F450645

General Info

Members Datasets Scaffolds Average Seq Length
471 223 942 167

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0579643|Ga0451577_0579643_198_767
Length 189
Sequence MAGRLSRDFREGRTSAMQLDLTRFHQGINHFSRTLQPDEVGQDGEAYRIVEPVRVDAEIHKDKERFRIAGTVNTRLELGCSRCLEPFTLPIDSAFDLQYLPAEAEAGSRGDDDREVSEDDFDASVYRDDQIDLNELLREQFYLALPMKPLCREDCAGLCPQCGTNRNTGTCACVSQWEDPRLAPLKRLK

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
158 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
199 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
207 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
208 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
209 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
210 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
211 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
212 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
213 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
214 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
215 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 13.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0579643 3300042876 Bacteria 1018
2 SwRhRL2b_contig_1301945 2162886007 Bacteria 958
3 2214781051 2209111006 Unclassified 762
4 ARCol0yngRDRAFT_1004611 3300000652 Unclassified 1000
5 JGI24746J21847_1001820 3300001977 Bacteria 3414
6 JGI24750J21931_1017787 3300002070 Unclassified 974
7 JGI24749J21850_1004204 3300002076 Bacteria 2013
8 JGI25406J46586_10000430 3300003203 Bacteria 19367
9 JGI25406J46586_10001699 3300003203 Bacteria 10354
10 Ga0058859_10008873 3300004798 Unclassified 670
11 Ga0065714_10125230 3300005288 Bacteria 1303
12 Ga0065704_10081630 3300005289 Bacteria 3726
13 Ga0065704_10311583 3300005289 Bacteria 867
14 Ga0065715_10008640 3300005293 Bacteria 2897
15 Ga0065715_10157191 3300005293 Bacteria 1652
16 Ga0065715_10230032 3300005293 Bacteria 1237
17 Ga0065715_10265010 3300005293 Bacteria 1127
18 Ga0065715_10502000 3300005293 Unclassified 779
19 Ga0065707_10003678 3300005295 Bacteria 3820
20 Ga0065707_10119309 3300005295 Bacteria 2163
21 Ga0065707_10248598 3300005295 Bacteria 1132
22 Ga0070658_10423505 3300005327 Bacteria 1145
23 Ga0070676_10001880 3300005328 Bacteria 10669
24 Ga0070676_10080909 3300005328 Bacteria 1970
25 Ga0070690_100089625 3300005330 Bacteria 2023
26 Ga0070690_100114195 3300005330 Bacteria 1805
27 Ga0070670_100005984 3300005331 Bacteria 10294
28 Ga0070670_100028204 3300005331 Bacteria 4831
29 Ga0070677_10001081 3300005333 Bacteria 8788
30 Ga0070677_10041557 3300005333 Bacteria 1816
31 Ga0070677_10081784 3300005333 Bacteria 1383
32 Ga0070677_10147007 3300005333 Unclassified 1093
33 Ga0068869_100168861 3300005334 Bacteria 1708
34 Ga0070666_10004789 3300005335 Bacteria 8274
35 Ga0070682_100298404 3300005337 Bacteria 1181
36 Ga0070689_100108698 3300005340 Bacteria 2203
37 Ga0070691_10183332 3300005341 Bacteria 1091
38 Ga0070687_100009746 3300005343 Bacteria 4127
39 Ga0070687_100384460 3300005343 Bacteria 916
40 Ga0070661_100057941 3300005344 Bacteria 2838
41 Ga0070661_100082015 3300005344 Bacteria 2382
42 Ga0070661_100495563 3300005344 Unclassified 977
43 Ga0070692_10085141 3300005345 Bacteria 1710
44 Ga0070692_10123695 3300005345 Bacteria 1446
45 Ga0070668_100103849 3300005347 Bacteria 2255
46 Ga0070668_100110242 3300005347 Bacteria 2190
47 Ga0070669_100000448 3300005353 Bacteria 31480
48 Ga0070669_100030163 3300005353 Bacteria 3912
49 Ga0070669_100068526 3300005353 Bacteria 2619
50 Ga0070669_100683990 3300005353 Bacteria 865
51 Ga0070669_100955482 3300005353 Unclassified 734
52 Ga0070675_100000062 3300005354 Bacteria 66400
53 Ga0070675_100013127 3300005354 Bacteria 6509
54 Ga0070675_100026207 3300005354 Bacteria 4677
55 Ga0070675_100123625 3300005354 Bacteria 2200
56 Ga0070675_100146321 3300005354 Bacteria 2023
57 Ga0070675_100218991 3300005354 Unclassified 1657
58 Ga0070675_100322817 3300005354 Bacteria 1364
59 Ga0070675_100400799 3300005354 Bacteria 1224
60 Ga0070671_100105962 3300005355 Bacteria 2359
61 Ga0070671_100253756 3300005355 Bacteria 1494
62 Ga0070674_100238840 3300005356 Bacteria 1421
63 Ga0070674_100345493 3300005356 Bacteria 1200
64 Ga0070673_100332485 3300005364 Unclassified 1345
65 Ga0070688_100006709 3300005365 Bacteria 6167
66 Ga0070688_100380548 3300005365 Unclassified 1040
67 Ga0070659_100019710 3300005366 Bacteria 5117
68 Ga0070667_100033391 3300005367 Bacteria 4300
69 Ga0070667_100804005 3300005367 Unclassified 873
70 Ga0070713_100024605 3300005436 Bacteria 4694
71 Ga0070701_10001039 3300005438 Bacteria 10122
72 Ga0070701_10013420 3300005438 Bacteria 3727
73 Ga0070701_10092515 3300005438 Bacteria 1659
74 Ga0070705_100002490 3300005440 Bacteria 9255
75 Ga0070705_100081787 3300005440 Bacteria 1985
76 Ga0070705_100260450 3300005440 Bacteria 1223
77 Ga0070705_101100684 3300005440 Unclassified 650
78 Ga0070700_100046142 3300005441 Bacteria 2691
79 Ga0070700_100283867 3300005441 Bacteria 1201
80 Ga0070694_100004064 3300005444 Bacteria 8771
81 Ga0070694_100122004 3300005444 Bacteria 1871
82 Ga0070694_100140681 3300005444 Bacteria 1753
83 Ga0070694_100270693 3300005444 Bacteria 1292
84 Ga0070694_100516601 3300005444 Bacteria 952
85 Ga0070708_100213839 3300005445 Bacteria 1807
86 Ga0070678_100010941 3300005456 Bacteria 5568
87 Ga0070678_100244947 3300005456 Unclassified 1501
88 Ga0070678_100747205 3300005456 Unclassified 884
89 Ga0070662_100063245 3300005457 Bacteria 2706
90 Ga0070662_100146822 3300005457 Bacteria 1832
91 Ga0070681_10043029 3300005458 Bacteria 4525
92 Ga0068867_100000717 3300005459 Bacteria 22125
93 Ga0068867_100058320 3300005459 Bacteria 2861
94 Ga0070685_10040346 3300005466 Bacteria 2656
95 Ga0070707_100219783 3300005468 Bacteria 1851
96 Ga0070698_100001657 3300005471 Bacteria 24844
97 Ga0070698_100150517 3300005471 Bacteria 2275
98 Ga0070698_100202574 3300005471 Bacteria 1920
99 Ga0070698_100711524 3300005471 Bacteria 947
100 Ga0070699_100000611 3300005518 Bacteria 33730
101 Ga0070699_100051256 3300005518 Bacteria 3573
102 Ga0070699_100123184 3300005518 Bacteria 2281
103 Ga0070699_100160333 3300005518 Bacteria 1990
104 Ga0070699_100279860 3300005518 Bacteria 1494
105 Ga0070679_100154501 3300005530 Bacteria 2270
106 Ga0070679_100387191 3300005530 Bacteria 1345
107 Ga0070697_100062973 3300005536 Bacteria 3028
108 Ga0070697_101434565 3300005536 Unclassified 617
109 Ga0068853_101330938 3300005539 Bacteria 694
110 Ga0070672_100011873 3300005543 Bacteria 6087
111 Ga0070672_100115555 3300005543 Bacteria 2191
112 Ga0070672_100174764 3300005543 Unclassified 1787
113 Ga0070695_100000171 3300005545 Bacteria 30974
114 Ga0070696_100000124 3300005546 Bacteria 40765
115 Ga0070696_100276544 3300005546 Bacteria 1278
116 Ga0070665_100067217 3300005548 Bacteria 3594
117 Ga0070665_101624302 3300005548 Unclassified 654
118 Ga0070704_100000145 3300005549 Bacteria 26912
119 Ga0070704_100114196 3300005549 Bacteria 2061
120 Ga0070704_100707592 3300005549 Unclassified 894
121 Ga0070704_100763529 3300005549 Unclassified 862
122 Ga0070664_100001279 3300005564 Bacteria 20137
123 Ga0068857_100008715 3300005577 Bacteria 8780
124 Ga0068857_100052688 3300005577 Bacteria 3609
125 Ga0068854_100058595 3300005578 Bacteria 2781
126 Ga0070702_100079636 3300005615 Bacteria 1958
127 Ga0070702_100420251 3300005615 Unclassified 962
128 Ga0068859_100032806 3300005617 Bacteria 5217
129 Ga0068859_100067141 3300005617 Bacteria 3621
130 Ga0068859_100082750 3300005617 Bacteria 3252
131 Ga0068864_100024688 3300005618 Bacteria 5056
132 Ga0068864_100167903 3300005618 Bacteria 1999
133 Ga0068864_100314161 3300005618 Bacteria 1470
134 Ga0068864_100924535 3300005618 Unclassified 862
135 Ga0068864_101370648 3300005618 Unclassified 708
136 Ga0068861_100002821 3300005719 Bacteria 11425
137 Ga0068861_100521207 3300005719 Bacteria 1078
138 Ga0068863_100011298 3300005841 Bacteria 8647
139 Ga0068863_100229691 3300005841 Bacteria 1789
140 Ga0068858_100008840 3300005842 Bacteria 9661
141 Ga0068858_100300349 3300005842 Bacteria 1532
142 Ga0068860_100018175 3300005843 Bacteria 6843
143 Ga0068860_100025169 3300005843 Bacteria 5743
144 Ga0068862_100000905 3300005844 Bacteria 28737
145 Ga0068862_100006321 3300005844 Bacteria 9850
146 Ga0081539_10000122 3300005985 Bacteria 183393
147 Ga0081539_10000251 3300005985 Bacteria 125220
148 Ga0081539_10001218 3300005985 Bacteria 45966
149 Ga0070717_10150043 3300006028 Bacteria 2016
150 Ga0075432_10111884 3300006058 Bacteria 1018
151 Ga0097621_100055359 3300006237 Bacteria 3239
152 Ga0097621_100278393 3300006237 Bacteria 1472
153 Ga0068871_100092867 3300006358 Bacteria 2517
154 Ga0068871_100172076 3300006358 Bacteria 1857
155 Ga0068871_100253674 3300006358 Bacteria 1533
156 Ga0068871_100482169 3300006358 Bacteria 1116
157 Ga0075428_100002392 3300006844 Bacteria 20368
158 Ga0075428_100009840 3300006844 Bacteria 10626
159 Ga0075428_100018315 3300006844 Bacteria 7742
160 Ga0075428_100061889 3300006844 Bacteria 4099
161 Ga0075430_100010664 3300006846 Bacteria 7787
162 Ga0075430_100020320 3300006846 Bacteria 5650
163 Ga0075430_100113436 3300006846 Bacteria 2259
164 Ga0075430_100120644 3300006846 Bacteria 2186
165 Ga0075431_100023079 3300006847 Bacteria 6361
166 Ga0075431_100126648 3300006847 Bacteria 2635
167 Ga0075433_10000117 3300006852 Bacteria 39826
168 Ga0075433_10010140 3300006852 Bacteria 7554
169 Ga0075433_10024700 3300006852 Bacteria 5075
170 Ga0075433_10030090 3300006852 Bacteria 4631
171 Ga0075433_10408953 3300006852 Bacteria 1197
172 Ga0075433_10703287 3300006852 Unclassified 885
173 Ga0075434_100010983 3300006871 Bacteria 8518
174 Ga0075434_100021873 3300006871 Bacteria 6224
175 Ga0075434_100022339 3300006871 Bacteria 6162
176 Ga0075434_100327943 3300006871 Bacteria 1551
177 Ga0075434_100662503 3300006871 Bacteria 1062
178 Ga0075429_100079460 3300006880 Bacteria 2859
179 Ga0075429_100181292 3300006880 Bacteria 1845
180 Ga0075429_100775071 3300006880 Unclassified 840
181 Ga0068865_100055299 3300006881 Bacteria 2761
182 Ga0068865_100219320 3300006881 Bacteria 1486
183 Ga0097620_100032806 3300006931 Bacteria 5217
184 Ga0097620_100067142 3300006931 Bacteria 3621
185 Ga0097620_100082743 3300006931 Bacteria 3252
186 Ga0075435_100042100 3300007076 Bacteria 3652
187 Ga0075435_100071355 3300007076 Bacteria 2836
188 Ga0075435_100149553 3300007076 Bacteria 1962
189 Ga0075435_101092911 3300007076 Unclassified 697
190 Ga0105240_10020153 3300009093 Bacteria 8901
191 Ga0111539_10000325 3300009094 Bacteria 58382
192 Ga0111539_10007219 3300009094 Bacteria 14239
193 Ga0111539_10010856 3300009094 Bacteria 11461
194 Ga0111539_10011286 3300009094 Bacteria 11223
195 Ga0111539_10490796 3300009094 Bacteria 1430
196 Ga0105245_10249248 3300009098 Bacteria 1725
197 Ga0114129_10006014 3300009147 Bacteria 17199
198 Ga0114129_10046246 3300009147 Bacteria 6117
199 Ga0114129_10197013 3300009147 Bacteria 2731
200 Ga0114129_10321542 3300009147 Bacteria 2057
201 Ga0114129_10325262 3300009147 Bacteria 2043
202 Ga0114129_10421009 3300009147 Bacteria 1756
203 Ga0105243_10104602 3300009148 Bacteria 2357
204 Ga0105243_10494144 3300009148 Unclassified 1158
205 Ga0105243_11342141 3300009148 Unclassified 734
206 Ga0105242_10183715 3300009176 Bacteria 1846
207 Ga0105242_10497379 3300009176 Unclassified 1159
208 Ga0105248_10390531 3300009177 Bacteria 1567
209 Ga0105248_10561065 3300009177 Bacteria 1288
210 Ga0105249_10001171 3300009553 Bacteria 23227
211 Ga0105249_10425505 3300009553 Bacteria 1362
212 Ga0105249_10832662 3300009553 Bacteria 988
213 Ga0105249_11390084 3300009553 Unclassified 774
214 Ga0105246_10097834 3300011119 Bacteria 2130
215 Ga0105246_10370373 3300011119 Bacteria 1180
216 Ga0157369_11848149 3300013105 Unclassified 613
217 Ga0157374_10065333 3300013296 Bacteria 3416
218 Ga0157374_10176873 3300013296 Bacteria 2083
219 Ga0157374_10807885 3300013296 Bacteria 954
220 Ga0157374_11808874 3300013296 Bacteria 636
221 Ga0157378_10603339 3300013297 Bacteria 1109
222 Ga0163162_10021598 3300013306 Bacteria 6341
223 Ga0163162_10132417 3300013306 Bacteria 2602
224 Ga0163162_10585381 3300013306 Unclassified 1243
225 Ga0157375_10005199 3300013308 Bacteria 11294
226 Ga0157375_10010606 3300013308 Bacteria 8113
227 Ga0157375_10328807 3300013308 Bacteria 1693
228 Ga0163163_10366656 3300014325 Unclassified 1497
229 Ga0157380_10010898 3300014326 Bacteria 6554
230 Ga0157380_10484794 3300014326 Bacteria 1197
231 Ga0157380_10629153 3300014326 Unclassified 1067
232 Ga0157377_10001249 3300014745 Bacteria 10872
233 Ga0157377_10060325 3300014745 Bacteria 2165
234 Ga0157377_10659828 3300014745 Bacteria 754
235 Ga0157379_10168071 3300014968 Bacteria 1980
236 Ga0157379_10432389 3300014968 Bacteria 1213
237 Ga0157376_10029631 3300014969 Bacteria 4361
238 Ga0157376_10112379 3300014969 Bacteria 2400
239 Ga0157376_10752775 3300014969 Unclassified 983
240 Ga0163161_10005471 3300017792 Bacteria 8818
241 Ga0163161_10758118 3300017792 Bacteria 812
242 Ga0207673_1001773 3300025290 Bacteria 2396
243 Ga0207697_10000205 3300025315 Bacteria 31703
244 Ga0207697_10024465 3300025315 Bacteria 2472
245 Ga0207697_10132025 3300025315 Bacteria 1080
246 Ga0207653_10183374 3300025885 Unclassified 784
247 Ga0207682_10000463 3300025893 Bacteria 18777
248 Ga0207682_10095769 3300025893 Bacteria 1293
249 Ga0207688_10001136 3300025901 Bacteria 13709
250 Ga0207680_10305748 3300025903 Unclassified 1109
251 Ga0207645_10000604 3300025907 Bacteria 29721
252 Ga0207645_10106229 3300025907 Bacteria 1815
253 Ga0207643_10000334 3300025908 Bacteria 32146
254 Ga0207643_10006114 3300025908 Bacteria 6439
255 Ga0207643_10030948 3300025908 Bacteria 2982
256 Ga0207705_10265124 3300025909 Unclassified 1312
257 Ga0207705_10456183 3300025909 Bacteria 991
258 Ga0207695_10411893 3300025913 Bacteria 1236
259 Ga0207662_10013498 3300025918 Bacteria 4568
260 Ga0207662_10112499 3300025918 Bacteria 1699
261 Ga0207649_10308995 3300025920 Unclassified 1158
262 Ga0207649_10541785 3300025920 Bacteria 889
263 Ga0207652_10777091 3300025921 Bacteria 851
264 Ga0207652_10874282 3300025921 Viruses 795
265 Ga0207646_10028551 3300025922 Bacteria 5076
266 Ga0207646_10114778 3300025922 Bacteria 2418
267 Ga0207681_10013102 3300025923 Bacteria 5126
268 Ga0207681_10024959 3300025923 Bacteria 3841
269 Ga0207681_10031100 3300025923 Bacteria 3484
270 Ga0207681_10102080 3300025923 Bacteria 2070
271 Ga0207650_10022225 3300025925 Bacteria 4489
272 Ga0207650_10060047 3300025925 Bacteria 2837
273 Ga0207659_10000326 3300025926 Bacteria 28731
274 Ga0207659_10022772 3300025926 Bacteria 4174
275 Ga0207659_10024434 3300025926 Bacteria 4048
276 Ga0207659_10136977 3300025926 Bacteria 1896
277 Ga0207659_10298721 3300025926 Bacteria 1322
278 Ga0207659_10465305 3300025926 Bacteria 1067
279 Ga0207706_10008688 3300025933 Bacteria 9357
280 Ga0207706_10016908 3300025933 Bacteria 6580
281 Ga0207709_10617829 3300025935 Bacteria 860
282 Ga0207670_10089542 3300025936 Bacteria 2172
283 Ga0207669_10165766 3300025937 Bacteria 1567
284 Ga0207704_10021765 3300025938 Bacteria 3422
285 Ga0207704_10069145 3300025938 Bacteria 2230
286 Ga0207704_10573951 3300025938 Bacteria 920
287 Ga0207691_10011123 3300025940 Bacteria 8637
288 Ga0207691_10038256 3300025940 Bacteria 4439
289 Ga0207691_10151107 3300025940 Bacteria 2042
290 Ga0207691_10546279 3300025940 Bacteria 982
291 Ga0207689_10000493 3300025942 Bacteria 37382
292 Ga0207689_10304702 3300025942 Bacteria 1321
293 Ga0207679_10037498 3300025945 Bacteria 3446
294 Ga0207679_10263882 3300025945 Bacteria 1470
295 Ga0207667_10726776 3300025949 Bacteria 994
296 Ga0207651_10047519 3300025960 Bacteria 2894
297 Ga0207651_10447184 3300025960 Bacteria 1108
298 Ga0207712_10003379 3300025961 Bacteria 10090
299 Ga0207712_10184551 3300025961 Bacteria 1641
300 Ga0207668_10011800 3300025972 Bacteria 5324
301 Ga0207668_10237641 3300025972 Bacteria 1472
302 Ga0207677_10043917 3300026023 Bacteria 2974
303 Ga0207703_10030037 3300026035 Bacteria 4292
304 Ga0207703_10124980 3300026035 Bacteria 2213
305 Ga0207703_10391982 3300026035 Bacteria 1287
306 Ga0207678_10876499 3300026067 Unclassified 793
307 Ga0207708_10162346 3300026075 Bacteria 1765
308 Ga0207708_10224932 3300026075 Bacteria 1505
309 Ga0207708_10663809 3300026075 Bacteria 888
310 Ga0207641_10002824 3300026088 Bacteria 15785
311 Ga0207641_10637146 3300026088 Bacteria 1046
312 Ga0207648_10037062 3300026089 Bacteria 4295
313 Ga0207676_10112459 3300026095 Bacteria 2281
314 Ga0207676_10136418 3300026095 Bacteria 2094
315 Ga0207676_10274777 3300026095 Bacteria 1527
316 Ga0207674_10139120 3300026116 Bacteria 2388
317 Ga0207675_100005255 3300026118 Bacteria 12453
318 Ga0207675_100265798 3300026118 Bacteria 1663
319 Ga0207683_10013130 3300026121 Bacteria 7066
320 Ga0207683_10096702 3300026121 Bacteria 2633
321 Ga0207683_10117705 3300026121 Bacteria 2383
322 Ga0207683_10171409 3300026121 Bacteria 1965
323 Ga0207428_10000236 3300027907 Bacteria 75764
324 Ga0207428_10001679 3300027907 Bacteria 22860
325 Ga0207428_10001725 3300027907 Bacteria 22383
326 Ga0268266_10193857 3300028379 Bacteria 1856
327 Ga0268265_10000073 3300028380 Bacteria 128856
328 Ga0268265_10011824 3300028380 Bacteria 5901
329 Ga0268264_10070352 3300028381 Bacteria 2962
330 Ga0268264_10204866 3300028381 Bacteria 1807
331 Ga0268264_10270782 3300028381 Bacteria 1586
332 Ga0268264_10950361 3300028381 Bacteria 865
333 Ga0307408_100355470 3300031548 Bacteria 1244
334 Ga0307405_10080880 3300031731 Bacteria 2122
335 Ga0307410_10037242 3300031852 Bacteria 3175
336 Ga0307410_10087781 3300031852 Bacteria 2201
337 Ga0307406_10657888 3300031901 Bacteria 870
338 Ga0307407_10009292 3300031903 Bacteria 4569
339 Ga0307407_10280718 3300031903 Bacteria 1153
340 Ga0307412_10033686 3300031911 Bacteria 3258
341 Ga0307412_10178663 3300031911 Bacteria 1594
342 Ga0307409_100012291 3300031995 Bacteria 5449
343 Ga0307416_100034539 3300032002 Bacteria 3849
344 Ga0307414_10042457 3300032004 Bacteria 3090
345 Ga0307414_10266287 3300032004 Bacteria 1433
346 Ga0307411_10127039 3300032005 Bacteria 1856
347 Ga0307411_10207876 3300032005 Bacteria 1509
348 Ga0307411_10636317 3300032005 Bacteria 922
349 Ga0307411_11362887 3300032005 Bacteria 648
350 Ga0307415_100021271 3300032126 Bacteria 3983
351 Ga0373958_0075955 3300034819 Unclassified 753
352 Ga0373959_0014843 3300034820 Unclassified 1423
353 Ga0373938_0099010 3300034957 Unclassified 730
354 Ga0373928_0106832 3300035084 Unclassified 736
355 Ga0373951_0013648 3300035091 Bacteria 1825
356 Ga0373932_0004060 3300035112 Bacteria 3480
357 Ga0373932_0060549 3300035112 Bacteria 1149
358 Ga0373939_0015708 3300035114 Bacteria 1986
359 Ga0373939_0027911 3300035114 Bacteria 1603
360 Ga0373941_0035997 3300035115 Bacteria 1503
361 Ga0373960_0012287 3300035121 Bacteria 2126
362 Ga0373962_0035422 3300035242 Bacteria 1386
363 Ga0373962_0173390 3300035242 Unclassified 717
364 Ga0373924_0084096 3300035410 Bacteria 1356
365 Ga0373931_0013690 3300035691 Bacteria 3954
366 Ga0373935_0167538 3300035692 Bacteria 1501
367 Ga0373937_0045551 3300036401 Bacteria 4009
368 Ga0439450_004834 3300042008 Bacteria 2330
369 Ga0439434_0144649 3300042435 Bacteria 785
370 Ga0439464_0027345 3300042439 Unclassified 1586
371 Ga0451577_0123896 3300042876 Unclassified 2316
372 Ga0451576_0011830 3300045051 Bacteria 9877
373 Ga0451576_0026240 3300045051 Bacteria 6267
374 Ga0451576_0595071 3300045051 Unclassified 1162
375 Ga0451576_0697669 3300045051 Unclassified 1066
376 Ga0495603_0192056 3300046455 Bacteria 1181
377 Ga0495653_0642083 3300046463 Unclassified 649
378 Ga0495580_0690789 3300046472 Bacteria 668
379 Ga0495582_0055401 3300046473 Bacteria 2186
380 Ga0495582_0188537 3300046473 Unclassified 1176
381 Ga0495584_0027492 3300046491 Bacteria 2883
382 Ga0495607_0306931 3300046501 Bacteria 745
383 Ga0495644_0048564 3300046523 Bacteria 1594
384 Ga0495663_0174216 3300046525 Bacteria 743
385 Ga0495663_0197585 3300046525 Bacteria 701
386 Ga0495642_0044545 3300046528 Bacteria 1811
387 Ga0495598_0016363 3300046537 Bacteria 1891
388 Ga0495598_0042350 3300046537 Unclassified 1336
389 Ga0495609_0039274 3300046538 Bacteria 2132
390 Ga0495609_0127593 3300046538 Bacteria 1091
391 Ga0495621_0000460 3300046539 Bacteria 9968
392 Ga0495621_0002101 3300046539 Bacteria 5281
393 Ga0495621_0046481 3300046539 Unclassified 1540
394 Ga0495621_0068145 3300046539 Bacteria 1305
395 Ga0495633_0023592 3300046558 Bacteria 3047
396 Ga0495633_0260188 3300046558 Unclassified 791
397 Ga0495659_0005886 3300046664 Bacteria 3874
398 Ga0495659_0015877 3300046664 Bacteria 2479
399 Ga0495659_0034709 3300046664 Bacteria 1775
400 Ga0495659_0054082 3300046664 Bacteria 1468
401 Ga0495659_0093425 3300046664 Bacteria 1157
402 Ga0495647_0040894 3300046681 Bacteria 1764
403 Ga0495658_0050730 3300046683 Bacteria 2348
404 Ga0495658_0220505 3300046683 Bacteria 1187
405 Ga0495669_0051725 3300046684 Bacteria 1844
406 Ga0495669_0064126 3300046684 Bacteria 1667
407 Ga0495669_0107107 3300046684 Bacteria 1303
408 Ga0495636_0011703 3300047318 Bacteria 3475
409 Ga0495636_0024856 3300047318 Bacteria 2431
410 Ga0495636_0267372 3300047318 Bacteria 794
411 Ga0495676_0043335 3300047321 Bacteria 3685
412 Ga0495677_0173482 3300047445 Bacteria 835
413 Ga0495593_0250022 3300047673 Bacteria 888
414 Ga0496106_0073146 3300048909 Bacteria 2622
415 Ga0496106_0403660 3300048909 Unclassified 1098
416 Ga0496109_0281229 3300048912 Bacteria 1568
417 Ga0501296_007347 3300049519 Bacteria 1263
418 Ga0501299_007014 3300049522 Bacteria 1783
419 Ga0501067_0033419 3300049583 Bacteria 2854
420 Ga0501068_0051929 3300049584 Bacteria 2481
421 Ga0501069_0110480 3300049585 Bacteria 1565
422 Ga0501071_1129461 3300049587 Unclassified 605
423 Ga0501073_0207204 3300049589 Bacteria 1355
424 Ga0501075_0992730 3300049591 Unclassified 638
425 Ga0501214_051566 3300049659 Bacteria 627
426 Ga0501233_137449 3300049668 Bacteria 672
427 Ga0501243_025778 3300049675 Bacteria 987
428 Ga0501249_023047 3300049679 Bacteria 1365
429 Ga0501256_033996 3300049685 Unclassified 585
430 Ga0501225_0027179 3300049705 Bacteria 1574
431 Ga0501245_013353 3300049708 Bacteria 1215
432 Ga0501263_038860 3300049760 Bacteria 694
433 Ga0501273_051843 3300049770 Unclassified 629
434 Ga0501204_053406 3300049850 Bacteria 625
435 nmdc:mga05p37_127440_c1 3300050507 Bacteria 3125
436 nmdc:mga05p37_154378_c1 3300050507 Bacteria 2806
437 nmdc:mga05p37_161312_c1 3300050507 Bacteria 2738
438 nmdc:mga05p37_422619_c1 3300050507 Bacteria 1551
439 nmdc:mga05p37_495914_c1 3300050507 Bacteria 1403
440 nmdc:mga05p37_709650_c1 3300050507 Bacteria 1116
441 nmdc:mga09592_132728_c1 3300050508 Bacteria 2144
442 nmdc:mga09592_14841_c1 3300050508 Bacteria 6360
443 nmdc:mga09592_259831_c1 3300050508 Bacteria 1506
444 nmdc:mga09592_491268_c1 3300050508 Bacteria 1057
445 nmdc:mga09592_50285_c1 3300050508 Bacteria 3516
446 nmdc:mga0qj67_126413_c1 3300050509 Bacteria 2069
447 nmdc:mga0qj67_19605_c1 3300050509 Bacteria 5169
448 nmdc:mga0qj67_6509_c1 3300050509 Bacteria 8581
449 nmdc:mga06r32_185029_c1 3300050510 Bacteria 2070
450 nmdc:mga06r32_26371_c1 3300050510 Bacteria 5417
451 nmdc:mga08y16_1194126_c1 3300050511 Unclassified 732
452 nmdc:mga08y16_12673_c1 3300050511 Bacteria 8870
453 nmdc:mga08y16_132557_c1 3300050511 Bacteria 2591
454 nmdc:mga08y16_16162_c1 3300050511 Bacteria 7846
455 nmdc:mga08y16_38491_c1 3300050511 Bacteria 5022
456 nmdc:mga0n895_15313_c1 3300050512 Bacteria 6987
457 nmdc:mga0n895_208549_c1 3300050512 Bacteria 1985
458 nmdc:mga0n895_378623_c1 3300050512 Unclassified 1432
459 nmdc:mga0n895_604114_c1 3300050512 Bacteria 1099
460 nmdc:mga0n895_693_c1 3300050512 Bacteria 23625
461 nmdc:mga0rr50_10441_c1 3300050513 Bacteria 5891
462 nmdc:mga0rr50_225831_c1 3300050513 Unclassified 1548
463 nmdc:mga0rr50_574121_c1 3300050513 Unclassified 961
464 nmdc:mga0rr50_60871_c1 3300050513 Bacteria 2842
465 nmdc:mga0rr50_831383_c1 3300050513 Bacteria 788
466 nmdc:mga0rr50_9301_c1 3300050513 Bacteria 6172
467 nmdc:mga0a205_1202_c1 3300050515 Bacteria 21664
468 nmdc:mga0a205_135037_c1 3300050515 Bacteria 2367
469 nmdc:mga0a205_2224_c1 3300050515 Bacteria 17074
470 nmdc:mga0a205_32033_c1 3300050515 Bacteria 3171
471 nmdc:mga0a205_81907_c1 3300050515 Bacteria 3118
472 Ga0451577_0579643
473 SwRhRL2b_contig_1301945
474 2214781051
475 ARCol0yngRDRAFT_1004611
476 JGI24746J21847_1001820
477 JGI24750J21931_1017787
478 JGI24749J21850_1004204
479 JGI25406J46586_10000430
480 JGI25406J46586_10001699
481 Ga0058859_10008873
482 Ga0065714_10125230
483 Ga0065704_10081630
484 Ga0065704_10311583
485 Ga0065715_10008640
486 Ga0065715_10157191
487 Ga0065715_10230032
488 Ga0065715_10265010
489 Ga0065715_10502000
490 Ga0065707_10003678
491 Ga0065707_10119309
492 Ga0065707_10248598
493 Ga0070658_10423505
494 Ga0070676_10001880
495 Ga0070676_10080909
496 Ga0070690_100089625
497 Ga0070690_100114195
498 Ga0070670_100005984
499 Ga0070670_100028204
500 Ga0070677_10001081
501 Ga0070677_10041557
502 Ga0070677_10081784
503 Ga0070677_10147007
504 Ga0068869_100168861
505 Ga0070666_10004789
506 Ga0070682_100298404
507 Ga0070689_100108698
508 Ga0070691_10183332
509 Ga0070687_100009746
510 Ga0070687_100384460
511 Ga0070661_100057941
512 Ga0070661_100082015
513 Ga0070661_100495563
514 Ga0070692_10085141
515 Ga0070692_10123695
516 Ga0070668_100103849
517 Ga0070668_100110242
518 Ga0070669_100000448
519 Ga0070669_100030163
520 Ga0070669_100068526
521 Ga0070669_100683990
522 Ga0070669_100955482
523 Ga0070675_100000062
524 Ga0070675_100013127
525 Ga0070675_100026207
526 Ga0070675_100123625
527 Ga0070675_100146321
528 Ga0070675_100218991
529 Ga0070675_100322817
530 Ga0070675_100400799
531 Ga0070671_100105962
532 Ga0070671_100253756
533 Ga0070674_100238840
534 Ga0070674_100345493
535 Ga0070673_100332485
536 Ga0070688_100006709
537 Ga0070688_100380548
538 Ga0070659_100019710
539 Ga0070667_100033391
540 Ga0070667_100804005
541 Ga0070713_100024605
542 Ga0070701_10001039
543 Ga0070701_10013420
544 Ga0070701_10092515
545 Ga0070705_100002490
546 Ga0070705_100081787
547 Ga0070705_100260450
548 Ga0070705_101100684
549 Ga0070700_100046142
550 Ga0070700_100283867
551 Ga0070694_100004064
552 Ga0070694_100122004
553 Ga0070694_100140681
554 Ga0070694_100270693
555 Ga0070694_100516601
556 Ga0070708_100213839
557 Ga0070678_100010941
558 Ga0070678_100244947
559 Ga0070678_100747205
560 Ga0070662_100063245
561 Ga0070662_100146822
562 Ga0070681_10043029
563 Ga0068867_100000717
564 Ga0068867_100058320
565 Ga0070685_10040346
566 Ga0070707_100219783
567 Ga0070698_100001657
568 Ga0070698_100150517
569 Ga0070698_100202574
570 Ga0070698_100711524
571 Ga0070699_100000611
572 Ga0070699_100051256
573 Ga0070699_100123184
574 Ga0070699_100160333
575 Ga0070699_100279860
576 Ga0070679_100154501
577 Ga0070679_100387191
578 Ga0070697_100062973
579 Ga0070697_101434565
580 Ga0068853_101330938
581 Ga0070672_100011873
582 Ga0070672_100115555
583 Ga0070672_100174764
584 Ga0070695_100000171
585 Ga0070696_100000124
586 Ga0070696_100276544
587 Ga0070665_100067217
588 Ga0070665_101624302
589 Ga0070704_100000145
590 Ga0070704_100114196
591 Ga0070704_100707592
592 Ga0070704_100763529
593 Ga0070664_100001279
594 Ga0068857_100008715
595 Ga0068857_100052688
596 Ga0068854_100058595
597 Ga0070702_100079636
598 Ga0070702_100420251
599 Ga0068859_100032806
600 Ga0068859_100067141
601 Ga0068859_100082750
602 Ga0068864_100024688
603 Ga0068864_100167903
604 Ga0068864_100314161
605 Ga0068864_100924535
606 Ga0068864_101370648
607 Ga0068861_100002821
608 Ga0068861_100521207
609 Ga0068863_100011298
610 Ga0068863_100229691
611 Ga0068858_100008840
612 Ga0068858_100300349
613 Ga0068860_100018175
614 Ga0068860_100025169
615 Ga0068862_100000905
616 Ga0068862_100006321
617 Ga0081539_10000122
618 Ga0081539_10000251
619 Ga0081539_10001218
620 Ga0070717_10150043
621 Ga0075432_10111884
622 Ga0097621_100055359
623 Ga0097621_100278393
624 Ga0068871_100092867
625 Ga0068871_100172076
626 Ga0068871_100253674
627 Ga0068871_100482169
628 Ga0075428_100002392
629 Ga0075428_100009840
630 Ga0075428_100018315
631 Ga0075428_100061889
632 Ga0075430_100010664
633 Ga0075430_100020320
634 Ga0075430_100113436
635 Ga0075430_100120644
636 Ga0075431_100023079
637 Ga0075431_100126648
638 Ga0075433_10000117
639 Ga0075433_10010140
640 Ga0075433_10024700
641 Ga0075433_10030090
642 Ga0075433_10408953
643 Ga0075433_10703287
644 Ga0075434_100010983
645 Ga0075434_100021873
646 Ga0075434_100022339
647 Ga0075434_100327943
648 Ga0075434_100662503
649 Ga0075429_100079460
650 Ga0075429_100181292
651 Ga0075429_100775071
652 Ga0068865_100055299
653 Ga0068865_100219320
654 Ga0097620_100032806
655 Ga0097620_100067142
656 Ga0097620_100082743
657 Ga0075435_100042100
658 Ga0075435_100071355
659 Ga0075435_100149553
660 Ga0075435_101092911
661 Ga0105240_10020153
662 Ga0111539_10000325
663 Ga0111539_10007219
664 Ga0111539_10010856
665 Ga0111539_10011286
666 Ga0111539_10490796
667 Ga0105245_10249248
668 Ga0114129_10006014
669 Ga0114129_10046246
670 Ga0114129_10197013
671 Ga0114129_10321542
672 Ga0114129_10325262
673 Ga0114129_10421009
674 Ga0105243_10104602
675 Ga0105243_10494144
676 Ga0105243_11342141
677 Ga0105242_10183715
678 Ga0105242_10497379
679 Ga0105248_10390531
680 Ga0105248_10561065
681 Ga0105249_10001171
682 Ga0105249_10425505
683 Ga0105249_10832662
684 Ga0105249_11390084
685 Ga0105246_10097834
686 Ga0105246_10370373
687 Ga0157369_11848149
688 Ga0157374_10065333
689 Ga0157374_10176873
690 Ga0157374_10807885
691 Ga0157374_11808874
692 Ga0157378_10603339
693 Ga0163162_10021598
694 Ga0163162_10132417
695 Ga0163162_10585381
696 Ga0157375_10005199
697 Ga0157375_10010606
698 Ga0157375_10328807
699 Ga0163163_10366656
700 Ga0157380_10010898
701 Ga0157380_10484794
702 Ga0157380_10629153
703 Ga0157377_10001249
704 Ga0157377_10060325
705 Ga0157377_10659828
706 Ga0157379_10168071
707 Ga0157379_10432389
708 Ga0157376_10029631
709 Ga0157376_10112379
710 Ga0157376_10752775
711 Ga0163161_10005471
712 Ga0163161_10758118
713 Ga0207673_1001773
714 Ga0207697_10000205
715 Ga0207697_10024465
716 Ga0207697_10132025
717 Ga0207653_10183374
718 Ga0207682_10000463
719 Ga0207682_10095769
720 Ga0207688_10001136
721 Ga0207680_10305748
722 Ga0207645_10000604
723 Ga0207645_10106229
724 Ga0207643_10000334
725 Ga0207643_10006114
726 Ga0207643_10030948
727 Ga0207705_10265124
728 Ga0207705_10456183
729 Ga0207695_10411893
730 Ga0207662_10013498
731 Ga0207662_10112499
732 Ga0207649_10308995
733 Ga0207649_10541785
734 Ga0207652_10777091
735 Ga0207652_10874282
736 Ga0207646_10028551
737 Ga0207646_10114778
738 Ga0207681_10013102
739 Ga0207681_10024959
740 Ga0207681_10031100
741 Ga0207681_10102080
742 Ga0207650_10022225
743 Ga0207650_10060047
744 Ga0207659_10000326
745 Ga0207659_10022772
746 Ga0207659_10024434
747 Ga0207659_10136977
748 Ga0207659_10298721
749 Ga0207659_10465305
750 Ga0207706_10008688
751 Ga0207706_10016908
752 Ga0207709_10617829
753 Ga0207670_10089542
754 Ga0207669_10165766
755 Ga0207704_10021765
756 Ga0207704_10069145
757 Ga0207704_10573951
758 Ga0207691_10011123
759 Ga0207691_10038256
760 Ga0207691_10151107
761 Ga0207691_10546279
762 Ga0207689_10000493
763 Ga0207689_10304702
764 Ga0207679_10037498
765 Ga0207679_10263882
766 Ga0207667_10726776
767 Ga0207651_10047519
768 Ga0207651_10447184
769 Ga0207712_10003379
770 Ga0207712_10184551
771 Ga0207668_10011800
772 Ga0207668_10237641
773 Ga0207677_10043917
774 Ga0207703_10030037
775 Ga0207703_10124980
776 Ga0207703_10391982
777 Ga0207678_10876499
778 Ga0207708_10162346
779 Ga0207708_10224932
780 Ga0207708_10663809
781 Ga0207641_10002824
782 Ga0207641_10637146
783 Ga0207648_10037062
784 Ga0207676_10112459
785 Ga0207676_10136418
786 Ga0207676_10274777
787 Ga0207674_10139120
788 Ga0207675_100005255
789 Ga0207675_100265798
790 Ga0207683_10013130
791 Ga0207683_10096702
792 Ga0207683_10117705
793 Ga0207683_10171409
794 Ga0207428_10000236
795 Ga0207428_10001679
796 Ga0207428_10001725
797 Ga0268266_10193857
798 Ga0268265_10000073
799 Ga0268265_10011824
800 Ga0268264_10070352
801 Ga0268264_10204866
802 Ga0268264_10270782
803 Ga0268264_10950361
804 Ga0307408_100355470
805 Ga0307405_10080880
806 Ga0307410_10037242
807 Ga0307410_10087781
808 Ga0307406_10657888
809 Ga0307407_10009292
810 Ga0307407_10280718
811 Ga0307412_10033686
812 Ga0307412_10178663
813 Ga0307409_100012291
814 Ga0307416_100034539
815 Ga0307414_10042457
816 Ga0307414_10266287
817 Ga0307411_10127039
818 Ga0307411_10207876
819 Ga0307411_10636317
820 Ga0307411_11362887
821 Ga0307415_100021271
822 Ga0373958_0075955
823 Ga0373959_0014843
824 Ga0373938_0099010
825 Ga0373928_0106832
826 Ga0373951_0013648
827 Ga0373932_0004060
828 Ga0373932_0060549
829 Ga0373939_0015708
830 Ga0373939_0027911
831 Ga0373941_0035997
832 Ga0373960_0012287
833 Ga0373962_0035422
834 Ga0373962_0173390
835 Ga0373924_0084096
836 Ga0373931_0013690
837 Ga0373935_0167538
838 Ga0373937_0045551
839 Ga0439450_004834
840 Ga0439434_0144649
841 Ga0439464_0027345
842 Ga0451577_0123896
843 Ga0451576_0011830
844 Ga0451576_0026240
845 Ga0451576_0595071
846 Ga0451576_0697669
847 Ga0495603_0192056
848 Ga0495653_0642083
849 Ga0495580_0690789
850 Ga0495582_0055401
851 Ga0495582_0188537
852 Ga0495584_0027492
853 Ga0495607_0306931
854 Ga0495644_0048564
855 Ga0495663_0174216
856 Ga0495663_0197585
857 Ga0495642_0044545
858 Ga0495598_0016363
859 Ga0495598_0042350
860 Ga0495609_0039274
861 Ga0495609_0127593
862 Ga0495621_0000460
863 Ga0495621_0002101
864 Ga0495621_0046481
865 Ga0495621_0068145
866 Ga0495633_0023592
867 Ga0495633_0260188
868 Ga0495659_0005886
869 Ga0495659_0015877
870 Ga0495659_0034709
871 Ga0495659_0054082
872 Ga0495659_0093425
873 Ga0495647_0040894
874 Ga0495658_0050730
875 Ga0495658_0220505
876 Ga0495669_0051725
877 Ga0495669_0064126
878 Ga0495669_0107107
879 Ga0495636_0011703
880 Ga0495636_0024856
881 Ga0495636_0267372
882 Ga0495676_0043335
883 Ga0495677_0173482
884 Ga0495593_0250022
885 Ga0496106_0073146
886 Ga0496106_0403660
887 Ga0496109_0281229
888 Ga0501296_007347
889 Ga0501299_007014
890 Ga0501067_0033419
891 Ga0501068_0051929
892 Ga0501069_0110480
893 Ga0501071_1129461
894 Ga0501073_0207204
895 Ga0501075_0992730
896 Ga0501214_051566
897 Ga0501233_137449
898 Ga0501243_025778
899 Ga0501249_023047
900 Ga0501256_033996
901 Ga0501225_0027179
902 Ga0501245_013353
903 Ga0501263_038860
904 Ga0501273_051843
905 Ga0501204_053406
906 nmdc:mga05p37_127440_c1
907 nmdc:mga05p37_154378_c1
908 nmdc:mga05p37_161312_c1
909 nmdc:mga05p37_422619_c1
910 nmdc:mga05p37_495914_c1
911 nmdc:mga05p37_709650_c1
912 nmdc:mga09592_132728_c1
913 nmdc:mga09592_14841_c1
914 nmdc:mga09592_259831_c1
915 nmdc:mga09592_491268_c1
916 nmdc:mga09592_50285_c1
917 nmdc:mga0qj67_126413_c1
918 nmdc:mga0qj67_19605_c1
919 nmdc:mga0qj67_6509_c1
920 nmdc:mga06r32_185029_c1
921 nmdc:mga06r32_26371_c1
922 nmdc:mga08y16_1194126_c1
923 nmdc:mga08y16_12673_c1
924 nmdc:mga08y16_132557_c1
925 nmdc:mga08y16_16162_c1
926 nmdc:mga08y16_38491_c1
927 nmdc:mga0n895_15313_c1
928 nmdc:mga0n895_208549_c1
929 nmdc:mga0n895_378623_c1
930 nmdc:mga0n895_604114_c1
931 nmdc:mga0n895_693_c1
932 nmdc:mga0rr50_10441_c1
933 nmdc:mga0rr50_225831_c1
934 nmdc:mga0rr50_574121_c1
935 nmdc:mga0rr50_60871_c1
936 nmdc:mga0rr50_831383_c1
937 nmdc:mga0rr50_9301_c1
938 nmdc:mga0a205_1202_c1
939 nmdc:mga0a205_135037_c1
940 nmdc:mga0a205_2224_c1
941 nmdc:mga0a205_32033_c1
942 nmdc:mga0a205_81907_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

68

189

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iq0-assembly6.cif.gz_K crystal structure of hydrogen sulfide-bound superoxide dismutase in oxidized state 0.6122 31 57
2qk7-assembly1.cif.gz_A a covalent s-f heterodimer of staphylococcal gamma-hemolysin 0.5879 12 61
2z7z-assembly1.cif.gz_A crystal structure of h2o2 treated cu,zn-sod 0.5824 31 56
8iq1-assembly4.cif.gz_G crystal structure of hydrogen sulfide-bound superoxide dismutase in reduced state 0.5767 31 56
4p1y-assembly1.cif.gz_C crystal structure of staphylococcal gamma-hemolysin prepore 0.5692 12 61
ID Description Score Start End Superfamily
4oqeB02 Mainly Beta;Single Sheet;S-adenosyl-L-methionine-dependent methyltransferases;CAC2371-like domains 0.5845 10 82 2.20.130.10
3cyjD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.5831 10 56 3.30.390.10
af_A4IDS8_71_212_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5427 9 88 3.10.450.50
af_F4J6T7_705_857_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.5357 12 56 2.60.40.1180
4oqeB02 Mainly Beta;Single Sheet;S-adenosyl-L-methionine-dependent methyltransferases;CAC2371-like domains 0.5296 10 82 2.20.130.10
ID Description Score Start End GO Terms
AF-A0A7C7HA84-F1-model_v4 DUF177 domain-containing protein 0.9033 1 169
AF-A0A2V8QJ68-F1-model_v4 DUF177 domain-containing protein 0.9011 1 87
AF-A0A7C1VZV2-F1-model_v4 DUF177 domain-containing protein 0.8942 33 167
AF-A0A3N5NPB6-F1-model_v4 DUF177 domain-containing protein 0.8933 1 170
AF-A0A7C6B7T2-F1-model_v4 DUF177 domain-containing protein 0.8917 1 170

Map