F450630

General Info

Members Datasets Scaffolds Average Seq Length
471 169 940 99

Family's Representative Sequence

Representative Sequence 3300035242|Ga0373962_0191754|Ga0373962_0191754_238_588
Length 116
Sequence MRKLTACATTEAQMQMADALGMIETRGFAAMVEASDAMVKAAKVELVGYEKIGGGYVTAIVRGDVAAVKAATEAGARAAEAVGEVVSVHIIPRPHQNVDEALPLGRAGKMLAGVKK

Samples

Sample ID Description Type Environment
1 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
76 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
83 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
91 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
103 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
104 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
105 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
106 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
109 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
112 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 2.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.7
Rhizosphere 96.39
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373962_0191754 3300035242 Bacteria 688
2 Ga0070683_100480857 3300005329 Bacteria 1186
3 Ga0068868_100493770 3300005338 Bacteria 1071
4 Ga0070668_101683146 3300005347 Bacteria 582
5 Ga0070688_100680226 3300005365 Bacteria 795
6 Ga0070667_101566214 3300005367 Bacteria 619
7 Ga0070714_101989012 3300005435 Bacteria 567
8 Ga0070710_10265182 3300005437 Bacteria 1109
9 Ga0070701_10629777 3300005438 Bacteria 714
10 Ga0070701_10708335 3300005438 Bacteria 678
11 Ga0070705_100247897 3300005440 Bacteria 1248
12 Ga0070700_101313361 3300005441 Bacteria 608
13 Ga0068867_101084756 3300005459 Bacteria 730
14 Ga0068867_101309492 3300005459 Unclassified 669
15 Ga0068867_101887617 3300005459 Bacteria 563
16 Ga0070685_10397545 3300005466 Bacteria 954
17 Ga0070685_11282147 3300005466 Bacteria 559
18 Ga0070698_100245422 3300005471 Bacteria 1724
19 Ga0070698_101185384 3300005471 Bacteria 713
20 Ga0070699_101496641 3300005518 Bacteria 619
21 Ga0070684_100107130 3300005535 Bacteria 2503
22 Ga0070686_100868154 3300005544 Bacteria 732
23 Ga0070686_101091837 3300005544 Unclassified 658
24 Ga0070695_101102156 3300005545 Bacteria 650
25 Ga0070693_100270988 3300005547 Bacteria 1133
26 Ga0070704_100260418 3300005549 Bacteria 1428
27 Ga0070702_100858178 3300005615 Bacteria 707
28 Ga0068859_102104308 3300005617 Bacteria 623
29 Ga0068864_101588818 3300005618 Bacteria 658
30 Ga0068861_101978693 3300005719 Bacteria 581
31 Ga0068870_11217130 3300005840 Bacteria 546
32 Ga0068863_100920818 3300005841 Bacteria 875
33 Ga0068858_100380366 3300005842 Bacteria 1355
34 Ga0068860_100244928 3300005843 Bacteria 1744
35 Ga0070717_10005472 3300006028 Bacteria 9269
36 Ga0075430_100152494 3300006846 Bacteria 1924
37 Ga0075433_10436650 3300006852 Bacteria 1154
38 Ga0075433_10793884 3300006852 Bacteria 827
39 Ga0075434_101029741 3300006871 Bacteria 837
40 Ga0097620_100545053 3300006931 Bacteria 1255
41 Ga0097620_102104621 3300006931 Bacteria 623
42 Ga0075435_101739868 3300007076 Bacteria 547
43 Ga0075435_102048240 3300007076 Bacteria 503
44 Ga0111539_11192750 3300009094 Bacteria 884
45 Ga0105245_12252076 3300009098 Bacteria 599
46 Ga0114129_10753702 3300009147 Bacteria 1246
47 Ga0114129_10792981 3300009147 Bacteria 1209
48 Ga0114129_11735125 3300009147 Unclassified 761
49 Ga0105243_10315554 3300009148 Bacteria 1422
50 Ga0105243_10504215 3300009148 Bacteria 1147
51 Ga0105248_11788818 3300009177 Bacteria 697
52 Ga0105249_10145418 3300009553 Bacteria 2277
53 Ga0157379_11120760 3300014968 Bacteria 754
54 Ga0157376_11223218 3300014969 Bacteria 780
55 Ga0213872_10000134 3300021361 Bacteria 67449
56 Ga0207653_10418869 3300025885 Bacteria 525
57 Ga0207647_10656877 3300025904 Bacteria 574
58 Ga0207643_10845614 3300025908 Bacteria 593
59 Ga0207684_11397087 3300025910 Bacteria 573
60 Ga0207663_11128095 3300025916 Bacteria 631
61 Ga0207662_10289767 3300025918 Bacteria 1086
62 Ga0207681_11155245 3300025923 Bacteria 650
63 Ga0207650_10051299 3300025925 Bacteria 3053
64 Ga0207690_10806340 3300025932 Bacteria 776
65 Ga0207709_10075576 3300025935 Bacteria 2153
66 Ga0207670_10241011 3300025936 Bacteria 1393
67 Ga0207670_11091656 3300025936 Bacteria 673
68 Ga0207711_12142461 3300025941 Bacteria 502
69 Ga0207661_10421068 3300025944 Bacteria 1213
70 Ga0207661_11472760 3300025944 Bacteria 624
71 Ga0207679_11094592 3300025945 Bacteria 731
72 Ga0207651_11531706 3300025960 Bacteria 601
73 Ga0207658_10843925 3300025986 Bacteria 833
74 Ga0207703_11505038 3300026035 Bacteria 647
75 Ga0207703_12271812 3300026035 Bacteria 518
76 Ga0207678_10611713 3300026067 Bacteria 956
77 Ga0207708_10216131 3300026075 Bacteria 1534
78 Ga0207708_10980593 3300026075 Bacteria 734
79 Ga0207648_11089186 3300026089 Bacteria 749
80 Ga0207676_11368072 3300026095 Unclassified 704
81 Ga0265326_10207095 3300028558 Bacteria 563
82 Ga0265334_10147726 3300028573 Bacteria 830
83 Ga0265323_10057546 3300028653 Bacteria 1360
84 Ga0265338_10396544 3300028800 Bacteria 984
85 Ga0265330_10121963 3300031235 Bacteria 1110
86 Ga0265328_10022901 3300031239 Bacteria 2372
87 Ga0265340_10250182 3300031247 Bacteria 790
88 Ga0265316_10144938 3300031344 Bacteria 1781
89 Ga0307513_10006058 3300031456 Bacteria 15869
90 Ga0307509_10037640 3300031507 Bacteria 5288
91 Ga0316575_10004061 3300031665 Bacteria 5130
92 Ga0316575_10070637 3300031665 Bacteria 1402
93 Ga0316575_10553762 3300031665 Bacteria 502
94 Ga0316579_10004407 3300031691 Bacteria 5584
95 Ga0316579_10018698 3300031691 Bacteria 3053
96 Ga0316579_10044895 3300031691 Bacteria 2059
97 Ga0316579_10063066 3300031691 Bacteria 1746
98 Ga0316579_10068266 3300031691 Bacteria 1681
99 Ga0316579_10085436 3300031691 Bacteria 1505
100 Ga0316579_10124409 3300031691 Bacteria 1240
101 Ga0316579_10201603 3300031691 Bacteria 962
102 Ga0316579_10656940 3300031691 Bacteria 508
103 Ga0265342_10032091 3300031712 Bacteria 3241
104 Ga0316576_10004813 3300031727 Bacteria 8158
105 Ga0316576_10006534 3300031727 Bacteria 7266
106 Ga0316576_10013450 3300031727 Bacteria 5440
107 Ga0316576_10021198 3300031727 Bacteria 4490
108 Ga0316576_10031391 3300031727 Bacteria 3769
109 Ga0316576_10031769 3300031727 Bacteria 3749
110 Ga0316576_10057293 3300031727 Bacteria 2847
111 Ga0316576_10096216 3300031727 Bacteria 2210
112 Ga0316576_10199262 3300031727 Bacteria 1508
113 Ga0316576_10200012 3300031727 Bacteria 1505
114 Ga0316576_10233320 3300031727 Bacteria 1383
115 Ga0316576_10435811 3300031727 Bacteria 969
116 Ga0316576_10795108 3300031727 Bacteria 681
117 Ga0316578_10002455 3300031728 Bacteria 8146
118 Ga0316578_10011094 3300031728 Bacteria 4699
119 Ga0316578_10026361 3300031728 Bacteria 3278
120 Ga0316578_10043311 3300031728 Bacteria 2614
121 Ga0316578_10047816 3300031728 Bacteria 2497
122 Ga0316578_10129296 3300031728 Bacteria 1519
123 Ga0316578_10292937 3300031728 Bacteria 974
124 Ga0316577_10000307 3300031733 Bacteria 17909
125 Ga0316577_10015335 3300031733 Bacteria 4216
126 Ga0316577_10017688 3300031733 Bacteria 3938
127 Ga0316577_10019044 3300031733 Bacteria 3797
128 Ga0316577_10020445 3300031733 Unclassified 3668
129 Ga0316577_10037878 3300031733 Bacteria 2696
130 Ga0316577_10053218 3300031733 Bacteria 2259
131 Ga0316577_10086399 3300031733 Bacteria 1755
132 Ga0316577_10095725 3300031733 Unclassified 1663
133 Ga0316577_10139397 3300031733 Bacteria 1366
134 Ga0316577_10161650 3300031733 Bacteria 1263
135 Ga0316577_10172007 3300031733 Bacteria 1223
136 Ga0316577_10197892 3300031733 Bacteria 1136
137 Ga0316577_10208080 3300031733 Bacteria 1106
138 Ga0316577_10218319 3300031733 Bacteria 1078
139 Ga0316577_10411754 3300031733 Bacteria 768
140 Ga0316577_10818501 3300031733 Bacteria 528
141 Ga0307415_100090480 3300032126 Bacteria 2214
142 Ga0316583_10002684 3300032133 Bacteria 6216
143 Ga0316583_10006658 3300032133 Bacteria 4160
144 Ga0316585_10001861 3300032137 Bacteria 5636
145 Ga0316585_10003973 3300032137 Bacteria 4094
146 Ga0316585_10049131 3300032137 Bacteria 1352
147 Ga0316585_10075601 3300032137 Bacteria 1095
148 Ga0316585_10247108 3300032137 Unclassified 591
149 Ga0316580_10000139 3300032139 Bacteria 13948
150 Ga0316580_10077965 3300032139 Archaea 1014
151 Ga0316580_10114935 3300032139 Bacteria 824
152 Ga0316593_10001977 3300032168 Bacteria 4716
153 Ga0316593_10003487 3300032168 Bacteria 3912
154 Ga0316593_10023151 3300032168 Bacteria 1959
155 Ga0316593_10141947 3300032168 Bacteria 870
156 Ga0316593_10153547 3300032168 Bacteria 838
157 Ga0316593_10169838 3300032168 Bacteria 799
158 Ga0316593_10232421 3300032168 Bacteria 687
159 Ga0316592_1041236 3300033524 Unclassified 1022
160 Ga0316592_1081012 3300033524 Bacteria 738
161 Ga0316588_1116394 3300033528 Bacteria 675
162 Ga0316596_1030100 3300033541 Bacteria 1407
163 Ga0316596_1140233 3300033541 Bacteria 662
164 Ga0373926_0019499 3300035083 Bacteria 2338
165 Ga0373940_0156279 3300035088 Bacteria 730
166 Ga0373932_0082733 3300035112 Bacteria 1017
167 Ga0373936_0494660 3300035113 Bacteria 568
168 Ga0373961_0071667 3300035241 Bacteria 1073
169 Ga0316574_0033172 3300035398 Bacteria 3142
170 Ga0316574_0034546 3300035398 Bacteria 3084
171 Ga0316574_0069875 3300035398 Bacteria 2217
172 Ga0316574_0076734 3300035398 Bacteria 2117
173 Ga0316574_0212684 3300035398 Bacteria 1240
174 Ga0316574_0223008 3300035398 Bacteria 1208
175 Ga0316574_0225018 3300035398 Bacteria 1201
176 Ga0316574_0288908 3300035398 Bacteria 1044
177 Ga0316574_0296068 3300035398 Archaea 1030
178 Ga0316574_0307915 3300035398 Bacteria 1007
179 Ga0316574_0433939 3300035398 Unclassified 825
180 Ga0316574_0504403 3300035398 Bacteria 754
181 Ga0316574_0669451 3300035398 Bacteria 638
182 Ga0316574_0943020 3300035398 Bacteria 521
183 Ga0373931_0586493 3300035691 Bacteria 727
184 Ga0373927_0001874 3300035695 Bacteria 15553
185 Ga0373947_0404346 3300035725 Bacteria 921
186 Ga0373937_0368536 3300036401 Bacteria 1362
187 Ga0373937_0698574 3300036401 Bacteria 961
188 Ga0316582_0000064 3300036647 Bacteria 26472
189 Ga0316582_0025646 3300036647 Bacteria 3542
190 Ga0316582_0052573 3300036647 Bacteria 2589
191 Ga0316582_0066825 3300036647 Bacteria 2318
192 Ga0316582_0077326 3300036647 Bacteria 2166
193 Ga0316582_0100261 3300036647 Bacteria 1917
194 Ga0316582_0134627 3300036647 Bacteria 1662
195 Ga0316582_0172094 3300036647 Bacteria 1471
196 Ga0316582_0201067 3300036647 Unclassified 1359
197 Ga0316582_0305753 3300036647 Bacteria 1093
198 Ga0316582_0449477 3300036647 Unclassified 888
199 Ga0316582_0482236 3300036647 Bacteria 855
200 Ga0316582_0533142 3300036647 Bacteria 809
201 Ga0316582_0733437 3300036647 Bacteria 678
202 Ga0316582_0915535 3300036647 Unclassified 600
203 Ga0316582_1015864 3300036647 Bacteria 566
204 Ga0316582_1150910 3300036647 Bacteria 528
205 Ga0316584_0000625 3300036712 Bacteria 19191
206 Ga0316584_0005731 3300036712 Bacteria 8369
207 Ga0316584_0006277 3300036712 Bacteria 8049
208 Ga0316584_0006708 3300036712 Bacteria 7808
209 Ga0316584_0016586 3300036712 Bacteria 5282
210 Ga0316584_0018723 3300036712 Bacteria 4998
211 Ga0316584_0025608 3300036712 Unclassified 4329
212 Ga0316584_0030630 3300036712 Bacteria 3974
213 Ga0316584_0050774 3300036712 Bacteria 3101
214 Ga0316584_0077263 3300036712 Bacteria 2494
215 Ga0316584_0082780 3300036712 Bacteria 2404
216 Ga0316584_0084393 3300036712 Bacteria 2379
217 Ga0316584_0087652 3300036712 Bacteria 2330
218 Ga0316584_0132220 3300036712 Bacteria 1864
219 Ga0316584_0214750 3300036712 Bacteria 1415
220 Ga0316584_0331191 3300036712 Unclassified 1096
221 Ga0316584_0463940 3300036712 Bacteria 894
222 Ga0316584_0576431 3300036712 Bacteria 783
223 Ga0316584_0610143 3300036712 Bacteria 756
224 Ga0316584_0770909 3300036712 Unclassified 655
225 Ga0316584_0864179 3300036712 Bacteria 611
226 Ga0316584_0872608 3300036712 Bacteria 607
227 Ga0316584_0964010 3300036712 Bacteria 571
228 Ga0373925_0000146 3300037068 Bacteria 75193
229 Ga0316581_0000538 3300037588 Bacteria 7388
230 Ga0316581_0014552 3300037588 Bacteria 2241
231 Ga0316581_0016492 3300037588 Bacteria 2121
232 Ga0316581_0017502 3300037588 Bacteria 2070
233 Ga0316581_0058104 3300037588 Bacteria 1186
234 Ga0316581_0282768 3300037588 Bacteria 509
235 Ga0400490_04614 3300038726 Bacteria 12566
236 Ga0400486_14577 3300038742 Bacteria 1280
237 Ga0400483_029605 3300039062 Bacteria 1182
238 Ga0400489_35179 3300039093 Bacteria 1157
239 Ga0400489_63116 3300039093 Bacteria 1246
240 Ga0436361_0260549 3300039447 Unclassified 588
241 Ga0436361_0455065 3300039447 Bacteria 73475
242 Ga0451804_1143665 3300041463 Bacteria 578
243 Ga0451841_0669311 3300041498 Bacteria 501
244 Ga0451849_1378173 3300041505 Bacteria 535
245 Ga0450907_040118 3300042146 Bacteria 801
246 Ga0439434_0062823 3300042435 Bacteria 1163
247 Ga0451577_1228340 3300042876 Bacteria 668
248 Ga0453684_0029399 3300044712 Bacteria 7802
249 Ga0453684_0050889 3300044712 Bacteria 5441
250 Ga0453684_0136086 3300044712 Bacteria 2941
251 Ga0453684_0713624 3300044712 Bacteria 1089
252 Ga0453684_0789237 3300044712 Bacteria 1025
253 Ga0453684_1404579 3300044712 Bacteria 724
254 Ga0453684_2347323 3300044712 Unclassified 529
255 Ga0451576_0023281 3300045051 Bacteria 6708
256 Ga0451576_0138499 3300045051 Bacteria 2538
257 Ga0451576_0205946 3300045051 Bacteria 2054
258 Ga0451576_0329781 3300045051 Bacteria 1597
259 Ga0451576_1667585 3300045051 Bacteria 661
260 Ga0495603_0634795 3300046455 Bacteria 611
261 Ga0495629_0441007 3300046459 Bacteria 882
262 Ga0495628_0757622 3300046516 Bacteria 682
263 Ga0495586_0004995 3300046535 Bacteria 7098
264 Ga0495621_0288954 3300046539 Bacteria 677
265 Ga0495658_0137326 3300046683 Bacteria 1493
266 Ga0495658_0491615 3300046683 Archaea 785
267 Ga0495613_0015341 3300046689 Bacteria 5696
268 Ga0495680_0481715 3300047322 Bacteria 845
269 Ga0496104_0083073 3300048907 Bacteria 3055
270 Ga0496105_0440562 3300048908 Bacteria 1029
271 Ga0496105_0681548 3300048908 Bacteria 791
272 Ga0496108_0054253 3300048911 Bacteria 3364
273 Ga0496109_1012094 3300048912 Bacteria 768
274 Ga0496110_0337161 3300048913 Bacteria 1374
275 Ga0496114_0939397 3300048917 Bacteria 747
276 Ga0501031_0067350 3300049568 Bacteria 2333
277 Ga0501031_0117802 3300049568 Bacteria 1735
278 Ga0501031_0411439 3300049568 Bacteria 874
279 Ga0501031_0557975 3300049568 Bacteria 738
280 Ga0501031_0614437 3300049568 Bacteria 699
281 Ga0501032_0123210 3300049569 Bacteria 1713
282 Ga0501032_0373805 3300049569 Bacteria 917
283 Ga0501033_0017997 3300049570 Bacteria 5336
284 Ga0501033_0076216 3300049570 Bacteria 2462
285 Ga0501033_0146196 3300049570 Bacteria 1707
286 Ga0501033_0169963 3300049570 Bacteria 1566
287 Ga0501033_0228585 3300049570 Bacteria 1322
288 Ga0501036_0001598 3300049572 Bacteria 17510
289 Ga0501036_0045467 3300049572 Bacteria 3719
290 Ga0501036_0060458 3300049572 Bacteria 3210
291 Ga0501036_0449789 3300049572 Bacteria 1073
292 Ga0501036_0494184 3300049572 Bacteria 1018
293 Ga0501037_0050167 3300049573 Bacteria 3055
294 Ga0501037_0061213 3300049573 Bacteria 2745
295 Ga0501038_0010155 3300049574 Bacteria 8619
296 Ga0501038_0024815 3300049574 Bacteria 5345
297 Ga0501038_0195097 3300049574 Bacteria 1628
298 Ga0501038_1316914 3300049574 Bacteria 521
299 Ga0501039_0003058 3300049575 Bacteria 12511
300 Ga0501039_0030430 3300049575 Bacteria 4163
301 Ga0501039_0033043 3300049575 Bacteria 3991
302 Ga0501039_0069225 3300049575 Bacteria 2740
303 Ga0501039_0189404 3300049575 Bacteria 1618
304 Ga0501039_0364992 3300049575 Bacteria 1134
305 Ga0501039_0655237 3300049575 Unclassified 822
306 Ga0501040_0006034 3300049576 Bacteria 7843
307 Ga0501040_0017958 3300049576 Bacteria 4695
308 Ga0501040_0018074 3300049576 Bacteria 4682
309 Ga0501040_0035809 3300049576 Bacteria 3367
310 Ga0501040_0061643 3300049576 Bacteria 2580
311 Ga0501040_0120044 3300049576 Bacteria 1844
312 Ga0501040_0192641 3300049576 Bacteria 1447
313 Ga0501040_0343910 3300049576 Bacteria 1068
314 Ga0501041_0015352 3300049577 Bacteria 4547
315 Ga0501041_0021545 3300049577 Bacteria 3861
316 Ga0501041_0030125 3300049577 Bacteria 3276
317 Ga0501041_0030987 3300049577 Bacteria 3228
318 Ga0501041_0225385 3300049577 Bacteria 1176
319 Ga0501041_1072258 3300049577 Bacteria 519
320 Ga0501042_0001210 3300049578 Bacteria 14968
321 Ga0501042_0017372 3300049578 Bacteria 4960
322 Ga0501042_0085913 3300049578 Bacteria 2256
323 Ga0501042_0121712 3300049578 Bacteria 1879
324 Ga0501042_0176702 3300049578 Bacteria 1540
325 Ga0501043_0021141 3300049579 Bacteria 5101
326 Ga0501043_0086381 3300049579 Bacteria 2465
327 Ga0501043_1006285 3300049579 Bacteria 593
328 Ga0501043_1190393 3300049579 Bacteria 535
329 Ga0501046_0006103 3300049580 Bacteria 10710
330 Ga0501046_0028328 3300049580 Bacteria 4563
331 Ga0501046_0031157 3300049580 Bacteria 4326
332 Ga0501046_0094387 3300049580 Bacteria 2299
333 Ga0501046_0175987 3300049580 Bacteria 1603
334 Ga0501046_0485302 3300049580 Bacteria 886
335 Ga0501047_0445089 3300049581 Bacteria 1125
336 Ga0501048_0002617 3300049582 Bacteria 13777
337 Ga0501048_0005065 3300049582 Bacteria 10042
338 Ga0501048_0048923 3300049582 Bacteria 3015
339 Ga0501048_0170224 3300049582 Bacteria 1543
340 Ga0501048_0293789 3300049582 Bacteria 1156
341 Ga0501048_0349844 3300049582 Bacteria 1054
342 Ga0501068_0022479 3300049584 Bacteria 3688
343 Ga0501068_0110667 3300049584 Bacteria 1707
344 Ga0501068_0265493 3300049584 Bacteria 1095
345 Ga0501069_0020144 3300049585 Bacteria 3611
346 Ga0501069_0070561 3300049585 Bacteria 1957
347 Ga0501069_0550154 3300049585 Bacteria 691
348 Ga0501069_0724571 3300049585 Bacteria 601
349 Ga0501070_0044335 3300049586 Bacteria 3702
350 Ga0501070_0571597 3300049586 Bacteria 903
351 Ga0501070_0710352 3300049586 Bacteria 794
352 Ga0501070_1236258 3300049586 Bacteria 572
353 Ga0501071_0001416 3300049587 Bacteria 13805
354 Ga0501071_0002599 3300049587 Bacteria 11034
355 Ga0501071_0053286 3300049587 Bacteria 2917
356 Ga0501071_0127415 3300049587 Bacteria 1890
357 Ga0501071_0254628 3300049587 Bacteria 1325
358 Ga0501071_0339337 3300049587 Bacteria 1142
359 Ga0501071_0386010 3300049587 Bacteria 1068
360 Ga0501071_1441960 3300049587 Bacteria 531
361 Ga0501072_0001562 3300049588 Bacteria 17098
362 Ga0501072_0041053 3300049588 Bacteria 3633
363 Ga0501072_0042426 3300049588 Bacteria 3573
364 Ga0501072_0071010 3300049588 Bacteria 2751
365 Ga0501072_0133601 3300049588 Bacteria 1978
366 Ga0501072_0143059 3300049588 Bacteria 1907
367 Ga0501072_0188940 3300049588 Bacteria 1643
368 Ga0501072_0564231 3300049588 Bacteria 899
369 Ga0501072_1373082 3300049588 Bacteria 547
370 Ga0501073_0077563 3300049589 Bacteria 2312
371 Ga0501073_0144562 3300049589 Bacteria 1648
372 Ga0501073_0688323 3300049589 Bacteria 705
373 Ga0501074_0019211 3300049590 Bacteria 4962
374 Ga0501074_0032761 3300049590 Bacteria 3764
375 Ga0501074_0101561 3300049590 Bacteria 2059
376 Ga0501074_0240955 3300049590 Bacteria 1286
377 Ga0501074_0312444 3300049590 Bacteria 1116
378 Ga0501074_0327351 3300049590 Bacteria 1088
379 Ga0501074_0420436 3300049590 Bacteria 948
380 Ga0501075_0007527 3300049591 Bacteria 7551
381 Ga0501075_0011281 3300049591 Bacteria 6322
382 Ga0501075_0012244 3300049591 Bacteria 6089
383 Ga0501075_0025832 3300049591 Bacteria 4316
384 Ga0501075_0064265 3300049591 Bacteria 2768
385 Ga0501075_0170406 3300049591 Unclassified 1661
386 Ga0501075_0173498 3300049591 Bacteria 1645
387 Ga0501075_0808064 3300049591 Bacteria 713
388 Ga0501075_1109073 3300049591 Bacteria 601
389 Ga0501076_0000567 3300049592 Bacteria 23608
390 Ga0501076_0010088 3300049592 Bacteria 6992
391 Ga0501076_0012836 3300049592 Bacteria 6269
392 Ga0501076_0027228 3300049592 Bacteria 4434
393 Ga0501076_0027507 3300049592 Bacteria 4410
394 Ga0501076_0050089 3300049592 Bacteria 3303
395 Ga0501076_0065858 3300049592 Unclassified 2890
396 Ga0501076_0741722 3300049592 Bacteria 810
397 Ga0501077_0002015 3300049593 Bacteria 12277
398 Ga0501077_0028474 3300049593 Bacteria 3550
399 Ga0501077_0047809 3300049593 Bacteria 2718
400 Ga0501077_0091667 3300049593 Unclassified 1926
401 Ga0501077_0220163 3300049593 Bacteria 1206
402 Ga0501079_0001487 3300049741 Bacteria 16593
403 Ga0501079_0007246 3300049741 Bacteria 8372
404 Ga0501079_0039552 3300049741 Bacteria 3637
405 Ga0501079_0087976 3300049741 Bacteria 2405
406 Ga0501079_0098038 3300049741 Bacteria 2272
407 Ga0501079_0242573 3300049741 Bacteria 1408
408 Ga0501079_0312733 3300049741 Bacteria 1229
409 Ga0501079_0358763 3300049741 Bacteria 1142
410 Ga0501079_0579038 3300049741 Bacteria 883
411 Ga0501079_0598887 3300049741 Bacteria 867
412 Ga0501079_0722181 3300049741 Bacteria 784
413 Ga0501080_0005867 3300049742 Bacteria 10997
414 Ga0501080_0147652 3300049742 Bacteria 2174
415 Ga0501080_0681549 3300049742 Unclassified 908
416 Ga0501080_1529954 3300049742 Bacteria 566
417 Ga0501081_0001062 3300049743 Bacteria 16486
418 Ga0501081_0007142 3300049743 Bacteria 7260
419 Ga0501081_0014902 3300049743 Bacteria 5127
420 Ga0501081_0030239 3300049743 Bacteria 3665
421 Ga0501081_0113158 3300049743 Bacteria 1927
422 Ga0501081_0206086 3300049743 Bacteria 1427
423 Ga0501081_0238038 3300049743 Bacteria 1327
424 Ga0501081_0245739 3300049743 Bacteria 1305
425 Ga0501081_0623310 3300049743 Bacteria 808
426 Ga0501081_0775680 3300049743 Bacteria 721
427 Ga0501083_0077961 3300049744 Bacteria 2198
428 Ga0501083_0141063 3300049744 Bacteria 1578
429 Ga0501083_0152327 3300049744 Bacteria 1514
430 Ga0501083_0703452 3300049744 Bacteria 657
431 Ga0501083_0765020 3300049744 Bacteria 628
432 Ga0501035_0006904 3300049822 Bacteria 10605
433 Ga0501035_0027274 3300049822 Bacteria 5221
434 Ga0501035_0429045 3300049822 Bacteria 1096
435 Ga0501044_0142159 3300049823 Bacteria 2388
436 Ga0501044_0452645 3300049823 Bacteria 1190
437 Ga0501045_0009055 3300049824 Bacteria 6954
438 Ga0501045_0019639 3300049824 Bacteria 4820
439 Ga0501045_0021794 3300049824 Bacteria 4586
440 Ga0501045_0026051 3300049824 Bacteria 4204
441 Ga0501045_0316998 3300049824 Bacteria 1160
442 nmdc:mga0qj67_319963_c1 3300050509 Bacteria 1256
443 nmdc:mga08y16_451086_c1 3300050511 Bacteria 1311
444 nmdc:mga0n895_390302_c1 3300050512 Unclassified 1408
445 nmdc:mga0rr50_1590591_c1 3300050513 Bacteria 552
446 nmdc:mga0a205_240729_c1 3300050515 Unclassified 1690
447 nmdc:mga0a205_31142_c1 3300050515 Bacteria 5109
448 Ga0495595_0462705 3300053084 Bacteria 645
449 Ga0501084_0008712 3300054114 Bacteria 8387
450 Ga0501084_0025060 3300054114 Bacteria 4977
451 Ga0501084_0100556 3300054114 Bacteria 2428
452 Ga0501084_0170927 3300054114 Bacteria 1834
453 Ga0501084_0258442 3300054114 Bacteria 1470
454 Ga0501084_0280403 3300054114 Bacteria 1407
455 Ga0501084_0348737 3300054114 Bacteria 1251
456 Ga0501084_0820298 3300054114 Bacteria 783
457 Ga0501084_1103732 3300054114 Unclassified 666
458 Ga0501084_1820055 3300054114 Bacteria 508
459 Ga0501082_0010251 3300060353 Bacteria 8069
460 Ga0501082_0055677 3300060353 Bacteria 3406
461 Ga0501082_0079146 3300060353 Bacteria 2835
462 Ga0501082_0428779 3300060353 Bacteria 1155
463 Ga0501082_0672303 3300060353 Bacteria 906
464 Ga0501082_0991863 3300060353 Bacteria 734
465 Ga0530510_0003712 3300061734 Bacteria 10509
466 Ga0530510_0024477 3300061734 Bacteria 4308
467 Ga0530510_0030159 3300061734 Bacteria 3894
468 Ga0530510_0139098 3300061734 Bacteria 1788
469 Ga0530510_1022632 3300061734 Bacteria 632
470 Ga0530510_1122891 3300061734 Bacteria 602
471 Ga0373962_0191754
472 Ga0070683_100480857
473 Ga0068868_100493770
474 Ga0070668_101683146
475 Ga0070688_100680226
476 Ga0070667_101566214
477 Ga0070714_101989012
478 Ga0070710_10265182
479 Ga0070701_10629777
480 Ga0070701_10708335
481 Ga0070705_100247897
482 Ga0070700_101313361
483 Ga0068867_101084756
484 Ga0068867_101309492
485 Ga0068867_101887617
486 Ga0070685_10397545
487 Ga0070685_11282147
488 Ga0070698_100245422
489 Ga0070698_101185384
490 Ga0070699_101496641
491 Ga0070684_100107130
492 Ga0070686_100868154
493 Ga0070686_101091837
494 Ga0070695_101102156
495 Ga0070693_100270988
496 Ga0070704_100260418
497 Ga0070702_100858178
498 Ga0068859_102104308
499 Ga0068864_101588818
500 Ga0068861_101978693
501 Ga0068870_11217130
502 Ga0068863_100920818
503 Ga0068858_100380366
504 Ga0068860_100244928
505 Ga0070717_10005472
506 Ga0075430_100152494
507 Ga0075433_10436650
508 Ga0075433_10793884
509 Ga0075434_101029741
510 Ga0097620_100545053
511 Ga0097620_102104621
512 Ga0075435_101739868
513 Ga0075435_102048240
514 Ga0111539_11192750
515 Ga0105245_12252076
516 Ga0114129_10753702
517 Ga0114129_10792981
518 Ga0114129_11735125
519 Ga0105243_10315554
520 Ga0105243_10504215
521 Ga0105248_11788818
522 Ga0105249_10145418
523 Ga0157379_11120760
524 Ga0157376_11223218
525 Ga0213872_10000134
526 Ga0207653_10418869
527 Ga0207647_10656877
528 Ga0207643_10845614
529 Ga0207684_11397087
530 Ga0207663_11128095
531 Ga0207662_10289767
532 Ga0207681_11155245
533 Ga0207650_10051299
534 Ga0207690_10806340
535 Ga0207709_10075576
536 Ga0207670_10241011
537 Ga0207670_11091656
538 Ga0207711_12142461
539 Ga0207661_10421068
540 Ga0207661_11472760
541 Ga0207679_11094592
542 Ga0207651_11531706
543 Ga0207658_10843925
544 Ga0207703_11505038
545 Ga0207703_12271812
546 Ga0207678_10611713
547 Ga0207708_10216131
548 Ga0207708_10980593
549 Ga0207648_11089186
550 Ga0207676_11368072
551 Ga0265326_10207095
552 Ga0265334_10147726
553 Ga0265323_10057546
554 Ga0265338_10396544
555 Ga0265330_10121963
556 Ga0265328_10022901
557 Ga0265340_10250182
558 Ga0265316_10144938
559 Ga0307513_10006058
560 Ga0307509_10037640
561 Ga0316575_10004061
562 Ga0316575_10070637
563 Ga0316575_10553762
564 Ga0316579_10004407
565 Ga0316579_10018698
566 Ga0316579_10044895
567 Ga0316579_10063066
568 Ga0316579_10068266
569 Ga0316579_10085436
570 Ga0316579_10124409
571 Ga0316579_10201603
572 Ga0316579_10656940
573 Ga0265342_10032091
574 Ga0316576_10004813
575 Ga0316576_10006534
576 Ga0316576_10013450
577 Ga0316576_10021198
578 Ga0316576_10031391
579 Ga0316576_10031769
580 Ga0316576_10057293
581 Ga0316576_10096216
582 Ga0316576_10199262
583 Ga0316576_10200012
584 Ga0316576_10233320
585 Ga0316576_10435811
586 Ga0316576_10795108
587 Ga0316578_10002455
588 Ga0316578_10011094
589 Ga0316578_10026361
590 Ga0316578_10043311
591 Ga0316578_10047816
592 Ga0316578_10129296
593 Ga0316578_10292937
594 Ga0316577_10000307
595 Ga0316577_10015335
596 Ga0316577_10017688
597 Ga0316577_10019044
598 Ga0316577_10020445
599 Ga0316577_10037878
600 Ga0316577_10053218
601 Ga0316577_10086399
602 Ga0316577_10095725
603 Ga0316577_10139397
604 Ga0316577_10161650
605 Ga0316577_10172007
606 Ga0316577_10197892
607 Ga0316577_10208080
608 Ga0316577_10218319
609 Ga0316577_10411754
610 Ga0316577_10818501
611 Ga0307415_100090480
612 Ga0316583_10002684
613 Ga0316583_10006658
614 Ga0316585_10001861
615 Ga0316585_10003973
616 Ga0316585_10049131
617 Ga0316585_10075601
618 Ga0316585_10247108
619 Ga0316580_10000139
620 Ga0316580_10077965
621 Ga0316580_10114935
622 Ga0316593_10001977
623 Ga0316593_10003487
624 Ga0316593_10023151
625 Ga0316593_10141947
626 Ga0316593_10153547
627 Ga0316593_10169838
628 Ga0316593_10232421
629 Ga0316592_1041236
630 Ga0316592_1081012
631 Ga0316588_1116394
632 Ga0316596_1030100
633 Ga0316596_1140233
634 Ga0373926_0019499
635 Ga0373940_0156279
636 Ga0373932_0082733
637 Ga0373936_0494660
638 Ga0373961_0071667
639 Ga0316574_0033172
640 Ga0316574_0034546
641 Ga0316574_0069875
642 Ga0316574_0076734
643 Ga0316574_0212684
644 Ga0316574_0223008
645 Ga0316574_0225018
646 Ga0316574_0288908
647 Ga0316574_0296068
648 Ga0316574_0307915
649 Ga0316574_0433939
650 Ga0316574_0504403
651 Ga0316574_0669451
652 Ga0316574_0943020
653 Ga0373931_0586493
654 Ga0373927_0001874
655 Ga0373947_0404346
656 Ga0373937_0368536
657 Ga0373937_0698574
658 Ga0316582_0000064
659 Ga0316582_0025646
660 Ga0316582_0052573
661 Ga0316582_0066825
662 Ga0316582_0077326
663 Ga0316582_0100261
664 Ga0316582_0134627
665 Ga0316582_0172094
666 Ga0316582_0201067
667 Ga0316582_0305753
668 Ga0316582_0449477
669 Ga0316582_0482236
670 Ga0316582_0533142
671 Ga0316582_0733437
672 Ga0316582_0915535
673 Ga0316582_1015864
674 Ga0316582_1150910
675 Ga0316584_0000625
676 Ga0316584_0005731
677 Ga0316584_0006277
678 Ga0316584_0006708
679 Ga0316584_0016586
680 Ga0316584_0018723
681 Ga0316584_0025608
682 Ga0316584_0030630
683 Ga0316584_0050774
684 Ga0316584_0077263
685 Ga0316584_0082780
686 Ga0316584_0084393
687 Ga0316584_0087652
688 Ga0316584_0132220
689 Ga0316584_0214750
690 Ga0316584_0331191
691 Ga0316584_0463940
692 Ga0316584_0576431
693 Ga0316584_0610143
694 Ga0316584_0770909
695 Ga0316584_0864179
696 Ga0316584_0872608
697 Ga0316584_0964010
698 Ga0373925_0000146
699 Ga0316581_0000538
700 Ga0316581_0014552
701 Ga0316581_0016492
702 Ga0316581_0017502
703 Ga0316581_0058104
704 Ga0316581_0282768
705 Ga0400490_04614
706 Ga0400486_14577
707 Ga0400483_029605
708 Ga0400489_35179
709 Ga0400489_63116
710 Ga0436361_0260549
711 Ga0436361_0455065
712 Ga0451804_1143665
713 Ga0451841_0669311
714 Ga0451849_1378173
715 Ga0450907_040118
716 Ga0439434_0062823
717 Ga0451577_1228340
718 Ga0453684_0029399
719 Ga0453684_0050889
720 Ga0453684_0136086
721 Ga0453684_0713624
722 Ga0453684_0789237
723 Ga0453684_1404579
724 Ga0453684_2347323
725 Ga0451576_0023281
726 Ga0451576_0138499
727 Ga0451576_0205946
728 Ga0451576_0329781
729 Ga0451576_1667585
730 Ga0495603_0634795
731 Ga0495629_0441007
732 Ga0495628_0757622
733 Ga0495586_0004995
734 Ga0495621_0288954
735 Ga0495658_0137326
736 Ga0495658_0491615
737 Ga0495613_0015341
738 Ga0495680_0481715
739 Ga0496104_0083073
740 Ga0496105_0440562
741 Ga0496105_0681548
742 Ga0496108_0054253
743 Ga0496109_1012094
744 Ga0496110_0337161
745 Ga0496114_0939397
746 Ga0501031_0067350
747 Ga0501031_0117802
748 Ga0501031_0411439
749 Ga0501031_0557975
750 Ga0501031_0614437
751 Ga0501032_0123210
752 Ga0501032_0373805
753 Ga0501033_0017997
754 Ga0501033_0076216
755 Ga0501033_0146196
756 Ga0501033_0169963
757 Ga0501033_0228585
758 Ga0501036_0001598
759 Ga0501036_0045467
760 Ga0501036_0060458
761 Ga0501036_0449789
762 Ga0501036_0494184
763 Ga0501037_0050167
764 Ga0501037_0061213
765 Ga0501038_0010155
766 Ga0501038_0024815
767 Ga0501038_0195097
768 Ga0501038_1316914
769 Ga0501039_0003058
770 Ga0501039_0030430
771 Ga0501039_0033043
772 Ga0501039_0069225
773 Ga0501039_0189404
774 Ga0501039_0364992
775 Ga0501039_0655237
776 Ga0501040_0006034
777 Ga0501040_0017958
778 Ga0501040_0018074
779 Ga0501040_0035809
780 Ga0501040_0061643
781 Ga0501040_0120044
782 Ga0501040_0192641
783 Ga0501040_0343910
784 Ga0501041_0015352
785 Ga0501041_0021545
786 Ga0501041_0030125
787 Ga0501041_0030987
788 Ga0501041_0225385
789 Ga0501041_1072258
790 Ga0501042_0001210
791 Ga0501042_0017372
792 Ga0501042_0085913
793 Ga0501042_0121712
794 Ga0501042_0176702
795 Ga0501043_0021141
796 Ga0501043_0086381
797 Ga0501043_1006285
798 Ga0501043_1190393
799 Ga0501046_0006103
800 Ga0501046_0028328
801 Ga0501046_0031157
802 Ga0501046_0094387
803 Ga0501046_0175987
804 Ga0501046_0485302
805 Ga0501047_0445089
806 Ga0501048_0002617
807 Ga0501048_0005065
808 Ga0501048_0048923
809 Ga0501048_0170224
810 Ga0501048_0293789
811 Ga0501048_0349844
812 Ga0501068_0022479
813 Ga0501068_0110667
814 Ga0501068_0265493
815 Ga0501069_0020144
816 Ga0501069_0070561
817 Ga0501069_0550154
818 Ga0501069_0724571
819 Ga0501070_0044335
820 Ga0501070_0571597
821 Ga0501070_0710352
822 Ga0501070_1236258
823 Ga0501071_0001416
824 Ga0501071_0002599
825 Ga0501071_0053286
826 Ga0501071_0127415
827 Ga0501071_0254628
828 Ga0501071_0339337
829 Ga0501071_0386010
830 Ga0501071_1441960
831 Ga0501072_0001562
832 Ga0501072_0041053
833 Ga0501072_0042426
834 Ga0501072_0071010
835 Ga0501072_0133601
836 Ga0501072_0143059
837 Ga0501072_0188940
838 Ga0501072_0564231
839 Ga0501072_1373082
840 Ga0501073_0077563
841 Ga0501073_0144562
842 Ga0501073_0688323
843 Ga0501074_0019211
844 Ga0501074_0032761
845 Ga0501074_0101561
846 Ga0501074_0240955
847 Ga0501074_0312444
848 Ga0501074_0327351
849 Ga0501074_0420436
850 Ga0501075_0007527
851 Ga0501075_0011281
852 Ga0501075_0012244
853 Ga0501075_0025832
854 Ga0501075_0064265
855 Ga0501075_0170406
856 Ga0501075_0173498
857 Ga0501075_0808064
858 Ga0501075_1109073
859 Ga0501076_0000567
860 Ga0501076_0010088
861 Ga0501076_0012836
862 Ga0501076_0027228
863 Ga0501076_0027507
864 Ga0501076_0050089
865 Ga0501076_0065858
866 Ga0501076_0741722
867 Ga0501077_0002015
868 Ga0501077_0028474
869 Ga0501077_0047809
870 Ga0501077_0091667
871 Ga0501077_0220163
872 Ga0501079_0001487
873 Ga0501079_0007246
874 Ga0501079_0039552
875 Ga0501079_0087976
876 Ga0501079_0098038
877 Ga0501079_0242573
878 Ga0501079_0312733
879 Ga0501079_0358763
880 Ga0501079_0579038
881 Ga0501079_0598887
882 Ga0501079_0722181
883 Ga0501080_0005867
884 Ga0501080_0147652
885 Ga0501080_0681549
886 Ga0501080_1529954
887 Ga0501081_0001062
888 Ga0501081_0007142
889 Ga0501081_0014902
890 Ga0501081_0030239
891 Ga0501081_0113158
892 Ga0501081_0206086
893 Ga0501081_0238038
894 Ga0501081_0245739
895 Ga0501081_0623310
896 Ga0501081_0775680
897 Ga0501083_0077961
898 Ga0501083_0141063
899 Ga0501083_0152327
900 Ga0501083_0703452
901 Ga0501083_0765020
902 Ga0501035_0006904
903 Ga0501035_0027274
904 Ga0501035_0429045
905 Ga0501044_0142159
906 Ga0501044_0452645
907 Ga0501045_0009055
908 Ga0501045_0019639
909 Ga0501045_0021794
910 Ga0501045_0026051
911 Ga0501045_0316998
912 nmdc:mga0qj67_319963_c1
913 nmdc:mga08y16_451086_c1
914 nmdc:mga0n895_390302_c1
915 nmdc:mga0rr50_1590591_c1
916 nmdc:mga0a205_240729_c1
917 nmdc:mga0a205_31142_c1
918 Ga0495595_0462705
919 Ga0501084_0008712
920 Ga0501084_0025060
921 Ga0501084_0100556
922 Ga0501084_0170927
923 Ga0501084_0258442
924 Ga0501084_0280403
925 Ga0501084_0348737
926 Ga0501084_0820298
927 Ga0501084_1103732
928 Ga0501084_1820055
929 Ga0501082_0010251
930 Ga0501082_0055677
931 Ga0501082_0079146
932 Ga0501082_0428779
933 Ga0501082_0672303
934 Ga0501082_0991863
935 Ga0530510_0003712
936 Ga0530510_0024477
937 Ga0530510_0030159
938 Ga0530510_0139098
939 Ga0530510_1022632
940 Ga0530510_1122891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00936

BMC

BMC domain

19

94

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mpx-assembly1.cif.gz_D cmcc e36g mutant from type ii cut mcp 1.004 3 80
7mpv-assembly1.cif.gz_C cmcc from type ii cut mcp 1.004 3 80
7mpw-assembly1.cif.gz_F cmcb from type ii cut mcp 1.004 5 83
4p7t-assembly1.cif.gz_C structural insights into higher-order assembly and function of the bacterial microcompartment protein pdua 1.003 6 78
7mn4-assembly1.cif.gz_D cmcb e35g mutant from type ii cut mcp 1.001 4 86
ID Description Score Start End Superfamily
4p7tC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 1.003 6 78 3.30.70.1710
4qieG00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.9947 3 83 3.30.70.1710
4axjB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.9803 2 88 3.30.70.1710
3mpwG00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.9797 3 90 3.30.70.1710
4p7tC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.9766 6 78 3.30.70.1710
ID Description Score Start End GO Terms
AF-A0A6C9DW12-F1-model_v4 deleted 1.007 1 80
AF-X1U8R7-F1-model_v4 BMC domain-containing protein 1.006 2 76 GO:0031469
AF-A0A2H0P0Z4-F1-model_v4 Ethanolamine utilization protein EutM 1.006 3 74 GO:0031469
AF-A0A7C3LM57-F1-model_v4 BMC domain-containing protein 1.004 2 76 GO:0031469
AF-A0A1T5I9Y0-F1-model_v4 Ethanolamine utilization protein EutM 1.003 3 86 GO:0031469

Map