F450546

General Info

Members Datasets Scaffolds Average Seq Length
471 269 942 447

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100003478|Ga0070706_10000347814
Length 506
Sequence MYPQGTWHRPRAGLHRPGWKVPSAQGLKKKILRLSLQIAGVVAVTGLLGASMAYDDVRERLARHVLTDGFHLILDLPRSHGSWIADARGGKRYLDLYSFFASAPLGINPPDVVGDQAFLGMLAEAAANKPTNPDIYTAHYADFVDTFARVLGDPALPHLFFIEGGALAVENALKCAFDWKSRHNEMRGRSPQLGTKVLHLTRAFHGRSGYTLSLTNTDPVKTDRFPKFDWPRIEVPAITFPLGEHLREVVAGEQRALRQAEAAFREHPDDIACFVAEPIQGEGGDNHMRPEFLQAMQRLCQDNEALFVLDEVQTGVGLTGTPWAYQQLGLAPDIVAFGKKVQLGGIMAGRRVDEVPGNVFAVSGRINSTWGGGLADMVRCRRLLEVIERDRLVDRVAAVGSWFLAELQALASRYPDLVSNVRGRGLMCALDLPGAEERDALVTALRDEEQVLLLPCGSTSIRFRPALTIAEDDLASGLKALDRCLARLPVVSARTMSHRQGEGEHG

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
132 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
133 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
162 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 2547132424 Nocardia nova SH22a Isolate Unclassified
253 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
254 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
255 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
256 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
257 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
258 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
259 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
260 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
261 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
262 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
263 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
264 2891562705 Microbispora tritici MT50 Isolate Unclassified
265 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
266 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
267 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
268 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
269 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.18
Metatranscriptomes 0
Isolates 3.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 8.28
Rhizosphere 85.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100003478 3300005467 Bacteria 15486
2 JGI24739J22299_10025247 3300001989 Bacteria 2090
3 JGI24745J21846_1002753 3300002073 Bacteria 1812
4 JGI25406J46586_10018151 3300003203 Bacteria 2895
5 Ga0055540_1003625 3300003792 Bacteria 7367
6 Ga0070658_10000592 3300005327 Bacteria 31417
7 Ga0070683_100048042 3300005329 Bacteria 3945
8 Ga0070683_100129776 3300005329 Bacteria 2385
9 Ga0070666_10025814 3300005335 Bacteria 3833
10 Ga0070680_100000007 3300005336 Bacteria 104173
11 Ga0070680_100128947 3300005336 Bacteria 2115
12 Ga0070682_100043923 3300005337 Bacteria 2765
13 Ga0068868_100047763 3300005338 Bacteria 3356
14 Ga0070660_100034738 3300005339 Bacteria 3811
15 Ga0070660_100050095 3300005339 Bacteria 3213
16 Ga0070660_100089036 3300005339 Bacteria 2432
17 Ga0070689_100102899 3300005340 Bacteria 2263
18 Ga0070668_100003088 3300005347 Bacteria 12308
19 Ga0070671_100013557 3300005355 Bacteria 6572
20 Ga0070671_100046009 3300005355 Bacteria 3628
21 Ga0070674_100086563 3300005356 Bacteria 2251
22 Ga0070688_100101541 3300005365 Bacteria 1897
23 Ga0070659_100030044 3300005366 Bacteria 4204
24 Ga0070709_10000641 3300005434 Bacteria 19967
25 Ga0070714_100019556 3300005435 Bacteria 5519
26 Ga0070714_100022792 3300005435 Bacteria 5137
27 Ga0070714_100060639 3300005435 Bacteria 3247
28 Ga0070714_100097452 3300005435 Bacteria 2585
29 Ga0070713_100006565 3300005436 Bacteria 8081
30 Ga0070713_100017613 3300005436 Bacteria 5407
31 Ga0070713_100026121 3300005436 Bacteria 4579
32 Ga0070710_10000175 3300005437 Bacteria 29456
33 Ga0070710_10051263 3300005437 Bacteria 2316
34 Ga0070710_10113524 3300005437 Bacteria 1630
35 Ga0070710_10129566 3300005437 Bacteria 1536
36 Ga0070678_100015831 3300005456 Bacteria 4804
37 Ga0070678_100110141 3300005456 Bacteria 2153
38 Ga0070681_10000024 3300005458 Bacteria 111597
39 Ga0070681_10008763 3300005458 Bacteria 9928
40 Ga0070681_10062786 3300005458 Bacteria 3688
41 Ga0070706_100054068 3300005467 Bacteria 3706
42 Ga0070706_100168926 3300005467 Bacteria 2042
43 Ga0070707_100010871 3300005468 Bacteria 8478
44 Ga0070707_100024117 3300005468 Bacteria 5758
45 Ga0070707_100197359 3300005468 Bacteria 1962
46 Ga0070698_100001112 3300005471 Bacteria 29679
47 Ga0070698_100031924 3300005471 Bacteria 5458
48 Ga0070698_100054264 3300005471 Bacteria 4070
49 Ga0070699_100077022 3300005518 Bacteria 2903
50 Ga0070679_100000109 3300005530 Bacteria 65139
51 Ga0070679_100001173 3300005530 Bacteria 22930
52 Ga0070679_100010858 3300005530 Bacteria 8652
53 Ga0070679_100329723 3300005530 Bacteria 1475
54 Ga0070684_100014981 3300005535 Bacteria 6296
55 Ga0070684_100146932 3300005535 Bacteria 2134
56 Ga0070672_100049324 3300005543 Bacteria 3275
57 Ga0070696_100000187 3300005546 Bacteria 36190
58 Ga0070696_100066755 3300005546 Bacteria 2523
59 Ga0070696_100161585 3300005546 Bacteria 1650
60 Ga0070665_100182778 3300005548 Bacteria 2097
61 Ga0070665_100399066 3300005548 Bacteria 1383
62 Ga0068855_100039251 3300005563 Bacteria 5620
63 Ga0068855_100103303 3300005563 Bacteria 3279
64 Ga0068855_100125484 3300005563 Bacteria 2935
65 Ga0068854_100082691 3300005578 Bacteria 2373
66 Ga0068856_100008601 3300005614 Bacteria 9925
67 Ga0068856_100027770 3300005614 Bacteria 5521
68 Ga0070702_100032643 3300005615 Bacteria 2857
69 Ga0068852_100025472 3300005616 Bacteria 4793
70 Ga0068861_100128781 3300005719 Bacteria 2052
71 Ga0068851_10044098 3300005834 Bacteria 2250
72 Ga0068863_100009857 3300005841 Bacteria 9307
73 Ga0068863_100023852 3300005841 Bacteria 5838
74 Ga0068858_100027416 3300005842 Bacteria 5292
75 Ga0068860_100048813 3300005843 Bacteria 4034
76 Ga0068860_100253583 3300005843 Bacteria 1714
77 Ga0068862_100083095 3300005844 Bacteria 2781
78 Ga0081455_10028070 3300005937 Bacteria 5146
79 Ga0081538_10000421 3300005981 Bacteria 47733
80 Ga0081540_1000582 3300005983 Bacteria 35204
81 Ga0081539_10007550 3300005985 Bacteria 9847
82 Ga0070717_10002954 3300006028 Bacteria 12079
83 Ga0070717_10020246 3300006028 Bacteria 5229
84 Ga0070717_10025934 3300006028 Bacteria 4671
85 Ga0070717_10071063 3300006028 Bacteria 2902
86 Ga0070717_10212182 3300006028 Bacteria 1699
87 Ga0075365_10069342 3300006038 Bacteria 2370
88 Ga0070715_10030656 3300006163 Bacteria 2176
89 Ga0070716_100000768 3300006173 Bacteria 13782
90 Ga0070712_100000962 3300006175 Bacteria 17331
91 Ga0070712_100079894 3300006175 Bacteria 2365
92 Ga0070712_100116051 3300006175 Bacteria 2007
93 Ga0070712_100156907 3300006175 Bacteria 1753
94 Ga0097621_100122975 3300006237 Bacteria 2203
95 Ga0068871_100018485 3300006358 Bacteria 5298
96 Ga0075428_100067320 3300006844 Bacteria 3921
97 Ga0075430_100118564 3300006846 Bacteria 2206
98 Ga0075433_10012825 3300006852 Bacteria 6790
99 Ga0075433_10022000 3300006852 Bacteria 5350
100 Ga0075434_100020328 3300006871 Bacteria 6438
101 Ga0075434_100029299 3300006871 Bacteria 5414
102 Ga0075434_100038865 3300006871 Bacteria 4715
103 Ga0075434_100349154 3300006871 Bacteria 1500
104 Ga0075429_100023412 3300006880 Bacteria 5360
105 Ga0068865_100043487 3300006881 Bacteria 3070
106 Ga0068865_100076415 3300006881 Bacteria 2390
107 Ga0075436_100016131 3300006914 Bacteria 5114
108 Ga0075436_100134828 3300006914 Bacteria 1733
109 Ga0075435_100024466 3300007076 Bacteria 4688
110 Ga0105240_10059876 3300009093 Bacteria 4750
111 Ga0111539_10002580 3300009094 Bacteria 23985
112 Ga0111539_10042055 3300009094 Bacteria 5490
113 Ga0105245_10058649 3300009098 Bacteria 3465
114 Ga0105247_10005178 3300009101 Bacteria 8245
115 Ga0105247_10072049 3300009101 Bacteria 2162
116 Ga0105247_10103516 3300009101 Bacteria 1823
117 Ga0114129_10006841 3300009147 Bacteria 16205
118 Ga0114129_10078028 3300009147 Bacteria 4607
119 Ga0105241_10035570 3300009174 Bacteria 3746
120 Ga0105248_10025400 3300009177 Bacteria 6586
121 Ga0105248_10262339 3300009177 Bacteria 1945
122 Ga0105238_10045442 3300009551 Bacteria 4436
123 Ga0105249_10098782 3300009553 Bacteria 2743
124 Ga0105246_10047111 3300011119 Bacteria 2943
125 Ga0157374_10018752 3300013296 Bacteria 6113
126 Ga0157378_10036927 3300013297 Bacteria 4325
127 Ga0163162_10028262 3300013306 Bacteria 5548
128 Ga0163162_10053609 3300013306 Bacteria 4054
129 Ga0157372_10077601 3300013307 Bacteria 3752
130 Ga0157375_10040438 3300013308 Bacteria 4494
131 Ga0163163_10070619 3300014325 Bacteria 3478
132 Ga0163163_10107908 3300014325 Bacteria 2810
133 Ga0163163_10237258 3300014325 Bacteria 1873
134 Ga0157377_10013819 3300014745 Bacteria 4093
135 Ga0157379_10060788 3300014968 Bacteria 3378
136 Ga0157376_10005320 3300014969 Bacteria 8988
137 Ga0157376_10040125 3300014969 Bacteria 3824
138 Ga0163161_10092949 3300017792 Bacteria 2234
139 Ga0213873_10000498 3300021358 Bacteria 6325
140 Ga0209051_1000630 3300025303 Bacteria 40553
141 Ga0207692_10000758 3300025898 Bacteria 11415
142 Ga0207692_10016231 3300025898 Bacteria 3292
143 Ga0207692_10040191 3300025898 Bacteria 2307
144 Ga0207692_10056508 3300025898 Bacteria 2013
145 Ga0207692_10077443 3300025898 Bacteria 1769
146 Ga0207710_10045380 3300025900 Bacteria 1960
147 Ga0207647_10016372 3300025904 Bacteria 5062
148 Ga0207647_10053522 3300025904 Bacteria 2487
149 Ga0207685_10009711 3300025905 Bacteria 2807
150 Ga0207699_10001694 3300025906 Bacteria 10432
151 Ga0207699_10004816 3300025906 Bacteria 6458
152 Ga0207699_10005776 3300025906 Bacteria 5951
153 Ga0207699_10012586 3300025906 Bacteria 4307
154 Ga0207643_10067192 3300025908 Bacteria 2057
155 Ga0207705_10000683 3300025909 Bacteria 28088
156 Ga0207684_10002141 3300025910 Bacteria 20227
157 Ga0207707_10000059 3300025912 Bacteria 110997
158 Ga0207707_10018344 3300025912 Bacteria 6098
159 Ga0207693_10009521 3300025915 Bacteria 7913
160 Ga0207693_10022613 3300025915 Bacteria 4995
161 Ga0207693_10060907 3300025915 Bacteria 2956
162 Ga0207693_10116481 3300025915 Bacteria 2098
163 Ga0207663_10034675 3300025916 Bacteria 3020
164 Ga0207663_10036996 3300025916 Bacteria 2940
165 Ga0207660_10000229 3300025917 Bacteria 36124
166 Ga0207657_10022599 3300025919 Bacteria 5879
167 Ga0207652_10000020 3300025921 Bacteria 159903
168 Ga0207652_10010895 3300025921 Bacteria 7328
169 Ga0207652_10067228 3300025921 Bacteria 3107
170 Ga0207646_10009481 3300025922 Bacteria 9620
171 Ga0207646_10039968 3300025922 Bacteria 4221
172 Ga0207646_10045335 3300025922 Bacteria 3947
173 Ga0207646_10257102 3300025922 Bacteria 1579
174 Ga0207700_10000154 3300025928 Bacteria 40709
175 Ga0207700_10014034 3300025928 Bacteria 5236
176 Ga0207700_10029520 3300025928 Bacteria 3870
177 Ga0207700_10031744 3300025928 Bacteria 3756
178 Ga0207700_10036852 3300025928 Bacteria 3536
179 Ga0207700_10056533 3300025928 Bacteria 2954
180 Ga0207664_10000211 3300025929 Bacteria 44314
181 Ga0207664_10015601 3300025929 Bacteria 5520
182 Ga0207664_10016388 3300025929 Bacteria 5407
183 Ga0207664_10018077 3300025929 Bacteria 5180
184 Ga0207664_10037052 3300025929 Bacteria 3772
185 Ga0207664_10053861 3300025929 Bacteria 3186
186 Ga0207664_10088025 3300025929 Bacteria 2540
187 Ga0207664_10146964 3300025929 Bacteria 2000
188 Ga0207644_10087680 3300025931 Bacteria 2313
189 Ga0207690_10078857 3300025932 Bacteria 2293
190 Ga0207669_10002655 3300025937 Bacteria 7656
191 Ga0207665_10000331 3300025939 Bacteria 32656
192 Ga0207665_10015581 3300025939 Bacteria 4988
193 Ga0207665_10105438 3300025939 Bacteria 1974
194 Ga0207691_10044543 3300025940 Bacteria 4083
195 Ga0207711_10038049 3300025941 Bacteria 4090
196 Ga0207711_10131645 3300025941 Bacteria 2243
197 Ga0207689_10056557 3300025942 Bacteria 3229
198 Ga0207661_10077354 3300025944 Bacteria 2736
199 Ga0207667_10048494 3300025949 Bacteria 4490
200 Ga0207712_10095628 3300025961 Bacteria 2197
201 Ga0207658_10005264 3300025986 Bacteria 8898
202 Ga0207677_10067063 3300026023 Bacteria 2512
203 Ga0207703_10019946 3300026035 Bacteria 5239
204 Ga0207703_10128317 3300026035 Bacteria 2186
205 Ga0207678_10002379 3300026067 Bacteria 17073
206 Ga0207702_10013142 3300026078 Bacteria 6883
207 Ga0207674_10015408 3300026116 Bacteria 8398
208 Ga0207675_100279233 3300026118 Bacteria 1623
209 Ga0207683_10020651 3300026121 Bacteria 5637
210 Ga0207698_10070213 3300026142 Bacteria 2774
211 Ga0207428_10002324 3300027907 Bacteria 19038
212 Ga0207428_10041438 3300027907 Bacteria 3728
213 Ga0268266_10004557 3300028379 Bacteria 13239
214 Ga0268266_10187009 3300028379 Bacteria 1889
215 Ga0307513_10075711 3300031456 Bacteria 3493
216 Ga0307508_10031829 3300031616 Bacteria 4767
217 Ga0307410_10006113 3300031852 Bacteria 6460
218 Ga0307410_10050260 3300031852 Bacteria 2802
219 Ga0307407_10108586 3300031903 Bacteria 1737
220 Ga0307412_10127954 3300031911 Bacteria 1840
221 Ga0307409_100026346 3300031995 Bacteria 4098
222 Ga0307409_100078908 3300031995 Bacteria 2650
223 Ga0307416_100117923 3300032002 Bacteria 2357
224 Ga0307416_100158194 3300032002 Bacteria 2089
225 Ga0307411_10039247 3300032005 Bacteria 2993
226 Ga0373930_0007416 3300034816 Bacteria 1888
227 Ga0373948_0011116 3300034817 Bacteria 1585
228 Ga0373950_0002190 3300034818 Bacteria 2661
229 Ga0373926_0007263 3300035083 Bacteria 3694
230 Ga0373926_0051624 3300035083 Bacteria 1484
231 Ga0373929_0005969 3300035085 Bacteria 2199
232 Ga0373934_0016778 3300035086 Bacteria 2787
233 Ga0373934_0032930 3300035086 Bacteria 2034
234 Ga0373940_0003998 3300035088 Bacteria 3077
235 Ga0373949_0011409 3300035090 Bacteria 1957
236 Ga0373952_0002865 3300035092 Bacteria 3116
237 Ga0373932_0017975 3300035112 Bacteria 1823
238 Ga0373953_0010556 3300035117 Bacteria 3219
239 Ga0373954_0038769 3300035118 Bacteria 2217
240 Ga0373956_0001121 3300035119 Bacteria 11041
241 Ga0373956_0064481 3300035119 Bacteria 1663
242 Ga0373957_0031932 3300035120 Bacteria 1937
243 Ga0373943_0004909 3300035170 Bacteria 6043
244 Ga0373946_0003646 3300035171 Bacteria 5454
245 Ga0373955_0000124 3300035172 Bacteria 30735
246 Ga0373955_0011307 3300035172 Bacteria 4248
247 Ga0373955_0103757 3300035172 Bacteria 1635
248 Ga0373942_0002647 3300035207 Bacteria 4306
249 Ga0373962_0004894 3300035242 Bacteria 3238
250 Ga0373962_0008309 3300035242 Bacteria 2553
251 Ga0373924_0009746 3300035410 Bacteria 3527
252 Ga0373931_0021017 3300035691 Bacteria 3270
253 Ga0373935_0008041 3300035692 Bacteria 6322
254 Ga0373935_0093155 3300035692 Bacteria 1975
255 Ga0373933_0000069 3300035724 Bacteria 62983
256 Ga0373933_0035968 3300035724 Bacteria 2895
257 Ga0373947_0022512 3300035725 Bacteria 3655
258 Ga0373937_0000168 3300036401 Bacteria 63667
259 Ga0373937_0024509 3300036401 Bacteria 5442
260 Ga0373937_0050332 3300036401 Bacteria 3816
261 Ga0373925_0015555 3300037068 Bacteria 5504
262 Ga0373925_0163311 3300037068 Bacteria 1755
263 Ga0395898_0004150 3300037466 Bacteria 15886
264 Ga0395898_0150156 3300037466 Bacteria 2230
265 Ga0395898_0156628 3300037466 Bacteria 2179
266 Ga0395901_0063540 3300038443 Bacteria 3842
267 Ga0436365_0184266 3300039437 Bacteria 36150
268 Ga0436365_1316733 3300039437 Bacteria 6722
269 Ga0436365_1918782 3300039437 Bacteria 5452
270 Ga0436362_0744141 3300039453 Bacteria 2403
271 Ga0436362_0957350 3300039453 Bacteria 35880
272 Ga0451837_0566295 3300041494 Bacteria 2379
273 Ga0439444_0001872 3300042437 Bacteria 2797
274 Ga0466972_0022755 3300044658 Bacteria 3119
275 Ga0466961_0007778 3300044693 Bacteria 6821
276 Ga0466963_0055962 3300044694 Bacteria 2624
277 Ga0466963_0164805 3300044694 Bacteria 1544
278 Ga0466957_0059323 3300044842 Bacteria 2345
279 Ga0466960_0000105 3300044901 Bacteria 27824
280 Ga0466959_0019090 3300045049 Bacteria 5039
281 Ga0466958_0015003 3300045836 Bacteria 4433
282 Ga0466967_0039391 3300045976 Bacteria 4063
283 Ga0495592_0000144 3300046454 Bacteria 62983
284 Ga0495592_0036205 3300046454 Bacteria 3717
285 Ga0495592_0089553 3300046454 Bacteria 2209
286 Ga0495603_0016539 3300046455 Bacteria 4463
287 Ga0495629_0014579 3300046459 Bacteria 5656
288 Ga0495629_0041907 3300046459 Bacteria 3218
289 Ga0495651_0000100 3300046462 Bacteria 62983
290 Ga0495651_0006644 3300046462 Bacteria 8839
291 Ga0495651_0112150 3300046462 Bacteria 2015
292 Ga0495653_0002862 3300046463 Bacteria 13795
293 Ga0495653_0027997 3300046463 Bacteria 4510
294 Ga0495653_0069847 3300046463 Bacteria 2629
295 Ga0495653_0093087 3300046463 Bacteria 2199
296 Ga0495653_0109625 3300046463 Bacteria 1986
297 Ga0495580_0043208 3300046472 Bacteria 3208
298 Ga0495582_0019814 3300046473 Bacteria 3678
299 Ga0495639_0066764 3300046475 Bacteria 1656
300 Ga0495662_0038144 3300046476 Bacteria 2322
301 Ga0495608_0000918 3300046511 Bacteria 20656
302 Ga0495608_0002932 3300046511 Bacteria 12207
303 Ga0495608_0051169 3300046511 Bacteria 2738
304 Ga0495618_0010476 3300046514 Bacteria 5608
305 Ga0495618_0012482 3300046514 Bacteria 5160
306 Ga0495628_0000308 3300046516 Bacteria 43976
307 Ga0495628_0042774 3300046516 Bacteria 3611
308 Ga0495652_0000126 3300046529 Bacteria 84302
309 Ga0495652_0002440 3300046529 Bacteria 19140
310 Ga0495665_0050784 3300046531 Bacteria 2198
311 Ga0495665_0109852 3300046531 Bacteria 1446
312 Ga0495640_0036885 3300046533 Bacteria 3451
313 Ga0495640_0114291 3300046533 Bacteria 1760
314 Ga0495586_0044013 3300046535 Bacteria 2404
315 Ga0495587_0000104 3300046536 Bacteria 63667
316 Ga0495587_0006984 3300046536 Bacteria 7331
317 Ga0495587_0007636 3300046536 Bacteria 6999
318 Ga0495587_0050148 3300046536 Bacteria 2469
319 Ga0495645_0058091 3300046543 Bacteria 2806
320 Ga0495667_0000097 3300046559 Bacteria 62983
321 Ga0495667_0000442 3300046559 Bacteria 26526
322 Ga0495667_0010671 3300046559 Bacteria 6210
323 Ga0495667_0016577 3300046559 Bacteria 4974
324 Ga0495634_0015828 3300046642 Bacteria 5405
325 Ga0495634_0073848 3300046642 Bacteria 2242
326 Ga0495635_0012047 3300046663 Bacteria 6062
327 Ga0495635_0019870 3300046663 Bacteria 4680
328 Ga0495635_0045163 3300046663 Bacteria 3039
329 Ga0495657_0001228 3300046675 Bacteria 22475
330 Ga0495657_0001691 3300046675 Bacteria 18895
331 Ga0495599_0000214 3300046678 Bacteria 37089
332 Ga0495623_0000090 3300046679 Bacteria 53800
333 Ga0495623_0013507 3300046679 Bacteria 5295
334 Ga0495623_0022694 3300046679 Bacteria 4051
335 Ga0495623_0024323 3300046679 Bacteria 3903
336 Ga0495623_0032120 3300046679 Bacteria 3374
337 Ga0495646_0006629 3300046680 Bacteria 7343
338 Ga0495646_0009326 3300046680 Bacteria 6227
339 Ga0495646_0010130 3300046680 Bacteria 5992
340 Ga0495646_0017531 3300046680 Bacteria 4542
341 Ga0495624_0068926 3300046690 Bacteria 2204
342 Ga0495589_0054515 3300046794 Bacteria 1972
343 Ga0495600_0001887 3300046809 Bacteria 11766
344 Ga0495600_0006628 3300046809 Bacteria 7055
345 Ga0495600_0107069 3300046809 Bacteria 1821
346 Ga0495581_0016479 3300047315 Bacteria 4296
347 Ga0495581_0023397 3300047315 Bacteria 3579
348 Ga0495604_0000135 3300047317 Bacteria 62983
349 Ga0495604_0001734 3300047317 Bacteria 17902
350 Ga0495604_0011993 3300047317 Bacteria 6890
351 Ga0495636_0012492 3300047318 Bacteria 3363
352 Ga0495674_0019549 3300047319 Bacteria 6285
353 Ga0495674_0040435 3300047319 Bacteria 4170
354 Ga0495674_0046970 3300047319 Bacteria 3830
355 Ga0495672_0014071 3300047320 Bacteria 5494
356 Ga0495680_0000156 3300047322 Bacteria 69379
357 Ga0495680_0014172 3300047322 Bacteria 6921
358 Ga0495680_0021201 3300047322 Bacteria 5444
359 Ga0495680_0022913 3300047322 Bacteria 5200
360 Ga0495680_0054474 3300047322 Bacteria 3105
361 Ga0495680_0135210 3300047322 Bacteria 1808
362 Ga0495675_0002068 3300047444 Bacteria 11974
363 Ga0495675_0005038 3300047444 Bacteria 8037
364 Ga0495684_0004801 3300047471 Bacteria 10554
365 Ga0495684_0023161 3300047471 Bacteria 4774
366 Ga0495684_0049330 3300047471 Bacteria 3217
367 Ga0495593_0016303 3300047673 Bacteria 4192
368 Ga0495602_0003580 3300048088 Bacteria 16079
369 Ga0495602_0011802 3300048088 Bacteria 9022
370 Ga0495602_0104472 3300048088 Bacteria 2317
371 Ga0495602_0118319 3300048088 Bacteria 2137
372 Ga0496100_0007455 3300048903 Bacteria 6037
373 Ga0496100_0009098 3300048903 Bacteria 5569
374 Ga0496100_0016087 3300048903 Bacteria 4383
375 Ga0496101_0002617 3300048904 Bacteria 11063
376 Ga0496101_0013147 3300048904 Bacteria 5539
377 Ga0496101_0119690 3300048904 Bacteria 1989
378 Ga0496102_0000059 3300048905 Bacteria 168633
379 Ga0496102_0000453 3300048905 Bacteria 46525
380 Ga0496103_0000182 3300048906 Bacteria 63355
381 Ga0496104_0001196 3300048907 Bacteria 22352
382 Ga0496104_0009247 3300048907 Bacteria 8763
383 Ga0496105_0003426 3300048908 Bacteria 11736
384 Ga0496105_0010589 3300048908 Bacteria 7254
385 Ga0496105_0052734 3300048908 Bacteria 3359
386 Ga0496105_0122875 3300048908 Bacteria 2140
387 Ga0496105_0224790 3300048908 Bacteria 1527
388 Ga0496105_0250938 3300048908 Bacteria 1433
389 Ga0496106_0005551 3300048909 Bacteria 9339
390 Ga0496106_0024165 3300048909 Bacteria 4516
391 Ga0496107_0006879 3300048910 Bacteria 7835
392 Ga0496107_0038031 3300048910 Bacteria 3454
393 Ga0496108_0005284 3300048911 Bacteria 10423
394 Ga0496108_0016767 3300048911 Bacteria 5985
395 Ga0496108_0111825 3300048911 Bacteria 2336
396 Ga0496108_0264958 3300048911 Bacteria 1495
397 Ga0496109_0020028 3300048912 Bacteria 5907
398 Ga0496109_0102201 3300048912 Bacteria 2660
399 Ga0496109_0103365 3300048912 Bacteria 2644
400 Ga0496110_0018370 3300048913 Bacteria 5863
401 Ga0496110_0092559 3300048913 Bacteria 2705
402 Ga0496111_0011344 3300048914 Bacteria 6000
403 Ga0496111_0014514 3300048914 Bacteria 5384
404 Ga0496112_0159980 3300048915 Bacteria 2218
405 Ga0496113_0070590 3300048916 Bacteria 2655
406 Ga0496113_0123318 3300048916 Bacteria 2027
407 Ga0496114_0003664 3300048917 Bacteria 11822
408 Ga0496114_0013579 3300048917 Bacteria 6534
409 Ga0496114_0130412 3300048917 Bacteria 2170
410 Ga0496115_0062143 3300048918 Bacteria 3012
411 Ga0496118_0031212 3300048921 Bacteria 4423
412 Ga0496119_0000354 3300048922 Bacteria 64356
413 Ga0496120_0015668 3300048923 Bacteria 4988
414 Ga0501031_0094381 3300049568 Bacteria 1952
415 Ga0501032_0023027 3300049569 Bacteria 4312
416 Ga0501034_0092223 3300049571 Bacteria 3026
417 Ga0501038_0002187 3300049574 Bacteria 18177
418 Ga0501047_0043813 3300049581 Bacteria 4322
419 Ga0501047_0054809 3300049581 Bacteria 3856
420 Ga0501070_0001842 3300049586 Bacteria 18699
421 Ga0501070_0005521 3300049586 Bacteria 10785
422 Ga0501070_0010706 3300049586 Bacteria 7754
423 Ga0501074_0011461 3300049590 Bacteria 6449
424 Ga0501074_0213658 3300049590 Bacteria 1374
425 Ga0501079_0000676 3300049741 Bacteria 22923
426 Ga0501080_0000665 3300049742 Bacteria 27325
427 Ga0501080_0020936 3300049742 Bacteria 6052
428 Ga0501080_0036389 3300049742 Bacteria 4595
429 Ga0501080_0237278 3300049742 Bacteria 1665
430 Ga0501035_0082697 3300049822 Bacteria 2833
431 Ga0501044_0022504 3300049823 Bacteria 6715
432 Ga0501044_0176177 3300049823 Bacteria 2107
433 Ga0501045_0134308 3300049824 Bacteria 1840
434 nmdc:mga05p37_86924_c1 3300050507 Bacteria 3854
435 nmdc:mga09592_29596_c1 3300050508 Bacteria 4554
436 nmdc:mga08y16_13352_c1 3300050511 Bacteria 8641
437 nmdc:mga08y16_92685_c1 3300050511 Bacteria 3148
438 nmdc:mga0n895_23352_c1 3300050512 Bacteria 5812
439 nmdc:mga0n895_31846_c1 3300050512 Bacteria 5055
440 nmdc:mga0rr50_139427_c1 3300050513 Bacteria 1949
441 nmdc:mga0rr50_5392_c1 3300050513 Bacteria 7625
442 nmdc:mga08x19_79071_c1 3300050514 Bacteria 2156
443 nmdc:mga0a205_41900_c1 3300050515 Bacteria 4411
444 nmdc:mga0a205_85836_c1 3300050515 Bacteria 3040
445 Ga0495601_0039085 3300053077 Bacteria 2970
446 Ga0495601_0072012 3300053077 Bacteria 2207
447 Ga0495595_0016199 3300053084 Bacteria 3185
448 Ga0495595_0041199 3300053084 Bacteria 2112
449 Ga0495619_0018181 3300053085 Bacteria 4458
450 Ga0495619_0060628 3300053085 Bacteria 2515
451 Ga0495619_0144037 3300053085 Bacteria 1642
452 Ga0500642_0023051 3300053130 Bacteria 2493
453 Ga0466962_0070550 3300061719 Bacteria 1669
454 2548693407 2547132424 Bacteria 8348532
455 2552106119 2551306166 Bacteria 9731570
456 2585318042 2582581314 Bacteria 11452267
457 2676488758 2675903060 Bacteria 10051191
458 2738887277 2738541308 Bacteria 7020677
459 2816504492 2816332139 Bacteria 9138787
460 2835190920 2835188231 Bacteria 3476928
461 2856744987 2856741275 Bacteria 8096094
462 2873317648 2873314349 Bacteria 8512634
463 2884702344 2884693830 Bacteria 11273186
464 2891396748 2891395885 Bacteria 9251614
465 2891559301 2891554331 Bacteria 8812224
466 2891565231 2891562705 Bacteria 8039471
467 2895437932 2895427314 Bacteria 13147766
468 2895451843 2895442618 Bacteria 11027144
469 2902800689 2902799365 Bacteria 5419524
470 8055071781 8055066027 Bacteria 9479577
471 8055179283 8055172936 Bacteria 9305943
472 Ga0070706_100003478
473 JGI24739J22299_10025247
474 JGI24745J21846_1002753
475 JGI25406J46586_10018151
476 Ga0055540_1003625
477 Ga0070658_10000592
478 Ga0070683_100048042
479 Ga0070683_100129776
480 Ga0070666_10025814
481 Ga0070680_100000007
482 Ga0070680_100128947
483 Ga0070682_100043923
484 Ga0068868_100047763
485 Ga0070660_100034738
486 Ga0070660_100050095
487 Ga0070660_100089036
488 Ga0070689_100102899
489 Ga0070668_100003088
490 Ga0070671_100013557
491 Ga0070671_100046009
492 Ga0070674_100086563
493 Ga0070688_100101541
494 Ga0070659_100030044
495 Ga0070709_10000641
496 Ga0070714_100019556
497 Ga0070714_100022792
498 Ga0070714_100060639
499 Ga0070714_100097452
500 Ga0070713_100006565
501 Ga0070713_100017613
502 Ga0070713_100026121
503 Ga0070710_10000175
504 Ga0070710_10051263
505 Ga0070710_10113524
506 Ga0070710_10129566
507 Ga0070678_100015831
508 Ga0070678_100110141
509 Ga0070681_10000024
510 Ga0070681_10008763
511 Ga0070681_10062786
512 Ga0070706_100054068
513 Ga0070706_100168926
514 Ga0070707_100010871
515 Ga0070707_100024117
516 Ga0070707_100197359
517 Ga0070698_100001112
518 Ga0070698_100031924
519 Ga0070698_100054264
520 Ga0070699_100077022
521 Ga0070679_100000109
522 Ga0070679_100001173
523 Ga0070679_100010858
524 Ga0070679_100329723
525 Ga0070684_100014981
526 Ga0070684_100146932
527 Ga0070672_100049324
528 Ga0070696_100000187
529 Ga0070696_100066755
530 Ga0070696_100161585
531 Ga0070665_100182778
532 Ga0070665_100399066
533 Ga0068855_100039251
534 Ga0068855_100103303
535 Ga0068855_100125484
536 Ga0068854_100082691
537 Ga0068856_100008601
538 Ga0068856_100027770
539 Ga0070702_100032643
540 Ga0068852_100025472
541 Ga0068861_100128781
542 Ga0068851_10044098
543 Ga0068863_100009857
544 Ga0068863_100023852
545 Ga0068858_100027416
546 Ga0068860_100048813
547 Ga0068860_100253583
548 Ga0068862_100083095
549 Ga0081455_10028070
550 Ga0081538_10000421
551 Ga0081540_1000582
552 Ga0081539_10007550
553 Ga0070717_10002954
554 Ga0070717_10020246
555 Ga0070717_10025934
556 Ga0070717_10071063
557 Ga0070717_10212182
558 Ga0075365_10069342
559 Ga0070715_10030656
560 Ga0070716_100000768
561 Ga0070712_100000962
562 Ga0070712_100079894
563 Ga0070712_100116051
564 Ga0070712_100156907
565 Ga0097621_100122975
566 Ga0068871_100018485
567 Ga0075428_100067320
568 Ga0075430_100118564
569 Ga0075433_10012825
570 Ga0075433_10022000
571 Ga0075434_100020328
572 Ga0075434_100029299
573 Ga0075434_100038865
574 Ga0075434_100349154
575 Ga0075429_100023412
576 Ga0068865_100043487
577 Ga0068865_100076415
578 Ga0075436_100016131
579 Ga0075436_100134828
580 Ga0075435_100024466
581 Ga0105240_10059876
582 Ga0111539_10002580
583 Ga0111539_10042055
584 Ga0105245_10058649
585 Ga0105247_10005178
586 Ga0105247_10072049
587 Ga0105247_10103516
588 Ga0114129_10006841
589 Ga0114129_10078028
590 Ga0105241_10035570
591 Ga0105248_10025400
592 Ga0105248_10262339
593 Ga0105238_10045442
594 Ga0105249_10098782
595 Ga0105246_10047111
596 Ga0157374_10018752
597 Ga0157378_10036927
598 Ga0163162_10028262
599 Ga0163162_10053609
600 Ga0157372_10077601
601 Ga0157375_10040438
602 Ga0163163_10070619
603 Ga0163163_10107908
604 Ga0163163_10237258
605 Ga0157377_10013819
606 Ga0157379_10060788
607 Ga0157376_10005320
608 Ga0157376_10040125
609 Ga0163161_10092949
610 Ga0213873_10000498
611 Ga0209051_1000630
612 Ga0207692_10000758
613 Ga0207692_10016231
614 Ga0207692_10040191
615 Ga0207692_10056508
616 Ga0207692_10077443
617 Ga0207710_10045380
618 Ga0207647_10016372
619 Ga0207647_10053522
620 Ga0207685_10009711
621 Ga0207699_10001694
622 Ga0207699_10004816
623 Ga0207699_10005776
624 Ga0207699_10012586
625 Ga0207643_10067192
626 Ga0207705_10000683
627 Ga0207684_10002141
628 Ga0207707_10000059
629 Ga0207707_10018344
630 Ga0207693_10009521
631 Ga0207693_10022613
632 Ga0207693_10060907
633 Ga0207693_10116481
634 Ga0207663_10034675
635 Ga0207663_10036996
636 Ga0207660_10000229
637 Ga0207657_10022599
638 Ga0207652_10000020
639 Ga0207652_10010895
640 Ga0207652_10067228
641 Ga0207646_10009481
642 Ga0207646_10039968
643 Ga0207646_10045335
644 Ga0207646_10257102
645 Ga0207700_10000154
646 Ga0207700_10014034
647 Ga0207700_10029520
648 Ga0207700_10031744
649 Ga0207700_10036852
650 Ga0207700_10056533
651 Ga0207664_10000211
652 Ga0207664_10015601
653 Ga0207664_10016388
654 Ga0207664_10018077
655 Ga0207664_10037052
656 Ga0207664_10053861
657 Ga0207664_10088025
658 Ga0207664_10146964
659 Ga0207644_10087680
660 Ga0207690_10078857
661 Ga0207669_10002655
662 Ga0207665_10000331
663 Ga0207665_10015581
664 Ga0207665_10105438
665 Ga0207691_10044543
666 Ga0207711_10038049
667 Ga0207711_10131645
668 Ga0207689_10056557
669 Ga0207661_10077354
670 Ga0207667_10048494
671 Ga0207712_10095628
672 Ga0207658_10005264
673 Ga0207677_10067063
674 Ga0207703_10019946
675 Ga0207703_10128317
676 Ga0207678_10002379
677 Ga0207702_10013142
678 Ga0207674_10015408
679 Ga0207675_100279233
680 Ga0207683_10020651
681 Ga0207698_10070213
682 Ga0207428_10002324
683 Ga0207428_10041438
684 Ga0268266_10004557
685 Ga0268266_10187009
686 Ga0307513_10075711
687 Ga0307508_10031829
688 Ga0307410_10006113
689 Ga0307410_10050260
690 Ga0307407_10108586
691 Ga0307412_10127954
692 Ga0307409_100026346
693 Ga0307409_100078908
694 Ga0307416_100117923
695 Ga0307416_100158194
696 Ga0307411_10039247
697 Ga0373930_0007416
698 Ga0373948_0011116
699 Ga0373950_0002190
700 Ga0373926_0007263
701 Ga0373926_0051624
702 Ga0373929_0005969
703 Ga0373934_0016778
704 Ga0373934_0032930
705 Ga0373940_0003998
706 Ga0373949_0011409
707 Ga0373952_0002865
708 Ga0373932_0017975
709 Ga0373953_0010556
710 Ga0373954_0038769
711 Ga0373956_0001121
712 Ga0373956_0064481
713 Ga0373957_0031932
714 Ga0373943_0004909
715 Ga0373946_0003646
716 Ga0373955_0000124
717 Ga0373955_0011307
718 Ga0373955_0103757
719 Ga0373942_0002647
720 Ga0373962_0004894
721 Ga0373962_0008309
722 Ga0373924_0009746
723 Ga0373931_0021017
724 Ga0373935_0008041
725 Ga0373935_0093155
726 Ga0373933_0000069
727 Ga0373933_0035968
728 Ga0373947_0022512
729 Ga0373937_0000168
730 Ga0373937_0024509
731 Ga0373937_0050332
732 Ga0373925_0015555
733 Ga0373925_0163311
734 Ga0395898_0004150
735 Ga0395898_0150156
736 Ga0395898_0156628
737 Ga0395901_0063540
738 Ga0436365_0184266
739 Ga0436365_1316733
740 Ga0436365_1918782
741 Ga0436362_0744141
742 Ga0436362_0957350
743 Ga0451837_0566295
744 Ga0439444_0001872
745 Ga0466972_0022755
746 Ga0466961_0007778
747 Ga0466963_0055962
748 Ga0466963_0164805
749 Ga0466957_0059323
750 Ga0466960_0000105
751 Ga0466959_0019090
752 Ga0466958_0015003
753 Ga0466967_0039391
754 Ga0495592_0000144
755 Ga0495592_0036205
756 Ga0495592_0089553
757 Ga0495603_0016539
758 Ga0495629_0014579
759 Ga0495629_0041907
760 Ga0495651_0000100
761 Ga0495651_0006644
762 Ga0495651_0112150
763 Ga0495653_0002862
764 Ga0495653_0027997
765 Ga0495653_0069847
766 Ga0495653_0093087
767 Ga0495653_0109625
768 Ga0495580_0043208
769 Ga0495582_0019814
770 Ga0495639_0066764
771 Ga0495662_0038144
772 Ga0495608_0000918
773 Ga0495608_0002932
774 Ga0495608_0051169
775 Ga0495618_0010476
776 Ga0495618_0012482
777 Ga0495628_0000308
778 Ga0495628_0042774
779 Ga0495652_0000126
780 Ga0495652_0002440
781 Ga0495665_0050784
782 Ga0495665_0109852
783 Ga0495640_0036885
784 Ga0495640_0114291
785 Ga0495586_0044013
786 Ga0495587_0000104
787 Ga0495587_0006984
788 Ga0495587_0007636
789 Ga0495587_0050148
790 Ga0495645_0058091
791 Ga0495667_0000097
792 Ga0495667_0000442
793 Ga0495667_0010671
794 Ga0495667_0016577
795 Ga0495634_0015828
796 Ga0495634_0073848
797 Ga0495635_0012047
798 Ga0495635_0019870
799 Ga0495635_0045163
800 Ga0495657_0001228
801 Ga0495657_0001691
802 Ga0495599_0000214
803 Ga0495623_0000090
804 Ga0495623_0013507
805 Ga0495623_0022694
806 Ga0495623_0024323
807 Ga0495623_0032120
808 Ga0495646_0006629
809 Ga0495646_0009326
810 Ga0495646_0010130
811 Ga0495646_0017531
812 Ga0495624_0068926
813 Ga0495589_0054515
814 Ga0495600_0001887
815 Ga0495600_0006628
816 Ga0495600_0107069
817 Ga0495581_0016479
818 Ga0495581_0023397
819 Ga0495604_0000135
820 Ga0495604_0001734
821 Ga0495604_0011993
822 Ga0495636_0012492
823 Ga0495674_0019549
824 Ga0495674_0040435
825 Ga0495674_0046970
826 Ga0495672_0014071
827 Ga0495680_0000156
828 Ga0495680_0014172
829 Ga0495680_0021201
830 Ga0495680_0022913
831 Ga0495680_0054474
832 Ga0495680_0135210
833 Ga0495675_0002068
834 Ga0495675_0005038
835 Ga0495684_0004801
836 Ga0495684_0023161
837 Ga0495684_0049330
838 Ga0495593_0016303
839 Ga0495602_0003580
840 Ga0495602_0011802
841 Ga0495602_0104472
842 Ga0495602_0118319
843 Ga0496100_0007455
844 Ga0496100_0009098
845 Ga0496100_0016087
846 Ga0496101_0002617
847 Ga0496101_0013147
848 Ga0496101_0119690
849 Ga0496102_0000059
850 Ga0496102_0000453
851 Ga0496103_0000182
852 Ga0496104_0001196
853 Ga0496104_0009247
854 Ga0496105_0003426
855 Ga0496105_0010589
856 Ga0496105_0052734
857 Ga0496105_0122875
858 Ga0496105_0224790
859 Ga0496105_0250938
860 Ga0496106_0005551
861 Ga0496106_0024165
862 Ga0496107_0006879
863 Ga0496107_0038031
864 Ga0496108_0005284
865 Ga0496108_0016767
866 Ga0496108_0111825
867 Ga0496108_0264958
868 Ga0496109_0020028
869 Ga0496109_0102201
870 Ga0496109_0103365
871 Ga0496110_0018370
872 Ga0496110_0092559
873 Ga0496111_0011344
874 Ga0496111_0014514
875 Ga0496112_0159980
876 Ga0496113_0070590
877 Ga0496113_0123318
878 Ga0496114_0003664
879 Ga0496114_0013579
880 Ga0496114_0130412
881 Ga0496115_0062143
882 Ga0496118_0031212
883 Ga0496119_0000354
884 Ga0496120_0015668
885 Ga0501031_0094381
886 Ga0501032_0023027
887 Ga0501034_0092223
888 Ga0501038_0002187
889 Ga0501047_0043813
890 Ga0501047_0054809
891 Ga0501070_0001842
892 Ga0501070_0005521
893 Ga0501070_0010706
894 Ga0501074_0011461
895 Ga0501074_0213658
896 Ga0501079_0000676
897 Ga0501080_0000665
898 Ga0501080_0020936
899 Ga0501080_0036389
900 Ga0501080_0237278
901 Ga0501035_0082697
902 Ga0501044_0022504
903 Ga0501044_0176177
904 Ga0501045_0134308
905 nmdc:mga05p37_86924_c1
906 nmdc:mga09592_29596_c1
907 nmdc:mga08y16_13352_c1
908 nmdc:mga08y16_92685_c1
909 nmdc:mga0n895_23352_c1
910 nmdc:mga0n895_31846_c1
911 nmdc:mga0rr50_139427_c1
912 nmdc:mga0rr50_5392_c1
913 nmdc:mga08x19_79071_c1
914 nmdc:mga0a205_41900_c1
915 nmdc:mga0a205_85836_c1
916 Ga0495601_0039085
917 Ga0495601_0072012
918 Ga0495595_0016199
919 Ga0495595_0041199
920 Ga0495619_0018181
921 Ga0495619_0060628
922 Ga0495619_0144037
923 Ga0500642_0023051
924 Ga0466962_0070550
925 2548693407
926 2552106119
927 2585318042
928 2676488758
929 2738887277
930 2816504492
931 2835190920
932 2856744987
933 2873317648
934 2884702344
935 2891396748
936 2891559301
937 2891565231
938 2895437932
939 2895451843
940 2902800689
941 8055071781
942 8055179283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

67

485

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jje-assembly1.cif.gz_A-2 crystal structure of t330s mutant of rv3290c from m. tuberculosis 0.9781 9 445
2jjh-assembly1.cif.gz_A-2 e243 mutant of m. tuberculosis rv3290c 0.9781 9 445
2cin-assembly1.cif.gz_A lysine aminotransferase from m. tuberculosis in the internal aldimine form 0.9779 9 445
2jjf-assembly1.cif.gz_A-2 n328a mutant of m. tuberculosis rv3290c 0.9776 9 445
2jje-assembly1.cif.gz_A-2 crystal structure of t330s mutant of rv3290c from m. tuberculosis 0.9759 9 445
ID Description Score Start End Superfamily
af_P9WQ77_356_444_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9905 352 437 3.90.1150.10
af_Q9VW68_397_486_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9766 355 443 3.90.1150.10
af_P80404_421_496_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9706 366 440 3.90.1150.10
2jjfA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9697 67 346 3.40.640.10
af_P61922_409_498_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9677 353 442 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A7S3GIY6-F1-model_v4 Uncharacterized protein 0.9822 331 444 GO:0005739
GO:0008483
GO:0009450
GO:0030170
AF-A0A0S7ZKE7-F1-model_v4 L-lysine 6-transaminase 0.9812 127 441 GO:0008483
GO:0009450
GO:0030170
AF-A0A7V2EF79-F1-model_v4 L-lysine 6-transaminase (EC 2.6.1.36) 0.9773 1 289 GO:0009450
GO:0030170
GO:0045484
AF-A0A0S7ZKE7-F1-model_v4 L-lysine 6-transaminase 0.975 127 441 GO:0008483
GO:0009450
GO:0030170
AF-A0A497THX6-F1-model_v4 L-lysine 6-transaminase (EC 2.6.1.36) (Lysine 6-aminotransferase) 0.9744 16 443 GO:0009450
GO:0017000
GO:0030170
GO:0045484

Map