 3300014325 Ga0163163_10090117 Ga0163163_100901173 286
257 3300014497 Ga0182008_10064267 Ga0182008_100642672 286
258 3300015262 Ga0182007_10023877 Ga0182007_100238772 286
259 3300025885 Ga0207653_10003370 Ga0207653_100033703 286
260 3300025907 Ga0207645_10005247 Ga0207645_100052477 286
261 3300025908 Ga0207643_10000296 Ga0207643_1000029617 286
262 3300025911 Ga0207654_10025012 Ga0207654_100250122 286
263 3300025912 Ga0207707_10000443 Ga0207707_1000044327 286
264 3300025917 Ga0207660_10002832 Ga0207660_1000283213 286
265 3300025919 Ga0207657_10000095 Ga0207657_1000009543 286
266 3300025920 Ga0207649_10023423 Ga0207649_100234232 286
267 3300025922 Ga0207646_10169847 Ga0207646_101698472 286
268 3300025923 Ga0207681_10085841 Ga0207681_100858412 286
269 3300025925 Ga0207650_10009474 Ga0207650_100094743 286
270 3300025932 Ga0207690_10133301 Ga0207690_101333012 286
271 3300025933 Ga0207706_10001514 Ga0207706_100015143 286
272 3300025936 Ga0207670_10045286 Ga0207670_100452864 286
273 3300025940 Ga0207691_10052557 Ga0207691_100525573 286
274 3300025942 Ga0207689_10000121 Ga0207689_1000012119 286
275 3300025945 Ga0207679_10048224 Ga0207679_100482244 286
276 3300025949 Ga0207667_10153262 Ga0207667_101532621 286
277 3300025960 Ga0207651_10033315 Ga0207651_100333153 286
278 3300025981 Ga0207640_10069822 Ga0207640_100698223 286
279 3300026023 Ga0207677_10052636 Ga0207677_100526363 286
280 3300026035 Ga0207703_10159728 Ga0207703_101597282 286
281 3300026041 Ga0207639_10004035 Ga0207639_100040358 286
282 3300026067 Ga0207678_10103762 Ga0207678_101037622 286
283 3300026078 Ga0207702_10408726 Ga0207702_104087262 286
284 3300026089 Ga0207648_10002571 Ga0207648_100025713 286
285 3300026095 Ga0207676_10061393 Ga0207676_100613931 286
286 3300026116 Ga0207674_10000307 Ga0207674_1000030717 286
287 3300027876 Ga0209974_10070956 Ga0209974_100709561 286
288 3300028380 Ga0268265_10039644 Ga0268265_100396443 286
289 3300028381 Ga0268264_10168991 Ga0268264_101689912 286
290 3300035085 Ga0373929_0009791 Ga0373929_0009791_343_1260 286
291 3300035090 Ga0373949_0007534 Ga0373949_0007534_89_1006 286
292 3300035121 Ga0373960_0015943 Ga0373960_0015943_885_1802 286
293 3300035241 Ga0373961_0015152 Ga0373961_0015152_172_1089 286
294 3300042438 Ga0439459_0002732 Ga0439459_0002732_1227_2144 286
295 3300042876 Ga0451577_0005046 Ga0451577_0005046_1188_2105 286
296 3300042876 Ga0451577_0129831 Ga0451577_0129831_148_1065 286
297 3300045051 Ga0451576_0006407 Ga0451576_0006407_686_1603 286
298 3300045051 Ga0451576_0059352 Ga0451576_0059352_1473_2393 286
299 3300045051 Ga0451576_0376136 Ga0451576_0376136_220_1137 286
300 3300046472 Ga0495580_0070767 Ga0495580_0070767_1049_1969 286
301 3300048905 Ga0496102_0152604 Ga0496102_0152604_49_966 286
302 3300050507 nmdc:mga05p37_348906_c1 nmdc:mga05p37_348906_c1_391_1308 286
303 3300050512 nmdc:mga0n895_235853_c1 nmdc:mga0n895_235853_c1_813_1730 286
304 3300050512 nmdc:mga0n895_98912_c1 nmdc:mga0n895_98912_c1_1836_2753 286
305 3300050515 nmdc:mga0a205_161571_c1 nmdc:mga0a205_161571_c1_1035_1952 286
306 3300005467 Ga0070706_100020186 Ga0070706_1000201862 287
307 3300005468 Ga0070707_100032615 Ga0070707_1000326152 287
308 3300005471 Ga0070698_100013021 Ga0070698_1000130212 287
309 3300005536 Ga0070697_100014600 Ga0070697_1000146006 287
310 3300006173 Ga0070716_100062453 Ga0070716_1000624532 287
311 3300006173 Ga0070716_100157976 Ga0070716_1001579761 287
312 3300006844 Ga0075428_100028947 Ga0075428_1000289475 287
313 3300006847 Ga0075431_100030375 Ga0075431_1000303753 287
314 3300006852 Ga0075433_10030096 Ga0075433_100300967 287
315 3300006880 Ga0075429_100061009 Ga0075429_1000610093 287
316 3300006914 Ga0075436_100047451 Ga0075436_1000474511 287
317 3300009094 Ga0111539_10063797 Ga0111539_100637975 287
318 3300009147 Ga0114129_10150641 Ga0114129_101506413 287
319 3300009553 Ga0105249_10109271 Ga0105249_101092711 287
320 3300025939 Ga0207665_10013049 Ga0207665_100130494 287
321 3300027907 Ga0207428_10015350 Ga0207428_100153503 287
322 3300044712 Ga0453684_0093828 Ga0453684_0093828_90_1016 287
323 3300046664 Ga0495659_0121441 Ga0495659_0121441_68_1003 287
324 3300050507 nmdc:mga05p37_41356_c1 nmdc:mga05p37_41356_c1_4404_5324 287
325 3300050507 nmdc:mga05p37_44160_c1 nmdc:mga05p37_44160_c1_1233_2150 287
326 3300050512 nmdc:mga0n895_113884_c1 nmdc:mga0n895_113884_c1_1778_2698 287
327 3300050515 nmdc:mga0a205_159970_c1 nmdc:mga0a205_159970_c1_1189_2124 287
328 3300005440 Ga0070705_100271582 Ga0070705_1002715821 288
329 3300005544 Ga0070686_100018143 Ga0070686_1000181434 288
330 3300006237 Ga0097621_100023939 Ga0097621_1000239394 288
331 3300031731 Ga0307405_10140278 Ga0307405_101402781 288
332 3300031824 Ga0307413_10115426 Ga0307413_101154263 288
333 3300031852 Ga0307410_10131505 Ga0307410_101315051 288
334 3300031911 Ga0307412_10045555 Ga0307412_100455555 288
335 3300032002 Ga0307416_100040765 Ga0307416_1000407653 288
336 3300034957 Ga0373938_0039920 Ga0373938_0039920_72_968 288
337 3300035691 Ga0373931_0013394 Ga0373931_0013394_2003_2899 288
338 3300046476 Ga0495662_0042285 Ga0495662_0042285_739_1647 289
339 3300046511 Ga0495608_0017221 Ga0495608_0017221_2778_3686 289
340 3300046535 Ga0495586_0028808 Ga0495586_0028808_224_1132 289
341 3300046543 Ga0495645_0089276 Ga0495645_0089276_583_1491 289
342 3300046559 Ga0495667_0039689 Ga0495667_0039689_1401_2309 289
343 3300046689 Ga0495613_0075590 Ga0495613_0075590_311_1219 289
344 3300047317 Ga0495604_0102763 Ga0495604_0102763_232_1140 289
345 3300053077 Ga0495601_0071087 Ga0495601_0071087_311_1219 289
346 3300005330 Ga0070690_100022598 Ga0070690_1000225983 290
347 3300006852 Ga0075433_10007931 Ga0075433_100079319 290
348 3300006871 Ga0075434_100002226 Ga0075434_1000022269 290
349 3300006914 Ga0075436_100002173 Ga0075436_10000217317 290
350 3300007076 Ga0075435_100000806 Ga0075435_10000080617 290
351 3300009094 Ga0111539_10091260 Ga0111539_100912604 290
352 3300050511 nmdc:mga08y16_103066_c1 nmdc:mga08y16_103066_c1_1739_2662 290
353 3300050512 nmdc:mga0n895_14255_c1 nmdc:mga0n895_14255_c1_772_1695 290
354 3300050513 nmdc:mga0rr50_49413_c1 nmdc:mga0rr50_49413_c1_1985_2908 290
355 3300050514 nmdc:mga08x19_16770_c1 nmdc:mga08x19_16770_c1_1857_2780 290
356 3300050515 nmdc:mga0a205_22313_c1 nmdc:mga0a205_22313_c1_772_1695 290
357 3300005937 Ga0081455_10000601 Ga0081455_1000060134 291
358 3300006173 Ga0070716_100001154 Ga0070716_10000115411 291
359 3300006914 Ga0075436_100173879 Ga0075436_1001738792 291
360 3300025939 Ga0207665_10007315 Ga0207665_100073156 291
361 3300050514 nmdc:mga08x19_9328_c1 nmdc:mga08x19_9328_c1_2879_3796 291
362 3300005468 Ga0070707_100494389 Ga0070707_1004943891 292
363 3300007076 Ga0075435_100417319 Ga0075435_1004173192 292
364 3300007265 Ga0099794_10018238 Ga0099794_100182381 292
365 3300009147 Ga0114129_10000730 Ga0114129_1000073045 293
366 3300025911 Ga0207654_10084278 Ga0207654_100842782 293
367 3300035083 Ga0373926_0017853 Ga0373926_0017853_572_1540 293
368 3300035116 Ga0373945_0050553 Ga0373945_0050553_341_1309 293
369 3300035170 Ga0373943_0131804 Ga0373943_0131804_329_1297 293
370 3300035692 Ga0373935_0254281 Ga0373935_0254281_180_1148 293
371 3300045051 Ga0451576_0007141 Ga0451576_0007141_4219_5145 293
372 3300046499 Ga0495594_0044714 Ga0495594_0044714_237_1205 293
373 3300047321 Ga0495676_0305194 Ga0495676_0305194_31_957 293
374 3300050507 nmdc:mga05p37_319257_c1 nmdc:mga05p37_319257_c1_542_1510 293
375 3300050507 nmdc:mga05p37_606533_c1 nmdc:mga05p37_606533_c1_87_1157 293
376 3300050507 nmdc:mga05p37_9963_c1 nmdc:mga05p37_9963_c1_1794_2720 293
377 3300050508 nmdc:mga09592_21699_c1 nmdc:mga09592_21699_c1_985_1953 293
378 3300050508 nmdc:mga09592_506_c1 nmdc:mga09592_506_c1_8012_8938 293
379 3300050510 nmdc:mga06r32_184055_c1 nmdc:mga06r32_184055_c1_721_1647 293
380 3300050510 nmdc:mga06r32_28562_c1 nmdc:mga06r32_28562_c1_2038_3006 293
381 3300050511 nmdc:mga08y16_150125_c1 nmdc:mga08y16_150125_c1_1348_2274 293
382 3300050511 nmdc:mga08y16_16845_c1 nmdc:mga08y16_16845_c1_3706_4674 293
383 3300050515 nmdc:mga0a205_246399_c1 nmdc:mga0a205_246399_c1_526_1452 293
384 3300005445 Ga0070708_100464657 Ga0070708_1004646571 294
385 3300005518 Ga0070699_100039648 Ga0070699_1000396484 294
386 3300005546 Ga0070696_100009753 Ga0070696_1000097535 294
387 3300006914 Ga0075436_100006027 Ga0075436_1000060276 294
388 3300009176 Ga0105242_10000746 Ga0105242_1000074624 294
389 3300010375 Ga0105239_10017858 Ga0105239_100178583 294
390 3300025922 Ga0207646_10557791 Ga0207646_105577911 294
391 3300034816 Ga0373930_0001189 Ga0373930_0001189_1728_2654 294
392 3300035083 Ga0373926_0004693 Ga0373926_0004693_1782_2711 294
393 3300035084 Ga0373928_0003602 Ga0373928_0003602_1220_2146 294
394 3300035088 Ga0373940_0009277 Ga0373940_0009277_1237_2163 294
395 3300035112 Ga0373932_0004419 Ga0373932_0004419_1119_2045 294
396 3300035114 Ga0373939_0009085 Ga0373939_0009085_174_1100 294
397 3300035116 Ga0373945_0006055 Ga0373945_0006055_2803_3732 294
398 3300035691 Ga0373931_0000901 Ga0373931_0000901_1199_2125 294
399 3300035695 Ga0373927_0030971 Ga0373927_0030971_1962_2891 294
400 3300035725 Ga0373947_0006446 Ga0373947_0006446_3592_4521 294
401 3300045051 Ga0451576_0008099 Ga0451576_0008099_2172_3098 294
402 3300046531 Ga0495665_0102698 Ga0495665_0102698_546_1475 294
403 3300046664 Ga0495659_0126327 Ga0495659_0126327_42_956 294
404 3300046674 Ga0495588_0075654 Ga0495588_0075654_34_963 294
405 3300046683 Ga0495658_0003979 Ga0495658_0003979_472_1401 294
406 3300049585 Ga0501069_0117603 Ga0501069_0117603_150_1076 294
407 3300050514 nmdc:mga08x19_21181_c1 nmdc:mga08x19_21181_c1_1159_2085 294
408 3300039438 Ga0436360_1095714 Ga0436360_1095714_558_1502 299
409 3300005295 Ga0065707_10013851 Ga0065707_100138511 300
410 3300005334 Ga0068869_100000362 Ga0068869_10000036216 300
411 3300005337 Ga0070682_100005691 Ga0070682_1000056912 300
412 3300005338 Ga0068868_100003571 Ga0068868_1000035715 300
413 3300005340 Ga0070689_100012506 Ga0070689_1000125067 300
414 3300005341 Ga0070691_10000756 Ga0070691_1000075618 300
415 3300005343 Ga0070687_100001869 Ga0070687_1000018692 300
416 3300005345 Ga0070692_10019995 Ga0070692_100199952 300
417 3300005354 Ga0070675_100184726 Ga0070675_1001847262 300
418 3300005406 Ga0070703_10005900 Ga0070703_100059002 300
419 3300005438 Ga0070701_10000076 Ga0070701_100000767 300
420 3300005440 Ga0070705_100003134 Ga0070705_1000031342 300
421 3300005441 Ga0070700_100000605 Ga0070700_10000060510 300
422 3300005444 Ga0070694_100000270 Ga0070694_1000002702 300
423 3300005458 Ga0070681_10023396 Ga0070681_100233964 300
424 3300005459 Ga0068867_100000406 Ga0068867_10000040617 300
425 3300005530 Ga0070679_100101310 Ga0070679_1001013103 300
426 3300005544 Ga0070686_100004039 Ga0070686_1000040392 300
427 3300005545 Ga0070695_100002250 Ga0070695_1000022502 300
428 3300005546 Ga0070696_100001321 Ga0070696_10000132118 300
429 3300005547 Ga0070693_100000483 Ga0070693_10000048321 300
430 3300005549 Ga0070704_100000068 Ga0070704_10000006831 300
431 3300005563 Ga0068855_100002155 Ga0068855_10000215512 300
432 3300005578 Ga0068854_100014574 Ga0068854_1000145743 300
433 3300005614 Ga0068856_100013069 Ga0068856_1000130697 300
434 3300005615 Ga0070702_100000140 Ga0070702_10000014022 300
435 3300005617 Ga0068859_100000543 Ga0068859_10000054334 300
436 3300005718 Ga0068866_10000166 Ga0068866_1000016622 300
437 3300005719 Ga0068861_100002341 Ga0068861_1000023412 300
438 3300005841 Ga0068863_100158316 Ga0068863_1001583162 300
439 3300005841 Ga0068863_100359349 Ga0068863_1003593492 300
440 3300005842 Ga0068858_100001484 Ga0068858_10000148418 300
441 3300005843 Ga0068860_100005557 Ga0068860_10000555718 300
442 3300005844 Ga0068862_100004960 Ga0068862_10000496018 300
443 3300006237 Ga0097621_100000836 Ga0097621_10000083621 300
444 3300006358 Ga0068871_100001789 Ga0068871_1000017895 300
445 3300006847 Ga0075431_100563675 Ga0075431_1005636752 300
446 3300006881 Ga0068865_100000254 Ga0068865_10000025417 300
447 3300006931 Ga0097620_100000543 Ga0097620_10000054334 300
448 3300025885 Ga0207653_10012545 Ga0207653_100125452 300
449 3300025899 Ga0207642_10005820 Ga0207642_100058203 300
450 3300025903 Ga0207680_10091171 Ga0207680_100911712 300
451 3300025912 Ga0207707_10069976 Ga0207707_100699762 300
452 3300025917 Ga0207660_10000830 Ga0207660_1000083018 300
453 3300025918 Ga0207662_10000364 Ga0207662_100003648 300
454 3300025921 Ga0207652_10023639 Ga0207652_100236392 300
455 3300025926 Ga0207659_10138056 Ga0207659_101380562 300
456 3300025927 Ga0207687_10002931 Ga0207687_1000293111 300
457 3300025933 Ga0207706_10172175 Ga0207706_101721752 300
458 3300025934 Ga0207686_10000852 Ga0207686_1000085212 300
459 3300025935 Ga0207709_10003152 Ga0207709_1000315211 300
460 3300025936 Ga0207670_10003105 Ga0207670_1000310512 300
461 3300025938 Ga0207704_10004527 Ga0207704_100045272 300
462 3300025942 Ga0207689_10001501 Ga0207689_1000150119 300
463 3300025949 Ga0207667_10018908 Ga0207667_100189082 300
464 3300026023 Ga0207677_10001272 Ga0207677_1000127210 300
465 3300026035 Ga0207703_10006646 Ga0207703_1000664614 300
466 3300026075 Ga0207708_10000327 Ga0207708_1000032732 300
467 3300026078 Ga0207702_10277242 Ga0207702_102772422 300
468 3300026089 Ga0207648_10000706 Ga0207648_1000070634 300
469 3300026118 Ga0207675_100000616 Ga0207675_10000061631 300
470 3300028380 Ga0268265_10011375 Ga0268265_100113752 300
471 3300028381 Ga0268264_10001855 Ga0268264_1000185519 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01972

SDH_sah

Serine dehydrogenase proteinase

61

345

0.97

PF00574

CLP_protease

Clp protease

104

210

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l6w-assembly1.cif.gz_A carboxyltransferase subunit (accd6) of mycobacterium tuberculosis acetyl-coa carboxylase 0.8131 71 154
1y7o-assembly1.cif.gz_A the structure of streptococcus pneumoniae a153p clpp 0.7882 43 251
5ini-assembly1.cif.gz_A structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics 0.769 71 154
5inf-assembly1.cif.gz_F structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics 0.7667 71 154
5inf-assembly1.cif.gz_A structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics 0.7658 71 154
ID Description Score Start End Superfamily
af_Q58890_51_250_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.946 47 246 3.90.226.10
af_Q58890_51_250_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9369 47 246 3.90.226.10
4lk5B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8107 74 154 3.90.226.10
3p5mE01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8028 78 165 3.90.226.10
5iniB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7684 71 154 3.90.226.10
ID Description Score Start End GO Terms
AF-X0XVQ9-F1-model_v4 Serine protease 0.9491 36 256 GO:0016020
AF-A0A7V0JRC4-F1-model_v4 Serine protease 0.9294 35 270 GO:0016020
AF-A0A099T3D4-F1-model_v4 Serine protease 0.9252 38 274 GO:0016020
AF-A0A0P7ZFL6-F1-model_v4 Serine dehydrogenase proteinase 0.9239 35 272 GO:0016020
AF-X0XVQ9-F1-model_v4 Serine protease 0.9132 36 256 GO:0016020

Feature Viewer

pLDDT pTM Quality
77.45 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map