F450620

General Info

Members Datasets Scaffolds Average Seq Length
471 247 463 246

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10051771|Ga0265328_100517712
Length 284
Sequence MSSTKQNKPSQPTGRQTGPQTGRLLLIPNTLDFGCLDDSTGEAAPDLRDVLPMGAITAAASLTHWIAENAKTTRAFLKRVGEISPLRAPLQEQDIQVLPRPNKGGNKGTSKRPDPQEDRQITDLLAPALAGHDVGLISEAGLPGVADPGAAVVLAAHKAGVPVLPLSGPSSLVLALAASGLHGQSFAFVGYLPVEAQERAQRIKDLEQTSRKAHQTQLVIETPYRNTALWQALLQHLQGNTLLSVSCGLTLPQGWSRTDTVERWRKLPVTLPDDIPTVFSWLAA

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221585 Pelomonas sp. Root662 Isolate Unclassified
4 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
5 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
6 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2643221656 Pelomonas sp. Root405 Isolate Unclassified
9 2738541337 Pelomonas sp. BT06 Isolate Unclassified
10 2831864461 Roseateles noduli HZ7 Isolate Nodule
11 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
142 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
143 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
151 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
168 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
185 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
186 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
187 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
188 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
189 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
190 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
231 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
232 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
242 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
245 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
246 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
247 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0
Isolates 2.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.9
Nodule 1.06
Rhizoplane 1.49
Rhizosphere 67.94
Stem 0
Stem Tuber 0
Unclassified 10.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10008969 3300003316 Bacteria 8211
2 rootH1_10008969 3300003323 Bacteria 2355
3 rootH1_10016292 3300003316 Bacteria 16501
4 rootH1_10016292 3300003323 Bacteria 2576
5 rootL2_10004981 3300003322 Bacteria 32520
6 rootL2_10027282 3300003322 Bacteria 16821
7 rootL2_10031835 3300003322 Bacteria 1338
8 rootH1_10022507 3300003316 Bacteria 2279
9 rootH1_10022507 3300003323 Bacteria 4965
10 rootH1_10030030 3300003323 Bacteria 1758
11 rootH1_10046719 3300003323 Bacteria 1205
12 Ga0055525_1000004 3300003759 Bacteria 888039
13 Ga0055524_1000121 3300003775 Bacteria 91150
14 Ga0055524_1001224 3300003775 Bacteria 15168
15 Ga0055524_1002725 3300003775 Bacteria 8921
16 Ga0055530_10003903 3300003791 Bacteria 8125
17 Ga0055530_10035106 3300003791 Bacteria 1275
18 Ga0055540_1000001 3300003792 Bacteria 466834
19 Ga0055531_10000007 3300003794 Bacteria 225289
20 Ga0055531_10001660 3300003794 Bacteria 16067
21 Ga0055531_10005441 3300003794 Bacteria 7454
22 Ga0055531_10007705 3300003794 Bacteria 5816
23 Ga0055543_1002116 3300004625 Bacteria 6880
24 Ga0065165_1000016 3300005262 Bacteria 286248
25 Ga0070658_10149037 3300005327 Bacteria 1957
26 Ga0070658_10228879 3300005327 Bacteria 1574
27 Ga0070658_10261865 3300005327 Bacteria 1469
28 Ga0070676_10003277 3300005328 Bacteria 8410
29 Ga0070676_10267371 3300005328 Bacteria 1147
30 Ga0070683_100087166 3300005329 Bacteria 2927
31 Ga0070690_100018361 3300005330 Bacteria 4223
32 Ga0070670_100011243 3300005331 Bacteria 7651
33 Ga0070670_100124087 3300005331 Bacteria 2228
34 Ga0070670_100484384 3300005331 Bacteria 1099
35 Ga0070677_10012600 3300005333 Bacteria 2939
36 Ga0070677_10063304 3300005333 Bacteria 1533
37 Ga0068869_100014800 3300005334 Bacteria 5218
38 Ga0068869_100032980 3300005334 Bacteria 3653
39 Ga0068869_100306482 3300005334 Bacteria 1284
40 Ga0070666_10035660 3300005335 Bacteria 3299
41 Ga0070682_100043043 3300005337 Bacteria 2791
42 Ga0068868_100065876 3300005338 Bacteria 2878
43 Ga0068868_100131718 3300005338 Bacteria 2046
44 Ga0070660_100240931 3300005339 Bacteria 1473
45 Ga0070661_100003258 3300005344 Bacteria 11197
46 Ga0070661_100261733 3300005344 Bacteria 1337
47 Ga0070668_100002286 3300005347 Bacteria 14134
48 Ga0070669_100001842 3300005353 Bacteria 15288
49 Ga0070675_100011141 3300005354 Bacteria 7035
50 Ga0070675_100038928 3300005354 Bacteria 3878
51 Ga0070675_100041985 3300005354 Bacteria 3736
52 Ga0070671_100019170 3300005355 Bacteria 5565
53 Ga0070671_100053922 3300005355 Bacteria 3342
54 Ga0070671_100139210 3300005355 Bacteria 2047
55 Ga0070674_100022459 3300005356 Bacteria 4070
56 Ga0070674_100086152 3300005356 Bacteria 2256
57 Ga0070673_100023530 3300005364 Bacteria 4501
58 Ga0070673_100153569 3300005364 Bacteria 1952
59 Ga0070673_100462496 3300005364 Bacteria 1143
60 Ga0070659_100044882 3300005366 Bacteria 3462
61 Ga0070659_100081375 3300005366 Bacteria 2586
62 Ga0070667_100000606 3300005367 Bacteria 34995
63 Ga0070667_100011188 3300005367 Bacteria 7423
64 Ga0070667_100196641 3300005367 Bacteria 1788
65 Ga0070703_10074125 3300005406 Bacteria 1143
66 Ga0070701_10094831 3300005438 Bacteria 1642
67 Ga0070700_100035802 3300005441 Bacteria 3006
68 Ga0070663_100000279 3300005455 Bacteria 25824
69 Ga0070663_100102106 3300005455 Bacteria 2142
70 Ga0070678_100057896 3300005456 Bacteria 2842
71 Ga0070678_100102688 3300005456 Bacteria 2219
72 Ga0070678_100159388 3300005456 Bacteria 1826
73 Ga0070662_100006467 3300005457 Bacteria 7555
74 Ga0070662_100034953 3300005457 Bacteria 3546
75 Ga0070662_100072639 3300005457 Bacteria 2540
76 Ga0068867_100000453 3300005459 Bacteria 27171
77 Ga0068867_100024108 3300005459 Bacteria 4360
78 Ga0068867_100036925 3300005459 Bacteria 3549
79 Ga0068867_100071565 3300005459 Bacteria 2594
80 Ga0068867_100084974 3300005459 Bacteria 2392
81 Ga0068867_100329259 3300005459 Bacteria 1268
82 Ga0068853_100733400 3300005539 Bacteria 944
83 Ga0070672_100001113 3300005543 Bacteria 16417
84 Ga0070672_100127278 3300005543 Bacteria 2090
85 Ga0070672_100134731 3300005543 Bacteria 2033
86 Ga0070672_100182061 3300005543 Bacteria 1751
87 Ga0070665_100365619 3300005548 Bacteria 1449
88 Ga0070665_100820516 3300005548 Bacteria 943
89 Ga0070664_100011508 3300005564 Bacteria 7181
90 Ga0070664_100070590 3300005564 Bacteria 2991
91 Ga0070664_100093819 3300005564 Bacteria 2601
92 Ga0070664_100182097 3300005564 Bacteria 1868
93 Ga0068852_100089152 3300005616 Bacteria 2756
94 Ga0068852_100146984 3300005616 Bacteria 2187
95 Ga0068852_100168080 3300005616 Bacteria 2053
96 Ga0068852_100305184 3300005616 Bacteria 1542
97 Ga0068852_100311791 3300005616 Bacteria 1526
98 Ga0068859_100120373 3300005617 Bacteria 2692
99 Ga0068864_100043110 3300005618 Bacteria 3862
100 Ga0068864_100492106 3300005618 Bacteria 1179
101 Ga0068866_10007428 3300005718 Bacteria 4587
102 Ga0068861_100002727 3300005719 Bacteria 11570
103 Ga0068851_10038362 3300005834 Bacteria 2403
104 Ga0068863_100077248 3300005841 Bacteria 3151
105 Ga0068863_100217723 3300005841 Bacteria 1839
106 Ga0068863_100499973 3300005841 Bacteria 1197
107 Ga0068863_100569301 3300005841 Bacteria 1120
108 Ga0068863_100739928 3300005841 Bacteria 979
109 Ga0068858_100002700 3300005842 Bacteria 17882
110 Ga0068860_100013981 3300005843 Bacteria 7871
111 Ga0068860_100072591 3300005843 Bacteria 3271
112 Ga0068860_100202985 3300005843 Bacteria 1921
113 Ga0068860_100475643 3300005843 Bacteria 1245
114 Ga0068862_100020926 3300005844 Bacteria 5465
115 Ga0075365_10042934 3300006038 Bacteria 2958
116 Ga0075365_10160366 3300006038 Bacteria 1567
117 Ga0075363_100302442 3300006048 Bacteria 928
118 Ga0075364_10110554 3300006051 Bacteria 1833
119 Ga0075362_10004098 3300006177 Bacteria 5195
120 Ga0075367_10024677 3300006178 Bacteria 3392
121 Ga0075366_10000139 3300006195 Bacteria 30628
122 Ga0075366_10003609 3300006195 Bacteria 8197
123 Ga0075366_10012833 3300006195 Bacteria 4762
124 Ga0075366_10018328 3300006195 Bacteria 4040
125 Ga0075366_10025054 3300006195 Bacteria 3481
126 Ga0075366_10037401 3300006195 Bacteria 2865
127 Ga0075366_10059196 3300006195 Bacteria 2275
128 Ga0075366_10075464 3300006195 Bacteria 2011
129 Ga0075366_10096570 3300006195 Bacteria 1772
130 Ga0075366_10099467 3300006195 Bacteria 1745
131 Ga0075366_10108887 3300006195 Bacteria 1666
132 Ga0075366_10206744 3300006195 Bacteria 1194
133 Ga0097621_100028612 3300006237 Bacteria 4393
134 Ga0097621_100178743 3300006237 Bacteria 1833
135 Ga0075370_10000112 3300006353 Bacteria 26323
136 Ga0075370_10001015 3300006353 Bacteria 11639
137 Ga0075370_10002597 3300006353 Bacteria 8417
138 Ga0075370_10007451 3300006353 Bacteria 5575
139 Ga0075370_10010483 3300006353 Bacteria 4845
140 Ga0075370_10027391 3300006353 Bacteria 3161
141 Ga0075370_10160836 3300006353 Bacteria 1318
142 Ga0068871_100017832 3300006358 Bacteria 5382
143 Ga0068871_100593520 3300006358 Bacteria 1007
144 Ga0075429_100031123 3300006880 Bacteria 4638
145 Ga0068865_100024100 3300006881 Bacteria 3989
146 Ga0097620_100120372 3300006931 Bacteria 2692
147 Ga0099823_1000021 3300006944 Bacteria 76133
148 Ga0079104_1000001 3300006946 Bacteria 521847
149 Ga0105245_10136994 3300009098 Bacteria 2302
150 Ga0105245_10167971 3300009098 Bacteria 2087
151 Ga0114129_10393015 3300009147 Bacteria 1829
152 Ga0105243_10002357 3300009148 Bacteria 15813
153 Ga0105243_10047607 3300009148 Bacteria 3377
154 Ga0105243_10140379 3300009148 Bacteria 2061
155 Ga0105248_10142373 3300009177 Bacteria 2705
156 Ga0105248_10636553 3300009177 Bacteria 1203
157 Ga0105237_10366241 3300009545 Bacteria 1446
158 Ga0105249_10015103 3300009553 Bacteria 6831
159 Ga0157319_1000027 3300012497 Bacteria 62955
160 Ga0157371_10125634 3300013102 Bacteria 1824
161 Ga0157374_10310651 3300013296 Bacteria 1561
162 Ga0157378_10059538 3300013297 Bacteria 3408
163 Ga0157378_10380191 3300013297 Bacteria 1386
164 Ga0163162_10004605 3300013306 Bacteria 13287
165 Ga0157375_10027080 3300013308 Bacteria 5354
166 Ga0157375_10316436 3300013308 Bacteria 1725
167 Ga0157375_10445752 3300013308 Bacteria 1460
168 Ga0163163_10398357 3300014325 Bacteria 1435
169 Ga0157380_10014744 3300014326 Bacteria 5723
170 Ga0157380_10235372 3300014326 Bacteria 1648
171 Ga0157377_10000088 3300014745 Bacteria 67719
172 Ga0157379_10027881 3300014968 Bacteria 5026
173 Ga0157379_10036220 3300014968 Bacteria 4400
174 Ga0157379_10724633 3300014968 Bacteria 935
175 Ga0157376_10036236 3300014969 Bacteria 3996
176 Ga0157376_10282507 3300014969 Bacteria 1564
177 Ga0163161_10015904 3300017792 Bacteria 5250
178 Ga0213872_10000469 3300021361 Bacteria 32732
179 Ga0213872_10000528 3300021361 Bacteria 29926
180 Ga0213872_10000566 3300021361 Bacteria 28609
181 Ga0213872_10007772 3300021361 Bacteria 5241
182 Ga0209563_100013 3300025230 Bacteria 941463
183 Ga0209673_1007134 3300025273 Bacteria 5229
184 Ga0209675_1014267 3300025291 Bacteria 2428
185 Ga0209564_1000008 3300025295 Bacteria 953227
186 Ga0209050_1000934 3300025298 Bacteria 38215
187 Ga0209050_1003281 3300025298 Bacteria 12153
188 Ga0209050_1006974 3300025298 Bacteria 6508
189 Ga0209050_1019785 3300025298 Bacteria 2539
190 Ga0209256_1000015 3300025299 Bacteria 622953
191 Ga0209256_1000424 3300025299 Bacteria 66333
192 Ga0209256_1002394 3300025299 Bacteria 15451
193 Ga0209051_1000018 3300025303 Bacteria 527061
194 Ga0209051_1000469 3300025303 Bacteria 52936
195 Ga0209051_1012745 3300025303 Bacteria 4048
196 Ga0209257_1000021 3300025304 Bacteria 771986
197 Ga0209257_1000084 3300025304 Bacteria 291502
198 Ga0209257_1000946 3300025304 Bacteria 40063
199 Ga0209257_1002583 3300025304 Bacteria 17605
200 Ga0207697_10025515 3300025315 Bacteria 2415
201 Ga0207653_10098379 3300025885 Bacteria 1032
202 Ga0207682_10013513 3300025893 Bacteria 3181
203 Ga0207682_10038145 3300025893 Bacteria 1948
204 Ga0207642_10262576 3300025899 Bacteria 985
205 Ga0207680_10087234 3300025903 Bacteria 1975
206 Ga0207645_10017617 3300025907 Bacteria 4710
207 Ga0207645_10026576 3300025907 Bacteria 3740
208 Ga0207645_10166071 3300025907 Bacteria 1445
209 Ga0207645_10300587 3300025907 Bacteria 1068
210 Ga0207705_10271026 3300025909 Bacteria 1298
211 Ga0207657_10165210 3300025919 Bacteria 1796
212 Ga0207649_10000359 3300025920 Bacteria 34180
213 Ga0207649_10211697 3300025920 Bacteria 1375
214 Ga0207681_10000583 3300025923 Bacteria 24864
215 Ga0207650_10006944 3300025925 Bacteria 7719
216 Ga0207650_10079182 3300025925 Bacteria 2488
217 Ga0207650_10085747 3300025925 Bacteria 2396
218 Ga0207650_10106220 3300025925 Bacteria 2168
219 Ga0207650_10177173 3300025925 Bacteria 1697
220 Ga0207650_10236880 3300025925 Bacteria 1474
221 Ga0207659_10028405 3300025926 Bacteria 3802
222 Ga0207659_10072048 3300025926 Bacteria 2525
223 Ga0207659_10125242 3300025926 Bacteria 1975
224 Ga0207659_10291351 3300025926 Bacteria 1338
225 Ga0207687_10111201 3300025927 Bacteria 2033
226 Ga0207644_10018232 3300025931 Bacteria 4746
227 Ga0207690_10029235 3300025932 Bacteria 3502
228 Ga0207690_10091803 3300025932 Bacteria 2147
229 Ga0207706_10002836 3300025933 Bacteria 16816
230 Ga0207706_10054660 3300025933 Bacteria 3523
231 Ga0207706_10181137 3300025933 Bacteria 1850
232 Ga0207709_10006590 3300025935 Bacteria 6519
233 Ga0207709_10009377 3300025935 Bacteria 5385
234 Ga0207709_10131369 3300025935 Bacteria 1707
235 Ga0207669_10009613 3300025937 Bacteria 4618
236 Ga0207669_10067243 3300025937 Bacteria 2232
237 Ga0207669_10143810 3300025937 Bacteria 1660
238 Ga0207704_10016917 3300025938 Bacteria 3764
239 Ga0207691_10010405 3300025940 Bacteria 8923
240 Ga0207691_10067263 3300025940 Bacteria 3240
241 Ga0207691_10099815 3300025940 Bacteria 2592
242 Ga0207691_10135842 3300025940 Bacteria 2169
243 Ga0207691_10467939 3300025940 Bacteria 1072
244 Ga0207711_10061435 3300025941 Bacteria 3240
245 Ga0207711_10175973 3300025941 Bacteria 1944
246 Ga0207689_10009785 3300025942 Bacteria 8259
247 Ga0207689_10172831 3300025942 Bacteria 1781
248 Ga0207689_10205665 3300025942 Bacteria 1626
249 Ga0207679_10000047 3300025945 Bacteria 119891
250 Ga0207679_10015999 3300025945 Bacteria 4972
251 Ga0207679_10367854 3300025945 Bacteria 1258
252 Ga0207651_10200900 3300025960 Bacteria 1597
253 Ga0207712_10024758 3300025961 Bacteria 3980
254 Ga0207658_10001932 3300025986 Bacteria 15466
255 Ga0207658_10006803 3300025986 Bacteria 7790
256 Ga0207658_10123966 3300025986 Bacteria 2065
257 Ga0207658_10135184 3300025986 Bacteria 1987
258 Ga0207677_10114896 3300026023 Bacteria 2012
259 Ga0207677_10227531 3300026023 Bacteria 1500
260 Ga0207703_10002118 3300026035 Bacteria 17481
261 Ga0207639_10256461 3300026041 Bacteria 1527
262 Ga0207678_10001700 3300026067 Bacteria 20180
263 Ga0207678_10061843 3300026067 Bacteria 3220
264 Ga0207708_10175956 3300026075 Bacteria 1697
265 Ga0207641_10023122 3300026088 Bacteria 5121
266 Ga0207641_10290693 3300026088 Bacteria 1540
267 Ga0207648_10000019 3300026089 Bacteria 144209
268 Ga0207648_10033979 3300026089 Bacteria 4497
269 Ga0207648_10062829 3300026089 Bacteria 3237
270 Ga0207648_10173131 3300026089 Bacteria 1909
271 Ga0207648_10185326 3300026089 Bacteria 1843
272 Ga0207648_10565482 3300026089 Bacteria 1046
273 Ga0207676_10033397 3300026095 Bacteria 3887
274 Ga0207676_10103062 3300026095 Bacteria 2370
275 Ga0207675_100019848 3300026118 Bacteria 6272
276 Ga0207683_10070584 3300026121 Bacteria 3086
277 Ga0207683_10156692 3300026121 Bacteria 2057
278 Ga0207683_10159500 3300026121 Bacteria 2038
279 Ga0207683_10162431 3300026121 Bacteria 2020
280 Ga0207683_10163287 3300026121 Bacteria 2015
281 Ga0207683_10268442 3300026121 Bacteria 1558
282 Ga0207698_10046132 3300026142 Bacteria 3288
283 Ga0207698_10115158 3300026142 Bacteria 2263
284 Ga0207698_10144617 3300026142 Bacteria 2054
285 Ga0207698_10183743 3300026142 Bacteria 1855
286 Ga0209281_1000151 3300027111 Bacteria 167268
287 Ga0209389_1000341 3300027296 Bacteria 28381
288 Ga0209371_1015531 3300027312 Bacteria 2041
289 Ga0209371_1015850 3300027312 Bacteria 2008
290 Ga0209974_10000696 3300027876 Bacteria 11455
291 Ga0268266_10303481 3300028379 Bacteria 1490
292 Ga0268265_10069594 3300028380 Bacteria 2733
293 Ga0268264_10001636 3300028381 Bacteria 20687
294 Ga0268264_10125012 3300028381 Bacteria 2272
295 Ga0268264_10287364 3300028381 Bacteria 1543
296 Ga0307517_10000174 3300028786 Bacteria 105578
297 Ga0307515_10002251 3300028794 Bacteria 42303
298 Ga0307515_10004349 3300028794 Bacteria 29393
299 Ga0307515_10006229 3300028794 Bacteria 23956
300 Ga0307515_10012576 3300028794 Bacteria 15908
301 Ga0307515_10021819 3300028794 Bacteria 11327
302 Ga0307515_10298155 3300028794 Bacteria 1300
303 Ga0268256_1013251 3300030500 Bacteria 2510
304 Ga0307512_10207865 3300030522 Bacteria 1046
305 Ga0265328_10051771 3300031239 Bacteria 1508
306 Ga0265331_10001541 3300031250 Bacteria 16945
307 Ga0265327_10000012 3300031251 Bacteria 530403
308 Ga0265327_10001086 3300031251 Bacteria 37884
309 Ga0265316_10000430 3300031344 Bacteria 47823
310 Ga0307513_10032159 3300031456 Bacteria 5921
311 Ga0307513_10042494 3300031456 Bacteria 5004
312 Ga0307513_10120650 3300031456 Bacteria 2590
313 Ga0307513_10190586 3300031456 Bacteria 1903
314 Ga0307513_10314430 3300031456 Bacteria 1327
315 Ga0307509_10008466 3300031507 Bacteria 13101
316 Ga0307509_10012377 3300031507 Bacteria 10208
317 Ga0307509_10034866 3300031507 Bacteria 5527
318 Ga0307509_10130971 3300031507 Bacteria 2464
319 Ga0307408_100000040 3300031548 Bacteria 175456
320 Ga0307408_100258867 3300031548 Bacteria 1439
321 Ga0307408_100399262 3300031548 Bacteria 1180
322 Ga0307408_100638499 3300031548 Bacteria 950
323 Ga0307508_10000123 3300031616 Bacteria 92439
324 Ga0307508_10007419 3300031616 Bacteria 10211
325 Ga0307508_10016592 3300031616 Bacteria 6702
326 Ga0307508_10055154 3300031616 Bacteria 3521
327 Ga0307514_10081062 3300031649 Bacteria 2399
328 Ga0307516_10004481 3300031730 Bacteria 17197
329 Ga0307516_10029903 3300031730 Bacteria 5503
330 Ga0307516_10373260 3300031730 Bacteria 1089
331 Ga0307416_100072987 3300032002 Bacteria 2859
332 Ga0307414_10025061 3300032004 Bacteria 3813
333 Ga0307414_10554357 3300032004 Bacteria 1025
334 Ga0307411_10028175 3300032005 Bacteria 3411
335 Ga0307507_10073510 3300033179 Bacteria 3073
336 Ga0307507_10123500 3300033179 Bacteria 2060
337 Ga0307510_10064818 3300033180 Bacteria 3706
338 Ga0307510_10065087 3300033180 Bacteria 3696
339 Ga0373950_0004687 3300034818 Bacteria 2012
340 Ga0373959_0012860 3300034820 Bacteria 1501
341 Ga0373940_0003862 3300035088 Bacteria 3110
342 Ga0373939_0000020 3300035114 Bacteria 58845
343 Ga0373939_0040288 3300035114 Bacteria 1402
344 Ga0373939_0045924 3300035114 Bacteria 1335
345 Ga0373960_0001589 3300035121 Bacteria 5070
346 Ga0373943_0026299 3300035170 Bacteria 2726
347 Ga0373924_0006075 3300035410 Bacteria 4312
348 Ga0373931_0000293 3300035691 Bacteria 21036
349 Ga0373931_0028022 3300035691 Bacteria 2880
350 Ga0373927_0101872 3300035695 Bacteria 1868
351 Ga0373937_0604915 3300036401 Bacteria 1040
352 Ga0373925_0054353 3300037068 Bacteria 2995
353 Ga0373925_0229789 3300037068 Bacteria 1483
354 Ga0395905_0001227 3300037471 Bacteria 31961
355 Ga0395905_0002152 3300037471 Bacteria 22342
356 Ga0395905_0005995 3300037471 Bacteria 12311
357 Ga0395905_0013875 3300037471 Bacteria 7709
358 Ga0395905_0053998 3300037471 Bacteria 3760
359 Ga0395905_0418207 3300037471 Bacteria 1236
360 Ga0436365_0104771 3300039437 Bacteria 1371
361 Ga0436361_0162124 3300039447 Bacteria 22005
362 Ga0436361_0487065 3300039447 Bacteria 63556
363 Ga0436361_0587802 3300039447 Bacteria 5607
364 Ga0436361_1117053 3300039447 Bacteria 8349
365 Ga0451797_0780207 3300041453 Bacteria 763
366 Ga0451853_2928907 3300041512 Bacteria 1639
367 Ga0439431_0046161 3300041997 Bacteria 1120
368 Ga0450919_000263 3300042121 Bacteria 6073
369 Ga0450920_006884 3300042122 Bacteria 2050
370 Ga0450888_001195 3300042126 Bacteria 2479
371 Ga0450892_000133 3300042130 Bacteria 8508
372 Ga0450889_002052 3300042144 Bacteria 2019
373 Ga0439459_0000026 3300042438 Bacteria 12841
374 Ga0450918_002926 3300042531 Bacteria 3209
375 Ga0466969_0020472 3300044656 Bacteria 3425
376 Ga0466965_0060016 3300044683 Bacteria 1899
377 Ga0466966_0115382 3300044684 Bacteria 1653
378 Ga0466961_0046262 3300044693 Bacteria 2783
379 Ga0466963_0144364 3300044694 Bacteria 1650
380 Ga0466964_0000349 3300044706 Bacteria 13843
381 Ga0453684_0001396 3300044712 Bacteria 69884
382 Ga0453684_0456312 3300044712 Bacteria 1422
383 Ga0466971_0105877 3300044719 Bacteria 1295
384 Ga0466957_0053761 3300044842 Bacteria 2456
385 Ga0466957_0124894 3300044842 Bacteria 1643
386 Ga0466959_0000920 3300045049 Bacteria 17440
387 Ga0466959_0065265 3300045049 Bacteria 2641
388 Ga0451576_0045916 3300045051 Bacteria 4600
389 Ga0451576_0260827 3300045051 Bacteria 1811
390 Ga0466958_0000143 3300045836 Bacteria 24574
391 Ga0466967_0012414 3300045976 Bacteria 6513
392 Ga0495592_0147759 3300046454 Bacteria 1628
393 Ga0495590_0033701 3300046457 Bacteria 1790
394 Ga0495650_0001962 3300046471 Bacteria 18166
395 Ga0495610_0016022 3300046512 Bacteria 4333
396 Ga0495632_0008447 3300046519 Bacteria 6321
397 Ga0495632_0016713 3300046519 Bacteria 4071
398 Ga0495643_0016473 3300046522 Bacteria 4341
399 Ga0495643_0148673 3300046522 Bacteria 1162
400 Ga0495586_0127198 3300046535 Bacteria 1426
401 Ga0495622_0093585 3300046557 Bacteria 1380
402 Ga0495668_0079465 3300046616 Bacteria 1800
403 Ga0495625_0000929 3300046660 Bacteria 39380
404 Ga0495625_0010060 3300046660 Bacteria 7861
405 Ga0495635_0375328 3300046663 Bacteria 947
406 Ga0495647_0042250 3300046681 Bacteria 1740
407 Ga0495671_0310878 3300046692 Bacteria 757
408 Ga0495649_0019487 3300046694 Bacteria 3811
409 Ga0495600_0282282 3300046809 Bacteria 1051
410 Ga0495660_0016858 3300046810 Bacteria 4209
411 Ga0495687_000327 3300047443 Bacteria 61677
412 Ga0495687_000615 3300047443 Bacteria 41337
413 Ga0495687_000811 3300047443 Bacteria 33635
414 Ga0495686_0056504 3300047472 Bacteria 2452
415 Ga0495626_0024554 3300048091 Bacteria 2954
416 Ga0496100_0173439 3300048903 Bacteria 1555
417 Ga0496102_0002833 3300048905 Bacteria 14745
418 Ga0496109_0055399 3300048912 Bacteria 3618
419 Ga0496109_0157585 3300048912 Bacteria 2127
420 Ga0496110_0106737 3300048913 Bacteria 2513
421 Ga0496114_0023523 3300048917 Bacteria 5028
422 Ga0496124_0000596 3300048927 Bacteria 60853
423 Ga0496124_0008511 3300048927 Bacteria 10717
424 Ga0496125_0008584 3300048928 Bacteria 10671
425 Ga0501211_000441 3300049658 Bacteria 4006
426 Ga0501235_039124 3300049669 Bacteria 1082
427 Ga0501229_000532 3300049706 Bacteria 4318
428 nmdc:mga03683_7461_c1 3300050489 Bacteria 3797
429 nmdc:mga0k408_110229_c1 3300050493 Bacteria 1627
430 nmdc:mga0k408_1196_c1 3300050493 Bacteria 14189
431 nmdc:mga0k408_130826_c1 3300050493 Bacteria 1490
432 nmdc:mga0k408_23091_c1 3300050493 Bacteria 3506
433 nmdc:mga0k408_2867_c1 3300050493 Bacteria 9153
434 nmdc:mga0k408_308_c1 3300050493 Bacteria 26541
435 nmdc:mga0k408_3464_c2 3300050493 Bacteria 6291
436 nmdc:mga0k408_61620_c1 3300050493 Bacteria 1854
437 nmdc:mga0k408_6803_c1 3300050493 Bacteria 6097
438 nmdc:mga0k408_74649_c1 3300050493 Bacteria 1981
439 nmdc:mga06z11_1592_c1 3300050494 Bacteria 8460
440 nmdc:mga06z11_27602_c1 3300050494 Bacteria 2715
441 nmdc:mga04h51_20014_c1 3300050495 Bacteria 1992
442 nmdc:mga07m45_10651_c1 3300050496 Bacteria 4810
443 nmdc:mga07m45_124_c1 3300050496 Bacteria 30492
444 nmdc:mga07m45_131726_c1 3300050496 Bacteria 1447
445 nmdc:mga07m45_170_c1 3300050496 Bacteria 26138
446 nmdc:mga07m45_1972_c1 3300050496 Bacteria 9502
447 nmdc:mga07m45_205015_c1 3300050496 Bacteria 1147
448 nmdc:mga07m45_27852_c1 3300050496 Bacteria 3117
449 nmdc:mga07m45_62040_c1 3300050496 Bacteria 2118
450 nmdc:mga07m45_64179_c1 3300050496 Bacteria 1759
451 nmdc:mga07m45_72014_c1 3300050496 Bacteria 1967
452 nmdc:mga07m45_996_c1 3300050496 Bacteria 12505
453 nmdc:mga05p37_335284_c1 3300050507 Bacteria 1785
454 Ga0495601_0031491 3300053077 Bacteria 3297
455 Ga0495595_0155508 3300053084 Bacteria 1126
456 Ga0500644_0170817 3300053088 Bacteria 884
457 Ga0500593_014225 3300053117 Bacteria 3409
458 Ga0500658_0002462 3300053134 Bacteria 7159
459 Ga0500658_0030106 3300053134 Bacteria 2115
460 Ga0500568_0023945 3300053139 Bacteria 2590
461 Ga0500590_002719 3300053148 Bacteria 7962
462 Ga0500619_000016 3300053154 Bacteria 54289
463 Ga0500587_004355 3300053739 Bacteria 1946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034818 Ga0373950_0004687 Ga0373950_0004687_733_1494 162
2 3300034820 Ga0373959_0012860 Ga0373959_0012860_583_1344 162
3 3300035088 Ga0373940_0003862 Ga0373940_0003862_708_1469 162
4 3300035114 Ga0373939_0000020 Ga0373939_0000020_50337_51098 162
5 3300035121 Ga0373960_0001589 Ga0373960_0001589_812_1573 162
6 3300035691 Ga0373931_0000293 Ga0373931_0000293_8359_9120 162
7 3300041453 Ga0451797_0780207 Ga0451797_0780207_110_745 165
8 3300046692 Ga0495671_0310878 Ga0495671_0310878_80_715 165
9 3300025942 Ga0207689_10172831 Ga0207689_101728312 175
10 3300006353 Ga0075370_10000112 Ga0075370_1000011221 180
11 3300050496 nmdc:mga07m45_124_c1 nmdc:mga07m45_124_c1_28346_29107 180
12 3300005616 Ga0068852_100168080 Ga0068852_1001680802 181
13 3300006353 Ga0075370_10027391 Ga0075370_100273914 181
14 3300013296 Ga0157374_10310651 Ga0157374_103106512 181
15 3300013308 Ga0157375_10445752 Ga0157375_104457522 181
16 3300005327 Ga0070658_10228879 Ga0070658_102288792 183
17 3300005564 Ga0070664_100182097 Ga0070664_1001820973 183
18 3300005841 Ga0068863_100499973 Ga0068863_1004999732 183
19 3300005841 Ga0068863_100739928 Ga0068863_1007399282 183
20 3300006358 Ga0068871_100593520 Ga0068871_1005935201 183
21 3300025925 Ga0207650_10177173 Ga0207650_101771732 183
22 3300025945 Ga0207679_10367854 Ga0207679_103678542 183
23 3300026121 Ga0207683_10163287 Ga0207683_101632872 183
24 3300031548 Ga0307408_100000040 Ga0307408_100000040116 184
25 3300005328 Ga0070676_10003277 Ga0070676_100032772 185
26 3300005330 Ga0070690_100018361 Ga0070690_1000183615 185
27 3300005333 Ga0070677_10012600 Ga0070677_100126002 185
28 3300005334 Ga0068869_100014800 Ga0068869_1000148005 185
29 3300005335 Ga0070666_10035660 Ga0070666_100356602 185
30 3300005338 Ga0068868_100065876 Ga0068868_1000658763 185
31 3300005347 Ga0070668_100002286 Ga0070668_1000022862 185
32 3300005353 Ga0070669_100001842 Ga0070669_10000184210 185
33 3300005354 Ga0070675_100011141 Ga0070675_1000111415 185
34 3300005355 Ga0070671_100053922 Ga0070671_1000539222 185
35 3300005356 Ga0070674_100022459 Ga0070674_1000224595 185
36 3300005364 Ga0070673_100462496 Ga0070673_1004624962 185
37 3300005366 Ga0070659_100081375 Ga0070659_1000813751 185
38 3300005367 Ga0070667_100011188 Ga0070667_1000111882 185
39 3300005406 Ga0070703_10074125 Ga0070703_100741252 185
40 3300005438 Ga0070701_10094831 Ga0070701_100948312 185
41 3300005441 Ga0070700_100035802 Ga0070700_1000358022 185
42 3300005456 Ga0070678_100102688 Ga0070678_1001026882 185
43 3300005457 Ga0070662_100034953 Ga0070662_1000349533 185
44 3300005459 Ga0068867_100036925 Ga0068867_1000369253 185
45 3300005543 Ga0070672_100001113 Ga0070672_10000111311 185
46 3300005543 Ga0070672_100182061 Ga0070672_1001820612 185
47 3300005616 Ga0068852_100146984 Ga0068852_1001469842 185
48 3300005617 Ga0068859_100120373 Ga0068859_1001203732 185
49 3300005618 Ga0068864_100492106 Ga0068864_1004921062 185
50 3300005718 Ga0068866_10007428 Ga0068866_100074282 185
51 3300005719 Ga0068861_100002727 Ga0068861_1000027272 185
52 3300005841 Ga0068863_100077248 Ga0068863_1000772483 185
53 3300005842 Ga0068858_100002700 Ga0068858_1000027009 185
54 3300005843 Ga0068860_100013981 Ga0068860_1000139818 185
55 3300005844 Ga0068862_100020926 Ga0068862_1000209266 185
56 3300006881 Ga0068865_100024100 Ga0068865_1000241002 185
57 3300006931 Ga0097620_100120372 Ga0097620_1001203722 185
58 3300009098 Ga0105245_10167971 Ga0105245_101679711 185
59 3300009148 Ga0105243_10140379 Ga0105243_101403792 185
60 3300009177 Ga0105248_10636553 Ga0105248_106365532 185
61 3300009553 Ga0105249_10015103 Ga0105249_100151038 185
62 3300013297 Ga0157378_10059538 Ga0157378_100595385 185
63 3300013306 Ga0163162_10004605 Ga0163162_1000460512 185
64 3300013308 Ga0157375_10027080 Ga0157375_100270805 185
65 3300014326 Ga0157380_10014744 Ga0157380_100147444 185
66 3300014968 Ga0157379_10036220 Ga0157379_100362202 185
67 3300014969 Ga0157376_10282507 Ga0157376_102825072 185
68 3300017792 Ga0163161_10015904 Ga0163161_100159046 185
69 3300025315 Ga0207697_10025515 Ga0207697_100255152 185
70 3300025885 Ga0207653_10098379 Ga0207653_100983792 185
71 3300025893 Ga0207682_10013513 Ga0207682_100135132 185
72 3300025893 Ga0207682_10038145 Ga0207682_100381452 185
73 3300025899 Ga0207642_10262576 Ga0207642_102625761 185
74 3300025903 Ga0207680_10087234 Ga0207680_100872342 185
75 3300025907 Ga0207645_10017617 Ga0207645_100176173 185
76 3300025923 Ga0207681_10000583 Ga0207681_1000058315 185
77 3300025926 Ga0207659_10028405 Ga0207659_100284052 185
78 3300025926 Ga0207659_10291351 Ga0207659_102913512 185
79 3300025927 Ga0207687_10111201 Ga0207687_101112012 185
80 3300025932 Ga0207690_10091803 Ga0207690_100918032 185
81 3300025933 Ga0207706_10054660 Ga0207706_100546602 185
82 3300025935 Ga0207709_10009377 Ga0207709_100093775 185
83 3300025937 Ga0207669_10009613 Ga0207669_100096135 185
84 3300025938 Ga0207704_10016917 Ga0207704_100169175 185
85 3300025940 Ga0207691_10067263 Ga0207691_100672632 185
86 3300025940 Ga0207691_10135842 Ga0207691_101358422 185
87 3300025941 Ga0207711_10175973 Ga0207711_101759733 185
88 3300025942 Ga0207689_10009785 Ga0207689_100097858 185
89 3300025961 Ga0207712_10024758 Ga0207712_100247585 185
90 3300025986 Ga0207658_10001932 Ga0207658_1000193210 185
91 3300026023 Ga0207677_10227531 Ga0207677_102275312 185
92 3300026035 Ga0207703_10002118 Ga0207703_1000211813 185
93 3300026075 Ga0207708_10175956 Ga0207708_101759562 185
94 3300026088 Ga0207641_10023122 Ga0207641_100231223 185
95 3300026089 Ga0207648_10033979 Ga0207648_100339792 185
96 3300026089 Ga0207648_10173131 Ga0207648_101731312 185
97 3300026089 Ga0207648_10565482 Ga0207648_105654822 185
98 3300026095 Ga0207676_10103062 Ga0207676_101030622 185
99 3300026118 Ga0207675_100019848 Ga0207675_1000198485 185
100 3300026121 Ga0207683_10162431 Ga0207683_101624312 185
101 3300026121 Ga0207683_10268442 Ga0207683_102684422 185
102 3300026142 Ga0207698_10183743 Ga0207698_101837432 185
103 3300028380 Ga0268265_10069594 Ga0268265_100695943 185
104 3300028381 Ga0268264_10001636 Ga0268264_1000163613 185
105 3300044712 Ga0453684_0456312 Ga0453684_0456312_157_858 185
106 3300005327 Ga0070658_10261865 Ga0070658_102618652 186
107 3300005328 Ga0070676_10267371 Ga0070676_102673712 186
108 3300005331 Ga0070670_100011243 Ga0070670_1000112436 186
109 3300005333 Ga0070677_10063304 Ga0070677_100633042 186
110 3300005354 Ga0070675_100038928 Ga0070675_1000389282 186
111 3300005355 Ga0070671_100139210 Ga0070671_1001392102 186
112 3300005364 Ga0070673_100023530 Ga0070673_1000235302 186
113 3300005456 Ga0070678_100057896 Ga0070678_1000578963 186
114 3300005459 Ga0068867_100329259 Ga0068867_1003292592 186
115 3300005548 Ga0070665_100365619 Ga0070665_1003656192 186
116 3300005616 Ga0068852_100305184 Ga0068852_1003051842 186
117 3300005618 Ga0068864_100043110 Ga0068864_1000431105 186
118 3300006237 Ga0097621_100028612 Ga0097621_1000286123 186
119 3300006237 Ga0097621_100178743 Ga0097621_1001787433 186
120 3300006358 Ga0068871_100017832 Ga0068871_1000178323 186
121 3300013308 Ga0157375_10316436 Ga0157375_103164363 186
122 3300014969 Ga0157376_10036236 Ga0157376_100362362 186
123 3300025907 Ga0207645_10300587 Ga0207645_103005871 186
124 3300025909 Ga0207705_10271026 Ga0207705_102710261 186
125 3300025925 Ga0207650_10006944 Ga0207650_100069443 186
126 3300025925 Ga0207650_10106220 Ga0207650_101062202 186
127 3300025926 Ga0207659_10072048 Ga0207659_100720482 186
128 3300025940 Ga0207691_10010405 Ga0207691_100104053 186
129 3300025940 Ga0207691_10467939 Ga0207691_104679392 186
130 3300025960 Ga0207651_10200900 Ga0207651_102009002 186
131 3300025986 Ga0207658_10123966 Ga0207658_101239662 186
132 3300026095 Ga0207676_10033397 Ga0207676_100333972 186
133 3300026121 Ga0207683_10070584 Ga0207683_100705845 186
134 3300026121 Ga0207683_10159500 Ga0207683_101595002 186
135 3300026142 Ga0207698_10144617 Ga0207698_101446172 186
136 3300028379 Ga0268266_10303481 Ga0268266_103034812 186
137 iso_pu_bacteria 2886848708 2886851221 186
138 3300005834 Ga0068851_10038362 Ga0068851_100383622 187
139 3300013297 Ga0157378_10380191 Ga0157378_103801912 187
140 3300005329 Ga0070683_100087166 Ga0070683_1000871662 188
141 3300005539 Ga0068853_100733400 Ga0068853_1007334001 188
142 3300005564 Ga0070664_100093819 Ga0070664_1000938193 188
143 3300026041 Ga0207639_10256461 Ga0207639_102564612 188
144 3300028794 Ga0307515_10298155 Ga0307515_102981552 188
145 3300037471 Ga0395905_0418207 Ga0395905_0418207_463_1224 188
146 3300050496 nmdc:mga07m45_62040_c1 nmdc:mga07m45_62040_c1_291_1052 188
147 3300005337 Ga0070682_100043043 Ga0070682_1000430432 190
148 3300009545 Ga0105237_10366241 Ga0105237_103662412 190
149 3300050494 nmdc:mga06z11_1592_c1 nmdc:mga06z11_1592_c1_7709_8443 190
150 3300014325 Ga0163163_10398357 Ga0163163_103983572 191
151 3300005331 Ga0070670_100484384 Ga0070670_1004843842 192
152 3300005344 Ga0070661_100261733 Ga0070661_1002617332 192
153 3300005355 Ga0070671_100019170 Ga0070671_1000191702 192
154 3300005356 Ga0070674_100086152 Ga0070674_1000861523 192
155 3300005456 Ga0070678_100159388 Ga0070678_1001593882 192
156 3300005459 Ga0068867_100024108 Ga0068867_1000241083 192
157 3300005543 Ga0070672_100127278 Ga0070672_1001272782 192
158 3300005616 Ga0068852_100311791 Ga0068852_1003117912 192
159 3300005841 Ga0068863_100569301 Ga0068863_1005693012 192
160 3300009177 Ga0105248_10142373 Ga0105248_101423732 192
161 3300025920 Ga0207649_10211697 Ga0207649_102116972 192
162 3300025925 Ga0207650_10085747 Ga0207650_100857474 192
163 3300025931 Ga0207644_10018232 Ga0207644_100182325 192
164 3300025937 Ga0207669_10067243 Ga0207669_100672432 192
165 3300025941 Ga0207711_10061435 Ga0207711_100614353 192
166 3300026088 Ga0207641_10290693 Ga0207641_102906932 192
167 3300026089 Ga0207648_10062829 Ga0207648_100628293 192
168 3300026121 Ga0207683_10156692 Ga0207683_101566922 192
169 3300035170 Ga0373943_0026299 Ga0373943_0026299_1041_1805 193
170 3300035410 Ga0373924_0006075 Ga0373924_0006075_1461_2225 193
171 3300035695 Ga0373927_0101872 Ga0373927_0101872_302_1066 193
172 3300036401 Ga0373937_0604915 Ga0373937_0604915_82_846 193
173 3300037068 Ga0373925_0054353 Ga0373925_0054353_1987_2751 193
174 3300037471 Ga0395905_0053998 Ga0395905_0053998_2705_3466 193
175 3300046535 Ga0495586_0127198 Ga0495586_0127198_275_1039 193
176 3300046663 Ga0495635_0375328 Ga0495635_0375328_90_854 193
177 3300046681 Ga0495647_0042250 Ga0495647_0042250_737_1504 193
178 3300046809 Ga0495600_0282282 Ga0495600_0282282_118_882 193
179 3300053077 Ga0495601_0031491 Ga0495601_0031491_1296_2060 193
180 3300053084 Ga0495595_0155508 Ga0495595_0155508_122_886 193
181 3300026142 Ga0207698_10046132 Ga0207698_100461325 194
182 3300005327 Ga0070658_10149037 Ga0070658_101490373 195
183 3300006353 Ga0075370_10160836 Ga0075370_101608362 195
184 3300025907 Ga0207645_10166071 Ga0207645_101660712 195
185 3300028794 Ga0307515_10021819 Ga0307515_100218197 195
186 3300031507 Ga0307509_10008466 Ga0307509_100084665 195
187 3300050493 nmdc:mga0k408_61620_c1 nmdc:mga0k408_61620_c1_710_1486 195
188 3300050496 nmdc:mga07m45_205015_c1 nmdc:mga07m45_205015_c1_279_1049 195
189 3300005843 Ga0068860_100202985 Ga0068860_1002029852 196
190 3300014968 Ga0157379_10027881 Ga0157379_100278812 196
191 3300031507 Ga0307509_10130971 Ga0307509_101309712 196
192 3300032004 Ga0307414_10025061 Ga0307414_100250613 197
193 3300032005 Ga0307411_10028175 Ga0307411_100281753 197
194 3300046457 Ga0495590_0033701 Ga0495590_0033701_604_1380 197
195 3300046519 Ga0495632_0008447 Ga0495632_0008447_5260_6036 197
196 3300046694 Ga0495649_0019487 Ga0495649_0019487_2975_3751 197
197 3300047443 Ga0495687_000615 Ga0495687_000615_38728_39504 197
198 3300047443 Ga0495687_000811 Ga0495687_000811_1834_2610 197
199 3300048091 Ga0495626_0024554 Ga0495626_0024554_1085_1861 197
200 3300053134 Ga0500658_0002462 Ga0500658_0002462_163_939 197
201 3300005459 Ga0068867_100084974 Ga0068867_1000849742 198
202 3300026089 Ga0207648_10185326 Ga0207648_101853262 198
203 3300028794 Ga0307515_10006229 Ga0307515_100062293 198
204 3300031507 Ga0307509_10012377 Ga0307509_100123773 198
205 3300031548 Ga0307408_100258867 Ga0307408_1002588672 198
206 3300031616 Ga0307508_10007419 Ga0307508_100074198 198
207 3300031616 Ga0307508_10016592 Ga0307508_100165925 198
208 3300031616 Ga0307508_10055154 Ga0307508_100551542 198
209 3300031730 Ga0307516_10373260 Ga0307516_103732602 198
210 3300032002 Ga0307416_100072987 Ga0307416_1000729872 198
211 3300033179 Ga0307507_10123500 Ga0307507_101235003 198
212 3300033180 Ga0307510_10064818 Ga0307510_100648183 198
213 3300033180 Ga0307510_10065087 Ga0307510_100650873 198
214 3300046616 Ga0495668_0079465 Ga0495668_0079465_173_949 199
215 3300046660 Ga0495625_0010060 Ga0495625_0010060_6741_7517 199
216 3300046810 Ga0495660_0016858 Ga0495660_0016858_240_1016 199
217 3300053139 Ga0500568_0023945 Ga0500568_0023945_897_1673 199
218 3300050493 nmdc:mga0k408_130826_c1 nmdc:mga0k408_130826_c1_414_1157 201
219 3300006038 Ga0075365_10042934 Ga0075365_100429344 202
220 3300006048 Ga0075363_100302442 Ga0075363_1003024421 202
221 3300025937 Ga0207669_10143810 Ga0207669_101438102 202
222 3300042122 Ga0450920_006884 Ga0450920_006884_874_1620 202
223 3300050493 nmdc:mga0k408_308_c1 nmdc:mga0k408_308_c1_1935_2714 202
224 3300050496 nmdc:mga07m45_170_c1 nmdc:mga07m45_170_c1_21458_22237 202
225 3300050496 nmdc:mga07m45_64179_c1 nmdc:mga07m45_64179_c1_876_1649 202
226 3300021361 Ga0213872_10000528 Ga0213872_100005288 203
227 3300039447 Ga0436361_0162124 Ga0436361_0162124_532_1320 203
228 iso_pu_bacteria 2643221644 2644246537 203
229 3300005339 Ga0070660_100240931 Ga0070660_1002409312 204
230 3300005344 Ga0070661_100003258 Ga0070661_1000032586 204
231 3300005366 Ga0070659_100044882 Ga0070659_1000448824 204
232 3300005564 Ga0070664_100011508 Ga0070664_1000115082 204
233 3300005564 Ga0070664_100070590 Ga0070664_1000705902 204
234 3300006195 Ga0075366_10012833 Ga0075366_100128336 204
235 3300025919 Ga0207657_10165210 Ga0207657_101652102 204
236 3300025920 Ga0207649_10000359 Ga0207649_100003594 204
237 3300025932 Ga0207690_10029235 Ga0207690_100292355 204
238 3300025945 Ga0207679_10000047 Ga0207679_1000004760 204
239 3300025945 Ga0207679_10015999 Ga0207679_100159995 204
240 iso_pu_bacteria 2585428062 2587759325 204
241 iso_pu_bacteria 2643221544 2643744946 204
242 iso_pu_bacteria 2643221585 2643937349 204
243 iso_pu_bacteria 2643221646 2644260733 204
244 iso_pu_bacteria 2643221656 2644318514 204
245 3300003775 Ga0055524_1000121 Ga0055524_100012124 205
246 3300003791 Ga0055530_10003903 Ga0055530_100039037 205
247 3300003792 Ga0055540_1000001 Ga0055540_1000001337 205
248 3300003794 Ga0055531_10007705 Ga0055531_100077055 205
249 3300006195 Ga0075366_10037401 Ga0075366_100374012 205
250 3300006946 Ga0079104_1000001 Ga0079104_1000001430 205
251 3300009147 Ga0114129_10393015 Ga0114129_103930152 205
252 3300025291 Ga0209675_1014267 Ga0209675_10142673 205
253 3300025298 Ga0209050_1000934 Ga0209050_100093426 205
254 3300025298 Ga0209050_1019785 Ga0209050_10197852 205
255 3300025299 Ga0209256_1000015 Ga0209256_1000015516 205
256 3300025303 Ga0209051_1000018 Ga0209051_1000018117 205
257 3300025304 Ga0209257_1000084 Ga0209257_1000084255 205
258 3300027111 Ga0209281_1000151 Ga0209281_1000151113 205
259 3300035691 Ga0373931_0028022 Ga0373931_0028022_1404_2165 205
260 3300042121 Ga0450919_000263 Ga0450919_000263_4469_5230 205
261 3300042531 Ga0450918_002926 Ga0450918_002926_2053_2814 205
262 3300044712 Ga0453684_0001396 Ga0453684_0001396_47904_48665 205
263 3300048917 Ga0496114_0023523 Ga0496114_0023523_377_1138 205
264 3300050507 nmdc:mga05p37_335284_c1 nmdc:mga05p37_335284_c1_886_1644 205
265 iso_pu_bacteria 2643221654 2644302894 205
266 iso_pu_bacteria 2738541337 2739058883 205
267 3300003316 rootH1_10016292 rootH1_100162923 206
268 3300003322 rootL2_10027282 rootL2_1002728224 206
269 3300003323 rootH1_10030030 rootH1_100300302 206
270 3300003794 Ga0055531_10000007 Ga0055531_10000007158 206
271 3300005367 Ga0070667_100000606 Ga0070667_10000060634 206
272 3300005843 Ga0068860_100475643 Ga0068860_1004756432 206
273 3300006195 Ga0075366_10206744 Ga0075366_102067441 206
274 3300009148 Ga0105243_10047607 Ga0105243_100476074 206
275 3300014968 Ga0157379_10724633 Ga0157379_107246332 206
276 3300025298 Ga0209050_1006974 Ga0209050_10069744 206
277 3300025303 Ga0209051_1012745 Ga0209051_10127452 206
278 3300025304 Ga0209257_1000021 Ga0209257_100002170 206
279 3300025935 Ga0207709_10131369 Ga0207709_101313693 206
280 3300025986 Ga0207658_10006803 Ga0207658_100068033 206
281 3300027876 Ga0209974_10000696 Ga0209974_1000069613 206
282 3300028381 Ga0268264_10287364 Ga0268264_102873642 206
283 3300028794 Ga0307515_10002251 Ga0307515_1000225144 206
284 3300028794 Ga0307515_10004349 Ga0307515_1000434928 206
285 3300028794 Ga0307515_10012576 Ga0307515_1001257616 206
286 3300030522 Ga0307512_10207865 Ga0307512_102078652 206
287 3300031250 Ga0265331_10001541 Ga0265331_100015419 206
288 3300031251 Ga0265327_10000012 Ga0265327_1000001223 206
289 3300031456 Ga0307513_10032159 Ga0307513_100321594 206
290 3300031456 Ga0307513_10042494 Ga0307513_100424942 206
291 3300031456 Ga0307513_10314430 Ga0307513_103144302 206
292 3300031507 Ga0307509_10034866 Ga0307509_100348665 206
293 3300031616 Ga0307508_10000123 Ga0307508_1000012344 206
294 3300031649 Ga0307514_10081062 Ga0307514_100810622 206
295 3300031730 Ga0307516_10004481 Ga0307516_100044814 206
296 3300033179 Ga0307507_10073510 Ga0307507_100735102 206
297 3300037068 Ga0373925_0229789 Ga0373925_0229789_235_999 206
298 3300037471 Ga0395905_0002152 Ga0395905_0002152_16793_17554 206
299 3300037471 Ga0395905_0005995 Ga0395905_0005995_8289_9053 206
300 3300041512 Ga0451853_2928907 Ga0451853_2928907_129_893 206
301 3300041997 Ga0439431_0046161 Ga0439431_0046161_332_1099 206
302 3300042126 Ga0450888_001195 Ga0450888_001195_1555_2316 206
303 3300042130 Ga0450892_000133 Ga0450892_000133_7095_7856 206
304 3300042144 Ga0450889_002052 Ga0450889_002052_1108_1869 206
305 3300045051 Ga0451576_0045916 Ga0451576_0045916_776_1540 206
306 3300045051 Ga0451576_0260827 Ga0451576_0260827_470_1228 206
307 3300046454 Ga0495592_0147759 Ga0495592_0147759_706_1470 206
308 3300046512 Ga0495610_0016022 Ga0495610_0016022_1368_2132 206
309 3300046519 Ga0495632_0016713 Ga0495632_0016713_456_1220 206
310 3300046522 Ga0495643_0016473 Ga0495643_0016473_620_1384 206
311 3300046660 Ga0495625_0000929 Ga0495625_0000929_5500_6264 206
312 3300047472 Ga0495686_0056504 Ga0495686_0056504_599_1363 206
313 3300048905 Ga0496102_0002833 Ga0496102_0002833_9028_9792 206
314 3300049658 Ga0501211_000441 Ga0501211_000441_677_1438 206
315 3300049669 Ga0501235_039124 Ga0501235_039124_250_1011 206
316 3300049706 Ga0501229_000532 Ga0501229_000532_3441_4202 206
317 3300050493 nmdc:mga0k408_2867_c1 nmdc:mga0k408_2867_c1_999_1775 206
318 3300050496 nmdc:mga07m45_131726_c1 nmdc:mga07m45_131726_c1_626_1390 206
319 3300050496 nmdc:mga07m45_72014_c1 nmdc:mga07m45_72014_c1_1044_1808 206
320 3300053088 Ga0500644_0170817 Ga0500644_0170817_66_830 206
321 3300053117 Ga0500593_014225 Ga0500593_014225_500_1264 206
322 3300053134 Ga0500658_0030106 Ga0500658_0030106_227_991 206
323 3300053148 Ga0500590_002719 Ga0500590_002719_4157_4921 206
324 3300053154 Ga0500619_000016 Ga0500619_000016_31259_32026 206
325 3300053739 Ga0500587_004355 Ga0500587_004355_220_984 206
326 iso_pu_bacteria 2643221639 2644222859 206
327 3300003322 rootL2_10031835 rootL2_100318352 207
328 3300003759 Ga0055525_1000004 Ga0055525_1000004446 207
329 3300005331 Ga0070670_100124087 Ga0070670_1001240872 207
330 3300005334 Ga0068869_100032980 Ga0068869_1000329802 207
331 3300005338 Ga0068868_100131718 Ga0068868_1001317181 207
332 3300005354 Ga0070675_100041985 Ga0070675_1000419855 207
333 3300005364 Ga0070673_100153569 Ga0070673_1001535692 207
334 3300005367 Ga0070667_100196641 Ga0070667_1001966412 207
335 3300005455 Ga0070663_100000279 Ga0070663_10000027922 207
336 3300005457 Ga0070662_100006467 Ga0070662_1000064675 207
337 3300005459 Ga0068867_100000453 Ga0068867_1000004535 207
338 3300005459 Ga0068867_100071565 Ga0068867_1000715652 207
339 3300005543 Ga0070672_100134731 Ga0070672_1001347312 207
340 3300005548 Ga0070665_100820516 Ga0070665_1008205161 207
341 3300005616 Ga0068852_100089152 Ga0068852_1000891523 207
342 3300005843 Ga0068860_100072591 Ga0068860_1000725914 207
343 3300006195 Ga0075366_10096570 Ga0075366_100965702 207
344 3300006195 Ga0075366_10099467 Ga0075366_100994672 207
345 3300006880 Ga0075429_100031123 Ga0075429_1000311234 207
346 3300009098 Ga0105245_10136994 Ga0105245_101369943 207
347 3300009148 Ga0105243_10002357 Ga0105243_1000235712 207
348 3300013102 Ga0157371_10125634 Ga0157371_101256342 207
349 3300014326 Ga0157380_10235372 Ga0157380_102353722 207
350 3300014745 Ga0157377_10000088 Ga0157377_1000008863 207
351 3300021361 Ga0213872_10000566 Ga0213872_1000056615 207
352 3300025230 Ga0209563_100013 Ga0209563_100013446 207
353 3300025907 Ga0207645_10026576 Ga0207645_100265763 207
354 3300025925 Ga0207650_10079182 Ga0207650_100791822 207
355 3300025925 Ga0207650_10236880 Ga0207650_102368801 207
356 3300025926 Ga0207659_10125242 Ga0207659_101252422 207
357 3300025933 Ga0207706_10002836 Ga0207706_100028367 207
358 3300025935 Ga0207709_10006590 Ga0207709_100065903 207
359 3300025940 Ga0207691_10099815 Ga0207691_100998152 207
360 3300025986 Ga0207658_10135184 Ga0207658_101351843 207
361 3300026023 Ga0207677_10114896 Ga0207677_101148961 207
362 3300026067 Ga0207678_10001700 Ga0207678_100017002 207
363 3300026089 Ga0207648_10000019 Ga0207648_1000001956 207
364 3300026142 Ga0207698_10115158 Ga0207698_101151582 207
365 3300028381 Ga0268264_10125012 Ga0268264_101250124 207
366 3300028786 Ga0307517_10000174 Ga0307517_1000017459 207
367 3300031730 Ga0307516_10029903 Ga0307516_100299033 207
368 3300032004 Ga0307414_10554357 Ga0307414_105543572 207
369 3300035114 Ga0373939_0045924 Ga0373939_0045924_99_860 207
370 3300039437 Ga0436365_0104771 Ga0436365_0104771_326_1096 207
371 3300039447 Ga0436361_0487065 Ga0436361_0487065_6360_7127 207
372 3300044656 Ga0466969_0020472 Ga0466969_0020472_924_1694 207
373 3300044684 Ga0466966_0115382 Ga0466966_0115382_522_1292 207
374 3300044693 Ga0466961_0046262 Ga0466961_0046262_1023_1793 207
375 3300044842 Ga0466957_0053761 Ga0466957_0053761_1237_2007 207
376 3300045049 Ga0466959_0065265 Ga0466959_0065265_1503_2273 207
377 3300046471 Ga0495650_0001962 Ga0495650_0001962_6864_7649 207
378 3300048927 Ga0496124_0000596 Ga0496124_0000596_20696_21469 207
379 3300048928 Ga0496125_0008584 Ga0496125_0008584_1034_1807 207
380 3300050493 nmdc:mga0k408_110229_c1 nmdc:mga0k408_110229_c1_595_1365 207
381 3300050493 nmdc:mga0k408_3464_c2 nmdc:mga0k408_3464_c2_4918_5682 207
382 3300005841 Ga0068863_100217723 Ga0068863_1002177232 208
383 3300006195 Ga0075366_10003609 Ga0075366_100036097 208
384 3300006195 Ga0075366_10018328 Ga0075366_100183283 208
385 3300031548 Ga0307408_100399262 Ga0307408_1003992622 208
386 3300035114 Ga0373939_0040288 Ga0373939_0040288_247_1017 208
387 3300037471 Ga0395905_0001227 Ga0395905_0001227_9325_10131 208
388 3300037471 Ga0395905_0013875 Ga0395905_0013875_2006_2779 208
389 3300044683 Ga0466965_0060016 Ga0466965_0060016_1057_1839 208
390 3300044694 Ga0466963_0144364 Ga0466963_0144364_396_1178 208
391 3300044706 Ga0466964_0000349 Ga0466964_0000349_6652_7434 208
392 3300044719 Ga0466971_0105877 Ga0466971_0105877_162_944 208
393 3300044842 Ga0466957_0124894 Ga0466957_0124894_389_1171 208
394 3300045049 Ga0466959_0000920 Ga0466959_0000920_13097_13879 208
395 3300045836 Ga0466958_0000143 Ga0466958_0000143_158_940 208
396 3300045976 Ga0466967_0012414 Ga0466967_0012414_4562_5344 208
397 3300046522 Ga0495643_0148673 Ga0495643_0148673_40_813 208
398 3300046557 Ga0495622_0093585 Ga0495622_0093585_186_959 208
399 3300048903 Ga0496100_0173439 Ga0496100_0173439_336_1106 208
400 3300050493 nmdc:mga0k408_23091_c1 nmdc:mga0k408_23091_c1_1176_1949 208
401 3300050493 nmdc:mga0k408_6803_c1 nmdc:mga0k408_6803_c1_1434_2207 208
402 3300005334 Ga0068869_100306482 Ga0068869_1003064822 209
403 3300005455 Ga0070663_100102106 Ga0070663_1001021061 209
404 3300005457 Ga0070662_100072639 Ga0070662_1000726392 209
405 3300006038 Ga0075365_10160366 Ga0075365_101603662 209
406 3300006051 Ga0075364_10110554 Ga0075364_101105542 209
407 3300006177 Ga0075362_10004098 Ga0075362_100040982 209
408 3300006178 Ga0075367_10024677 Ga0075367_100246774 209
409 3300006195 Ga0075366_10000139 Ga0075366_1000013925 209
410 3300006195 Ga0075366_10025054 Ga0075366_100250542 209
411 3300006195 Ga0075366_10075464 Ga0075366_100754642 209
412 3300006195 Ga0075366_10108887 Ga0075366_101088872 209
413 3300006353 Ga0075370_10001015 Ga0075370_100010159 209
414 3300006353 Ga0075370_10002597 Ga0075370_100025976 209
415 3300006353 Ga0075370_10007451 Ga0075370_100074516 209
416 3300021361 Ga0213872_10000469 Ga0213872_100004698 209
417 3300021361 Ga0213872_10007772 Ga0213872_100077723 209
418 3300025933 Ga0207706_10181137 Ga0207706_101811372 209
419 3300025942 Ga0207689_10205665 Ga0207689_102056653 209
420 3300026067 Ga0207678_10061843 Ga0207678_100618433 209
421 3300031456 Ga0307513_10120650 Ga0307513_101206503 209
422 3300031456 Ga0307513_10190586 Ga0307513_101905862 209
423 3300039447 Ga0436361_0587802 Ga0436361_0587802_2756_3535 209
424 3300039447 Ga0436361_1117053 Ga0436361_1117053_3569_4354 209
425 3300047443 Ga0495687_000327 Ga0495687_000327_17307_18083 209
426 3300050489 nmdc:mga03683_7461_c1 nmdc:mga03683_7461_c1_218_994 209
427 3300050493 nmdc:mga0k408_1196_c1 nmdc:mga0k408_1196_c1_12544_13320 209
428 3300050494 nmdc:mga06z11_27602_c1 nmdc:mga06z11_27602_c1_645_1421 209
429 3300050495 nmdc:mga04h51_20014_c1 nmdc:mga04h51_20014_c1_809_1585 209
430 3300050496 nmdc:mga07m45_1972_c1 nmdc:mga07m45_1972_c1_2536_3312 209
431 3300050496 nmdc:mga07m45_27852_c1 nmdc:mga07m45_27852_c1_760_1536 209
432 3300050496 nmdc:mga07m45_996_c1 nmdc:mga07m45_996_c1_6773_7549 209
433 3300003322 rootL2_10004981 rootL2_1000498120 210
434 3300048912 Ga0496109_0055399 Ga0496109_0055399_224_1069 210
435 iso_pu_bacteria 2831864461 2831869327 212
436 3300031239 Ga0265328_10051771 Ga0265328_100517712 213
437 3300031251 Ga0265327_10001086 Ga0265327_1000108622 213
438 3300048912 Ga0496109_0157585 Ga0496109_0157585_958_1770 213
439 3300048913 Ga0496110_0106737 Ga0496110_0106737_893_1705 213
440 3300003323 rootH1_10022507 rootH1_100225072 215
441 3300003775 Ga0055524_1002725 Ga0055524_10027257 215
442 3300003791 Ga0055530_10035106 Ga0055530_100351062 215
443 3300003794 Ga0055531_10001660 Ga0055531_100016608 215
444 3300006944 Ga0099823_1000021 Ga0099823_100002165 215
445 3300025273 Ga0209673_1007134 Ga0209673_10071344 215
446 3300025298 Ga0209050_1003281 Ga0209050_10032817 215
447 3300025299 Ga0209256_1002394 Ga0209256_10023947 215
448 3300025303 Ga0209051_1000469 Ga0209051_100046913 215
449 3300025304 Ga0209257_1002583 Ga0209257_100258310 215
450 3300027296 Ga0209389_1000341 Ga0209389_100034126 215
451 3300027312 Ga0209371_1015531 Ga0209371_10155312 215
452 3300003316 rootH1_10008969 rootH1_1000896911 216
453 3300003323 rootH1_10046719 rootH1_100467191 216
454 3300003775 Ga0055524_1001224 Ga0055524_10012249 216
455 3300003794 Ga0055531_10005441 Ga0055531_100054418 216
456 3300004625 Ga0055543_1002116 Ga0055543_10021167 216
457 3300005262 Ga0065165_1000016 Ga0065165_100001687 216
458 3300006195 Ga0075366_10059196 Ga0075366_100591963 216
459 3300006353 Ga0075370_10010483 Ga0075370_100104833 216
460 3300012497 Ga0157319_1000027 Ga0157319_100002743 216
461 3300025295 Ga0209564_1000008 Ga0209564_1000008457 216
462 3300025299 Ga0209256_1000424 Ga0209256_100042453 216
463 3300025304 Ga0209257_1000946 Ga0209257_100094631 216
464 3300027312 Ga0209371_1015850 Ga0209371_10158502 216
465 3300030500 Ga0268256_1013251 Ga0268256_10132512 216
466 3300031344 Ga0265316_10000430 Ga0265316_100004308 216
467 3300031548 Ga0307408_100638499 Ga0307408_1006384992 216
468 3300042438 Ga0439459_0000026 Ga0439459_0000026_4836_5627 216
469 3300048927 Ga0496124_0008511 Ga0496124_0008511_1543_2334 216
470 3300050493 nmdc:mga0k408_74649_c1 nmdc:mga0k408_74649_c1_480_1271 216
471 3300050496 nmdc:mga07m45_10651_c1 nmdc:mga07m45_10651_c1_3604_4395 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

74

261

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.8453 1 145
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.8384 1 145
3hh1-assembly1.cif.gz_B the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.767 3 146
3hh1-assembly1.cif.gz_B the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.7549 3 146
2ybq-assembly1.cif.gz_A-2 the x-ray structure of the sam-dependent uroporphyrinogen iii methyltransferase nire from pseudomonas aeruginosa in complex with sah and uroporphyrinogen iii 0.6861 2 146
ID Description Score Start End Superfamily
1wyzC01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8528 3 147 3.40.1010.10
1wyzC01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8455 3 147 3.40.1010.10
af_A0A0R4IGH3_135_264_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.767 176 214 3.40.630.30
af_P9WGW7_1_114_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.7424 1 145 3.40.1010.10
af_P9WGW7_1_114_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.7368 1 145 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A4Q3P893-F1-model_v4 deleted 0.9508 4 73
AF-A0A5C7P3D6-F1-model_v4 Ribosomal RNA small subunit methyltransferase I 0.8817 1 85 GO:0008168
GO:0032259
AF-A0A5C7P3D6-F1-model_v4 Ribosomal RNA small subunit methyltransferase I 0.8619 1 85 GO:0008168
GO:0032259
AF-A0A4Q3PYE0-F1-model_v4 deleted 0.8439 1 109
AF-A0A4Q3PYE0-F1-model_v4 deleted 0.8358 1 109

Feature Viewer

pLDDT pTM Quality
74.62 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map