F450445

General Info

Members Datasets Scaffolds Average Seq Length
470 206 470 135

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0216265|Ga0316574_0216265_151_615
Length 154
Sequence LKNIKEKEGKPTNFGEVHMYTNEGKKIIHTDKAPEAIGPYSQAVRIENMVFTAGQIGLDPATMEIVDGGIEAETRQVLMNLKNILETANSGLNYVIKTTVFLRDMADFPKMNTIYAEFFFENPPARSTVAVATLPKDVAVEIEAVALLASHQGD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
129 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.21
Rhizosphere 97.02
Stem 0
Stem Tuber 0
Unclassified 2.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1117078 2162886007 Bacteria 12618
2 Ga0065704_10071224 3300005289 Bacteria 12391
3 Ga0065704_10150620 3300005289 Bacteria 1432
4 Ga0065704_10300263 3300005289 Unclassified 873
5 Ga0065707_10000506 3300005295 Bacteria 28358
6 Ga0065707_10089757 3300005295 Bacteria 4266
7 Ga0065707_10440084 3300005295 Unclassified 811
8 Ga0070658_10000043 3300005327 Bacteria 132337
9 Ga0070658_10033243 3300005327 Bacteria 4148
10 Ga0070658_10070138 3300005327 Bacteria 2869
11 Ga0070658_10285797 3300005327 Bacteria 1405
12 Ga0070683_100033003 3300005329 Bacteria 4717
13 Ga0070680_100060124 3300005336 Bacteria 3109
14 Ga0070680_100130944 3300005336 Bacteria 2099
15 Ga0070680_100168270 3300005336 Bacteria 1844
16 Ga0070680_100311077 3300005336 Bacteria 1337
17 Ga0070680_100344119 3300005336 Bacteria 1267
18 Ga0070680_101762880 3300005336 Bacteria 537
19 Ga0070682_100170755 3300005337 Bacteria 1511
20 Ga0068868_100737310 3300005338 Bacteria 884
21 Ga0070660_100027491 3300005339 Bacteria 4246
22 Ga0070660_100046541 3300005339 Bacteria 3325
23 Ga0070660_100055895 3300005339 Bacteria 3052
24 Ga0070660_100153385 3300005339 Bacteria 1853
25 Ga0070660_100637298 3300005339 Bacteria 892
26 Ga0070689_100233239 3300005340 Bacteria 1513
27 Ga0070689_101580790 3300005340 Bacteria 595
28 Ga0070661_100028594 3300005344 Bacteria 4021
29 Ga0070661_100053149 3300005344 Bacteria 2965
30 Ga0070661_100079914 3300005344 Bacteria 2413
31 Ga0070661_100886681 3300005344 Bacteria 736
32 Ga0070661_101010710 3300005344 Bacteria 690
33 Ga0070692_10927814 3300005345 Unclassified 604
34 Ga0070669_100184507 3300005353 Unclassified 1634
35 Ga0070659_100042245 3300005366 Bacteria 3564
36 Ga0070659_100042305 3300005366 Bacteria 3562
37 Ga0070659_100189326 3300005366 Bacteria 1690
38 Ga0070667_101687696 3300005367 Bacteria 596
39 Ga0070709_10286376 3300005434 Bacteria 1199
40 Ga0070714_100051898 3300005435 Bacteria 3497
41 Ga0070714_100256223 3300005435 Bacteria 1619
42 Ga0070714_100688836 3300005435 Bacteria 986
43 Ga0070714_101803826 3300005435 Bacteria 597
44 Ga0070710_10208848 3300005437 Bacteria 1237
45 Ga0070711_100116393 3300005439 Bacteria 1970
46 Ga0070705_100276594 3300005440 Unclassified 1191
47 Ga0070705_101054563 3300005440 Unclassified 663
48 Ga0070694_100738960 3300005444 Unclassified 803
49 Ga0070708_100841110 3300005445 Unclassified 862
50 Ga0070663_100086748 3300005455 Bacteria 2312
51 Ga0070663_100161400 3300005455 Bacteria 1725
52 Ga0070663_100286522 3300005455 Unclassified 1314
53 Ga0070662_101754369 3300005457 Unclassified 536
54 Ga0070681_10001636 3300005458 Bacteria 19981
55 Ga0070681_10009030 3300005458 Bacteria 9798
56 Ga0070681_10337873 3300005458 Bacteria 1416
57 Ga0070681_10540924 3300005458 Bacteria 1078
58 Ga0070681_11331519 3300005458 Bacteria 641
59 Ga0070706_100475283 3300005467 Bacteria 1163
60 Ga0070707_100069756 3300005468 Bacteria 3385
61 Ga0070698_100081138 3300005471 Bacteria 3238
62 Ga0070698_100511050 3300005471 Bacteria 1139
63 Ga0070698_101001247 3300005471 Bacteria 783
64 Ga0070698_101425694 3300005471 Unclassified 644
65 Ga0070699_100002719 3300005518 Bacteria 15768
66 Ga0070699_100553920 3300005518 Bacteria 1047
67 Ga0070679_100016232 3300005530 Bacteria 7174
68 Ga0070679_100107292 3300005530 Bacteria 2778
69 Ga0070679_100180300 3300005530 Bacteria 2085
70 Ga0070679_100555841 3300005530 Bacteria 1091
71 Ga0070684_100029885 3300005535 Bacteria 4624
72 Ga0070684_100139864 3300005535 Bacteria 2188
73 Ga0068853_100061638 3300005539 Bacteria 3245
74 Ga0068853_100126609 3300005539 Bacteria 2282
75 Ga0070695_100048347 3300005545 Bacteria 2720
76 Ga0070695_101276450 3300005545 Unclassified 606
77 Ga0070696_100201013 3300005546 Bacteria 1488
78 Ga0070696_100421312 3300005546 Bacteria 1048
79 Ga0070696_100621923 3300005546 Bacteria 873
80 Ga0070693_100068657 3300005547 Bacteria 2081
81 Ga0070693_100255701 3300005547 Bacteria 1163
82 Ga0070704_100622076 3300005549 Unclassified 951
83 Ga0068855_100098821 3300005563 Bacteria 3362
84 Ga0068855_100155378 3300005563 Bacteria 2599
85 Ga0068855_100164632 3300005563 Bacteria 2515
86 Ga0068855_101362734 3300005563 Unclassified 732
87 Ga0070664_100320896 3300005564 Bacteria 1403
88 Ga0070664_101154020 3300005564 Bacteria 730
89 Ga0070664_101154061 3300005564 Bacteria 730
90 Ga0068857_100063538 3300005577 Bacteria 3282
91 Ga0068857_100108090 3300005577 Bacteria 2499
92 Ga0068857_100162717 3300005577 Bacteria 2025
93 Ga0068857_100351771 3300005577 Bacteria 1364
94 Ga0068857_101295843 3300005577 Bacteria 707
95 Ga0068854_100032709 3300005578 Bacteria 3620
96 Ga0068854_100061497 3300005578 Bacteria 2720
97 Ga0068856_100000623 3300005614 Bacteria 38692
98 Ga0068856_100031085 3300005614 Bacteria 5222
99 Ga0068852_100029973 3300005616 Bacteria 4474
100 Ga0068852_100226508 3300005616 Bacteria 1780
101 Ga0068852_100598191 3300005616 Bacteria 1107
102 Ga0068859_100054328 3300005617 Bacteria 4028
103 Ga0068859_101541848 3300005617 Unclassified 734
104 Ga0068864_100509516 3300005618 Bacteria 1159
105 Ga0068866_10199610 3300005718 Unclassified 1194
106 Ga0068851_10158790 3300005834 Bacteria 1241
107 Ga0068858_100694357 3300005842 Bacteria 990
108 Ga0068860_100044549 3300005843 Bacteria 4229
109 Ga0068860_100616035 3300005843 Bacteria 1092
110 Ga0068862_100349328 3300005844 Bacteria 1372
111 Ga0068862_101568517 3300005844 Bacteria 665
112 Ga0081539_10161884 3300005985 Bacteria 1066
113 Ga0081539_10257501 3300005985 Bacteria 772
114 Ga0070712_100062673 3300006175 Bacteria 2630
115 Ga0070712_100086238 3300006175 Unclassified 2288
116 Ga0075428_100148255 3300006844 Bacteria 2549
117 Ga0075428_100299933 3300006844 Bacteria 1727
118 Ga0075428_100883036 3300006844 Bacteria 949
119 Ga0075428_102727274 3300006844 Unclassified 503
120 Ga0075430_100114617 3300006846 Bacteria 2246
121 Ga0075430_100186662 3300006846 Unclassified 1724
122 Ga0075431_100024046 3300006847 Bacteria 6239
123 Ga0075431_100977202 3300006847 Archaea 814
124 Ga0075431_101237198 3300006847 Bacteria 709
125 Ga0075433_10025088 3300006852 Bacteria 5038
126 Ga0075433_10103120 3300006852 Bacteria 2526
127 Ga0075434_101059272 3300006871 Unclassified 824
128 Ga0075429_100034313 3300006880 Bacteria 4408
129 Ga0075429_100096070 3300006880 Bacteria 2584
130 Ga0075429_100219694 3300006880 Bacteria 1665
131 Ga0075429_100253841 3300006880 Unclassified 1540
132 Ga0075429_100296623 3300006880 Archaea 1415
133 Ga0075429_100605752 3300006880 Unclassified 960
134 Ga0075429_101489052 3300006880 Bacteria 589
135 Ga0097620_100054327 3300006931 Bacteria 4028
136 Ga0097620_101541909 3300006931 Unclassified 734
137 Ga0105240_10158708 3300009093 Bacteria 2688
138 Ga0105240_10876688 3300009093 Bacteria 967
139 Ga0111539_10019878 3300009094 Bacteria 8275
140 Ga0105245_10524576 3300009098 Bacteria 1203
141 Ga0105247_10141821 3300009101 Bacteria 1575
142 Ga0114129_10026326 3300009147 Bacteria 8237
143 Ga0114129_10079528 3300009147 Bacteria 4558
144 Ga0114129_10099287 3300009147 Unclassified 4030
145 Ga0114129_10140900 3300009147 Bacteria 3306
146 Ga0114129_10197899 3300009147 Bacteria 2724
147 Ga0114129_10390551 3300009147 Bacteria 1836
148 Ga0114129_10479443 3300009147 Bacteria 1628
149 Ga0114129_10611405 3300009147 Bacteria 1411
150 Ga0105243_10129920 3300009148 Unclassified 2136
151 Ga0105241_10072657 3300009174 Bacteria 2674
152 Ga0105241_10089699 3300009174 Bacteria 2423
153 Ga0105248_10085191 3300009177 Bacteria 3556
154 Ga0105237_10048297 3300009545 Bacteria 4278
155 Ga0105237_10074403 3300009545 Bacteria 3389
156 Ga0105238_10034584 3300009551 Bacteria 5141
157 Ga0105238_10140000 3300009551 Bacteria 2397
158 Ga0105238_10182537 3300009551 Bacteria 2075
159 Ga0105238_11043880 3300009551 Unclassified 839
160 Ga0105249_10053320 3300009553 Bacteria 3697
161 Ga0105249_10578210 3300009553 Bacteria 1176
162 Ga0105249_11524092 3300009553 Unclassified 741
163 Ga0105239_10421082 3300010375 Bacteria 1513
164 Ga0105246_10515044 3300011119 Bacteria 1018
165 Ga0105246_10529125 3300011119 Bacteria 1006
166 Ga0157373_10002105 3300013100 Bacteria 15069
167 Ga0157373_10004592 3300013100 Bacteria 10392
168 Ga0157373_10141518 3300013100 Bacteria 1692
169 Ga0157371_10254657 3300013102 Bacteria 1265
170 Ga0157370_10007000 3300013104 Bacteria 12316
171 Ga0157370_10033803 3300013104 Bacteria 4984
172 Ga0157370_10055037 3300013104 Bacteria 3792
173 Ga0157370_10056652 3300013104 Bacteria 3730
174 Ga0157370_10390050 3300013104 Bacteria 1282
175 Ga0157369_11451073 3300013105 Bacteria 698
176 Ga0157369_11451074 3300013105 Bacteria 698
177 Ga0157369_11452028 3300013105 Bacteria 698
178 Ga0157372_10005816 3300013307 Bacteria 13136
179 Ga0157372_10010235 3300013307 Bacteria 9958
180 Ga0157372_10022864 3300013307 Bacteria 6770
181 Ga0157372_10184516 3300013307 Bacteria 2416
182 Ga0157372_10278056 3300013307 Bacteria 1946
183 Ga0157372_10620898 3300013307 Bacteria 1260
184 Ga0157372_10717167 3300013307 Bacteria 1163
185 Ga0157372_12846315 3300013307 Bacteria 554
186 Ga0163163_11047127 3300014325 Bacteria 879
187 Ga0157379_10217111 3300014968 Bacteria 1732
188 Ga0157379_11859090 3300014968 Bacteria 593
189 Ga0206356_10995553 3300020070 Bacteria 697
190 Ga0206353_10230230 3300020082 Bacteria 565
191 Ga0213873_10119424 3300021358 Bacteria 773
192 Ga0213872_10012181 3300021361 Bacteria 4055
193 Ga0213875_10015726 3300021388 Bacteria 3680
194 Ga0213875_10023590 3300021388 Bacteria 2937
195 Ga0213875_10218165 3300021388 Bacteria 898
196 Ga0213875_10252315 3300021388 Bacteria 832
197 Ga0213871_10000239 3300021441 Bacteria 6606
198 Ga0207653_10144910 3300025885 Unclassified 871
199 Ga0207710_10141790 3300025900 Bacteria 1160
200 Ga0207680_10563176 3300025903 Bacteria 814
201 Ga0207647_10195259 3300025904 Bacteria 1172
202 Ga0207699_10367615 3300025906 Bacteria 1018
203 Ga0207645_10404758 3300025907 Bacteria 918
204 Ga0207705_10000034 3300025909 Bacteria 216943
205 Ga0207705_10005800 3300025909 Bacteria 9198
206 Ga0207705_10028848 3300025909 Bacteria 3955
207 Ga0207705_10081824 3300025909 Bacteria 2354
208 Ga0207705_10284691 3300025909 Unclassified 1266
209 Ga0207705_11266450 3300025909 Bacteria 564
210 Ga0207684_10315524 3300025910 Bacteria 1347
211 Ga0207654_10031490 3300025911 Bacteria 2922
212 Ga0207707_10031552 3300025912 Bacteria 4636
213 Ga0207707_10105565 3300025912 Bacteria 2462
214 Ga0207707_10411517 3300025912 Bacteria 1160
215 Ga0207695_10099174 3300025913 Bacteria 2911
216 Ga0207695_10263498 3300025913 Bacteria 1621
217 Ga0207671_10163691 3300025914 Bacteria 1724
218 Ga0207671_10480133 3300025914 Bacteria 991
219 Ga0207693_10351903 3300025915 Unclassified 1153
220 Ga0207663_10031069 3300025916 Bacteria 3157
221 Ga0207663_10071065 3300025916 Bacteria 2245
222 Ga0207660_10016970 3300025917 Bacteria 4830
223 Ga0207660_10077426 3300025917 Bacteria 2434
224 Ga0207660_10106697 3300025917 Bacteria 2100
225 Ga0207660_10166372 3300025917 Bacteria 1705
226 Ga0207660_10924904 3300025917 Bacteria 711
227 Ga0207662_10145947 3300025918 Bacteria 1502
228 Ga0207657_10006614 3300025919 Bacteria 11997
229 Ga0207657_10033731 3300025919 Bacteria 4611
230 Ga0207657_10039300 3300025919 Bacteria 4207
231 Ga0207657_11416099 3300025919 Unclassified 522
232 Ga0207649_10193689 3300025920 Bacteria 1431
233 Ga0207649_10435203 3300025920 Bacteria 987
234 Ga0207649_11015901 3300025920 Bacteria 653
235 Ga0207649_11367651 3300025920 Bacteria 560
236 Ga0207652_10005927 3300025921 Bacteria 9884
237 Ga0207652_10068455 3300025921 Bacteria 3080
238 Ga0207652_10212484 3300025921 Bacteria 1742
239 Ga0207681_10311091 3300025923 Bacteria 1249
240 Ga0207694_10061112 3300025924 Bacteria 2932
241 Ga0207694_10111881 3300025924 Bacteria 2173
242 Ga0207694_10299881 3300025924 Bacteria 1323
243 Ga0207694_10782163 3300025924 Unclassified 806
244 Ga0207694_10898973 3300025924 Bacteria 749
245 Ga0207659_10331806 3300025926 Bacteria 1258
246 Ga0207664_10106349 3300025929 Bacteria 2326
247 Ga0207664_10335862 3300025929 Bacteria 1335
248 Ga0207664_10370060 3300025929 Bacteria 1271
249 Ga0207690_10040953 3300025932 Bacteria 3032
250 Ga0207690_10164321 3300025932 Bacteria 1657
251 Ga0207690_10299092 3300025932 Bacteria 1259
252 Ga0207709_11703194 3300025935 Unclassified 524
253 Ga0207670_10150727 3300025936 Bacteria 1725
254 Ga0207691_10576658 3300025940 Bacteria 953
255 Ga0207711_10849875 3300025941 Bacteria 849
256 Ga0207689_10044939 3300025942 Bacteria 3653
257 Ga0207661_10093714 3300025944 Bacteria 2507
258 Ga0207661_10696308 3300025944 Bacteria 934
259 Ga0207679_10228093 3300025945 Bacteria 1571
260 Ga0207667_10000251 3300025949 Bacteria 75691
261 Ga0207667_10016950 3300025949 Bacteria 8218
262 Ga0207667_10059855 3300025949 Bacteria 3987
263 Ga0207667_10197337 3300025949 Bacteria 2065
264 Ga0207667_11651966 3300025949 Bacteria 608
265 Ga0207712_10061834 3300025961 Bacteria 2659
266 Ga0207712_10502344 3300025961 Bacteria 1037
267 Ga0207640_10029332 3300025981 Bacteria 3376
268 Ga0207640_10056543 3300025981 Bacteria 2576
269 Ga0207639_10007998 3300026041 Bacteria 7223
270 Ga0207639_10313194 3300026041 Bacteria 1391
271 Ga0207678_10009211 3300026067 Bacteria 8688
272 Ga0207678_10043371 3300026067 Bacteria 3892
273 Ga0207678_10320234 3300026067 Unclassified 1334
274 Ga0207702_10059999 3300026078 Bacteria 3242
275 Ga0207702_10101977 3300026078 Bacteria 2535
276 Ga0207702_11225248 3300026078 Bacteria 745
277 Ga0207676_10144572 3300026095 Bacteria 2041
278 Ga0207676_11268102 3300026095 Bacteria 731
279 Ga0207674_10008769 3300026116 Bacteria 11645
280 Ga0207674_10067648 3300026116 Bacteria 3596
281 Ga0207674_10195233 3300026116 Bacteria 1974
282 Ga0207674_10283131 3300026116 Bacteria 1606
283 Ga0207675_100029002 3300026118 Bacteria 5156
284 Ga0207675_100503125 3300026118 Bacteria 1206
285 Ga0209971_1076199 3300027682 Bacteria 816
286 Ga0268265_10198905 3300028380 Bacteria 1737
287 Ga0268265_10669003 3300028380 Bacteria 1000
288 Ga0268265_10893294 3300028380 Bacteria 872
289 Ga0268264_10055851 3300028381 Bacteria 3300
290 Ga0268264_11104688 3300028381 Unclassified 801
291 Ga0316575_10006093 3300031665 Bacteria 4325
292 Ga0316575_10107898 3300031665 Bacteria 1135
293 Ga0316579_10054244 3300031691 Bacteria 1879
294 Ga0316579_10084316 3300031691 Bacteria 1515
295 Ga0316579_10484793 3300031691 Unclassified 598
296 Ga0316579_10506015 3300031691 Unclassified 584
297 Ga0316576_10021976 3300031727 Bacteria 4422
298 Ga0316576_10141453 3300031727 Bacteria 1812
299 Ga0316578_10060133 3300031728 Bacteria 2236
300 Ga0316578_10103496 3300031728 Unclassified 1708
301 Ga0316578_10166138 3300031728 Bacteria 1330
302 Ga0316577_10000403 3300031733 Bacteria 16625
303 Ga0316577_10569793 3300031733 Unclassified 644
304 Ga0307412_11880936 3300031911 Unclassified 552
305 Ga0307416_100637651 3300032002 Unclassified 1149
306 Ga0307416_101195236 3300032002 Unclassified 866
307 Ga0307411_10922558 3300032005 Bacteria 777
308 Ga0307415_100706168 3300032126 Unclassified 911
309 Ga0307415_101329370 3300032126 Unclassified 682
310 Ga0373941_0222897 3300035115 Bacteria 726
311 Ga0316574_0165506 3300035398 Bacteria 1424
312 Ga0316574_0183419 3300035398 Bacteria 1346
313 Ga0316574_0216265 3300035398 Bacteria 1229
314 Ga0373933_0184889 3300035724 Bacteria 1330
315 Ga0373937_0057019 3300036401 Bacteria 3588
316 Ga0373937_1048783 3300036401 Bacteria 764
317 Ga0316582_0012633 3300036647 Unclassified 4720
318 Ga0316582_0897155 3300036647 Bacteria 606
319 Ga0316584_0000036 3300036712 Bacteria 48276
320 Ga0316584_0094158 3300036712 Bacteria 2243
321 Ga0316584_0135317 3300036712 Bacteria 1840
322 Ga0316584_0350307 3300036712 Bacteria 1060
323 Ga0316584_0416777 3300036712 Bacteria 954
324 Ga0395899_0603531 3300037312 Bacteria 699
325 Ga0395900_0565709 3300037418 Bacteria 1080
326 Ga0395905_0270502 3300037471 Bacteria 1585
327 Ga0436364_0162742 3300037853 Bacteria 668
328 Ga0436364_0185420 3300037853 Bacteria 2184
329 Ga0436364_0314824 3300037853 Bacteria 921
330 Ga0436364_0515841 3300037853 Bacteria 16542
331 Ga0436364_0914385 3300037853 Bacteria 1740
332 Ga0436365_0373800 3300039437 Unclassified 1003
333 Ga0436360_0888261 3300039438 Bacteria 23248
334 Ga0436361_0919035 3300039447 Bacteria 12873
335 Ga0436363_0474768 3300039450 Unclassified 931
336 Ga0436363_1446141 3300039450 Bacteria 1269
337 Ga0436363_1588567 3300039450 Bacteria 793
338 Ga0436362_0144170 3300039453 Bacteria 12661
339 Ga0436362_0427475 3300039453 Bacteria 874
340 Ga0436362_0462721 3300039453 Bacteria 965
341 Ga0436362_0468664 3300039453 Archaea 687
342 Ga0436362_0552605 3300039453 Bacteria 543
343 Ga0439448_0307299 3300042005 Bacteria 563
344 Ga0450890_054310 3300042127 Bacteria 617
345 Ga0451577_0001377 3300042876 Bacteria 32574
346 Ga0451577_0303520 3300042876 Bacteria 1446
347 Ga0451577_0598574 3300042876 Bacteria 1000
348 Ga0451577_0818809 3300042876 Bacteria 841
349 Ga0453683_0026791 3300044673 Bacteria 3659
350 Ga0453683_0059636 3300044673 Bacteria 2385
351 Ga0453683_0075927 3300044673 Bacteria 2104
352 Ga0453683_0220297 3300044673 Bacteria 1206
353 Ga0453683_0418554 3300044673 Unclassified 865
354 Ga0453683_0454818 3300044673 Bacteria 828
355 Ga0466964_0852409 3300044706 Bacteria 518
356 Ga0453684_0072547 3300044712 Bacteria 4346
357 Ga0453684_0137991 3300044712 Bacteria 2916
358 Ga0453684_0153927 3300044712 Unclassified 2729
359 Ga0453684_0193946 3300044712 Bacteria 2374
360 Ga0453684_0284258 3300044712 Bacteria 1885
361 Ga0453684_0344779 3300044712 Bacteria 1681
362 Ga0453684_0483860 3300044712 Bacteria 1373
363 Ga0453684_0540841 3300044712 Bacteria 1284
364 Ga0453684_1014537 3300044712 Bacteria 882
365 Ga0453684_1586278 3300044712 Bacteria 672
366 Ga0453684_1748428 3300044712 Bacteria 634
367 Ga0453684_2349287 3300044712 Bacteria 529
368 Ga0451576_0000189 3300045051 Bacteria 155001
369 Ga0451576_0007675 3300045051 Bacteria 12827
370 Ga0451576_0045044 3300045051 Bacteria 4648
371 Ga0451576_0592429 3300045051 Bacteria 1165
372 Ga0451576_0801896 3300045051 Bacteria 989
373 Ga0466958_0079993 3300045836 Bacteria 2010
374 Ga0466967_0163358 3300045976 Bacteria 2092
375 Ga0495580_0540391 3300046472 Bacteria 775
376 Ga0495594_0166940 3300046499 Archaea 1252
377 Ga0495587_0069354 3300046536 Bacteria 2053
378 Ga0495633_0089406 3300046558 Archaea 1432
379 Ga0495623_0147344 3300046679 Bacteria 1395
380 Ga0495658_0050942 3300046683 Bacteria 2344
381 Ga0495658_0487201 3300046683 Bacteria 788
382 Ga0496101_1042838 3300048904 Bacteria 643
383 Ga0501299_010749 3300049522 Bacteria 1534
384 Ga0501031_0115449 3300049568 Bacteria 1754
385 Ga0501033_0585337 3300049570 Bacteria 766
386 Ga0501034_0039023 3300049571 Bacteria 4810
387 Ga0501036_0694228 3300049572 Unclassified 841
388 Ga0501037_0076344 3300049573 Bacteria 2433
389 Ga0501038_0102012 3300049574 Bacteria 2388
390 Ga0501038_0478292 3300049574 Bacteria 955
391 Ga0501039_0022714 3300049575 Bacteria 4813
392 Ga0501039_0171492 3300049575 Bacteria 1706
393 Ga0501040_0901697 3300049576 Unclassified 640
394 Ga0501041_0265684 3300049577 Bacteria 1079
395 Ga0501041_0862879 3300049577 Unclassified 581
396 Ga0501046_0344016 3300049580 Unclassified 1084
397 Ga0501047_0034154 3300049581 Bacteria 4911
398 Ga0501047_0566515 3300049581 Bacteria 959
399 Ga0501067_0031740 3300049583 Bacteria 2931
400 Ga0501068_0069909 3300049584 Bacteria 2141
401 Ga0501068_0132021 3300049584 Bacteria 1562
402 Ga0501068_0145560 3300049584 Bacteria 1487
403 Ga0501069_0101580 3300049585 Bacteria 1633
404 Ga0501069_0252275 3300049585 Bacteria 1029
405 Ga0501070_0009407 3300049586 Bacteria 8261
406 Ga0501070_0056277 3300049586 Bacteria 3260
407 Ga0501070_0839802 3300049586 Bacteria 719
408 Ga0501071_0011320 3300049587 Bacteria 6006
409 Ga0501071_0962194 3300049587 Bacteria 659
410 Ga0501072_0006805 3300049588 Bacteria 8679
411 Ga0501072_0023948 3300049588 Bacteria 4745
412 Ga0501072_0047874 3300049588 Bacteria 3367
413 Ga0501072_0056700 3300049588 Bacteria 3087
414 Ga0501073_0005057 3300049589 Bacteria 9889
415 Ga0501073_0158126 3300049589 Bacteria 1570
416 Ga0501074_0026143 3300049590 Bacteria 4233
417 Ga0501074_0784771 3300049590 Bacteria 671
418 Ga0501075_0100479 3300049591 Bacteria 2197
419 Ga0501075_0292751 3300049591 Bacteria 1240
420 Ga0501076_0004233 3300049592 Bacteria 10152
421 Ga0501076_0092552 3300049592 Bacteria 2432
422 Ga0501076_0142013 3300049592 Bacteria 1951
423 Ga0501076_0630047 3300049592 Unclassified 885
424 Ga0501076_0669104 3300049592 Bacteria 857
425 Ga0501077_0035873 3300049593 Bacteria 3157
426 Ga0501079_0031668 3300049741 Bacteria 4065
427 Ga0501079_0074868 3300049741 Bacteria 2618
428 Ga0501079_0093366 3300049741 Bacteria 2331
429 Ga0501079_0761890 3300049741 Unclassified 762
430 Ga0501080_0003540 3300049742 Bacteria 13755
431 Ga0501080_0050289 3300049742 Bacteria 3880
432 Ga0501080_0109359 3300049742 Bacteria 2562
433 Ga0501080_1013546 3300049742 Bacteria 720
434 Ga0501081_0207831 3300049743 Bacteria 1421
435 Ga0501081_0488431 3300049743 Unclassified 917
436 Ga0501083_0007271 3300049744 Bacteria 7857
437 Ga0501083_0061741 3300049744 Bacteria 2502
438 Ga0501083_0314896 3300049744 Bacteria 1018
439 Ga0501044_0241295 3300049823 Bacteria 1751
440 Ga0501045_0291827 3300049824 Bacteria 1213
441 Ga0501045_1001044 3300049824 Bacteria 613
442 nmdc:mga05p37_1021177_c1 3300050507 Bacteria 876
443 nmdc:mga05p37_130445_c1 3300050507 Bacteria 3084
444 nmdc:mga05p37_317834_c1 3300050507 Bacteria 1844
445 nmdc:mga05p37_38945_c1 3300050507 Bacteria 5832
446 nmdc:mga05p37_71934_c1 3300050507 Unclassified 4255
447 nmdc:mga05p37_771258_c1 3300050507 Bacteria 1057
448 nmdc:mga09592_1240519_c1 3300050508 Bacteria 615
449 nmdc:mga09592_204567_c1 3300050508 Archaea 1710
450 nmdc:mga09592_20628_c1 3300050508 Bacteria 5421
451 nmdc:mga09592_21325_c1 3300050508 Bacteria 5340
452 nmdc:mga09592_253546_c1 3300050508 Bacteria 1525
453 nmdc:mga09592_47743_c1 3300050508 Bacteria 3609
454 nmdc:mga0qj67_168155_c1 3300050509 Unclassified 1780
455 nmdc:mga0qj67_95304_c1 3300050509 Bacteria 2395
456 nmdc:mga06r32_1594000_c1 3300050510 Unclassified 591
457 nmdc:mga06r32_1754516_c1 3300050510 Unclassified 557
458 nmdc:mga06r32_420384_c1 3300050510 Bacteria 1318
459 nmdc:mga06r32_934153_c1 3300050510 Bacteria 822
460 nmdc:mga08y16_1963380_c1 3300050511 Unclassified 535
461 nmdc:mga0n895_31753_c1 3300050512 Bacteria 5060
462 nmdc:mga0n895_899105_c1 3300050512 Unclassified 871
463 nmdc:mga0a205_130624_c1 3300050515 Bacteria 2412
464 nmdc:mga0a205_7075_c1 3300050515 Bacteria 10134
465 Ga0501084_0022229 3300054114 Bacteria 5292
466 Ga0501084_0081607 3300054114 Bacteria 2712
467 Ga0501084_0300273 3300054114 Bacteria 1356
468 Ga0501082_0234746 3300060353 Bacteria 1596
469 Ga0501082_0262388 3300060353 Bacteria 1503
470 Ga0530510_0131520 3300061734 Bacteria 1841

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_1446141 Ga0436363_1446141_441_830 116
2 3300039453 Ga0436362_0468664 Ga0436362_0468664_22_432 124
3 3300005340 Ga0070689_101580790 Ga0070689_1015807901 125
4 3300005353 Ga0070669_100184507 Ga0070669_1001845072 125
5 3300005367 Ga0070667_101687696 Ga0070667_1016876961 125
6 3300005458 Ga0070681_10540924 Ga0070681_105409242 125
7 3300005577 Ga0068857_100162717 Ga0068857_1001627173 125
8 3300005617 Ga0068859_100054328 Ga0068859_1000543283 125
9 3300005842 Ga0068858_100694357 Ga0068858_1006943572 125
10 3300005843 Ga0068860_100044549 Ga0068860_1000445493 125
11 3300005844 Ga0068862_100349328 Ga0068862_1003493283 125
12 3300005844 Ga0068862_101568517 Ga0068862_1015685172 125
13 3300006175 Ga0070712_100062673 Ga0070712_1000626733 125
14 3300006175 Ga0070712_100086238 Ga0070712_1000862383 125
15 3300006931 Ga0097620_100054327 Ga0097620_1000543273 125
16 3300009098 Ga0105245_10524576 Ga0105245_105245762 125
17 3300009101 Ga0105247_10141821 Ga0105247_101418213 125
18 3300009177 Ga0105248_10085191 Ga0105248_100851913 125
19 3300014325 Ga0163163_11047127 Ga0163163_110471272 125
20 3300014968 Ga0157379_10217111 Ga0157379_102171112 125
21 3300014968 Ga0157379_11859090 Ga0157379_118590902 125
22 3300025900 Ga0207710_10141790 Ga0207710_101417902 125
23 3300025903 Ga0207680_10563176 Ga0207680_105631761 125
24 3300025907 Ga0207645_10404758 Ga0207645_104047582 125
25 3300025909 Ga0207705_10005800 Ga0207705_100058008 125
26 3300025912 Ga0207707_10411517 Ga0207707_104115173 125
27 3300025915 Ga0207693_10351903 Ga0207693_103519032 125
28 3300025918 Ga0207662_10145947 Ga0207662_101459472 125
29 3300025923 Ga0207681_10311091 Ga0207681_103110912 125
30 3300025924 Ga0207694_10299881 Ga0207694_102998812 125
31 3300025926 Ga0207659_10331806 Ga0207659_103318062 125
32 3300025932 Ga0207690_10164321 Ga0207690_101643212 125
33 3300025936 Ga0207670_10150727 Ga0207670_101507272 125
34 3300025940 Ga0207691_10576658 Ga0207691_105766582 125
35 3300025941 Ga0207711_10849875 Ga0207711_108498751 125
36 3300025942 Ga0207689_10044939 Ga0207689_100449396 125
37 3300025944 Ga0207661_10093714 Ga0207661_100937145 125
38 3300025961 Ga0207712_10061834 Ga0207712_100618342 125
39 3300026095 Ga0207676_10144572 Ga0207676_101445723 125
40 3300026116 Ga0207674_10283131 Ga0207674_102831312 125
41 3300026118 Ga0207675_100029002 Ga0207675_1000290023 125
42 3300026118 Ga0207675_100503125 Ga0207675_1005031252 125
43 3300027682 Ga0209971_1076199 Ga0209971_10761992 125
44 3300028380 Ga0268265_10198905 Ga0268265_101989053 125
45 3300028380 Ga0268265_10893294 Ga0268265_108932942 125
46 3300028381 Ga0268264_10055851 Ga0268264_100558514 125
47 3300035724 Ga0373933_0184889 Ga0373933_0184889_755_1132 125
48 3300036401 Ga0373937_0057019 Ga0373937_0057019_2357_2734 125
49 3300042127 Ga0450890_054310 Ga0450890_054310_22_399 125
50 3300042876 Ga0451577_0818809 Ga0451577_0818809_179_556 125
51 3300044712 Ga0453684_1748428 Ga0453684_1748428_126_503 125
52 3300046472 Ga0495580_0540391 Ga0495580_0540391_166_543 125
53 3300046499 Ga0495594_0166940 Ga0495594_0166940_844_1221 125
54 3300046536 Ga0495587_0069354 Ga0495587_0069354_1230_1607 125
55 3300046558 Ga0495633_0089406 Ga0495633_0089406_234_611 125
56 3300046679 Ga0495623_0147344 Ga0495623_0147344_309_686 125
57 3300046683 Ga0495658_0050942 Ga0495658_0050942_1654_2031 125
58 3300046683 Ga0495658_0487201 Ga0495658_0487201_348_725 125
59 3300005336 Ga0070680_100311077 Ga0070680_1003110772 126
60 3300005337 Ga0070682_100170755 Ga0070682_1001707551 126
61 3300005344 Ga0070661_100053149 Ga0070661_1000531492 126
62 3300005458 Ga0070681_10001636 Ga0070681_100016368 126
63 3300005530 Ga0070679_100180300 Ga0070679_1001803002 126
64 3300005539 Ga0068853_100061638 Ga0068853_1000616383 126
65 3300005547 Ga0070693_100068657 Ga0070693_1000686572 126
66 3300005564 Ga0070664_101154061 Ga0070664_1011540612 126
67 3300005577 Ga0068857_100108090 Ga0068857_1001080902 126
68 3300013100 Ga0157373_10002105 Ga0157373_100021053 126
69 3300013104 Ga0157370_10007000 Ga0157370_1000700012 126
70 3300013307 Ga0157372_10010235 Ga0157372_100102359 126
71 3300025912 Ga0207707_10031552 Ga0207707_100315522 126
72 3300025917 Ga0207660_10077426 Ga0207660_100774263 126
73 3300025920 Ga0207649_10435203 Ga0207649_104352032 126
74 3300025921 Ga0207652_10212484 Ga0207652_102124842 126
75 3300026041 Ga0207639_10007998 Ga0207639_100079982 126
76 3300026116 Ga0207674_10195233 Ga0207674_101952332 126
77 3300031665 Ga0316575_10006093 Ga0316575_100060934 126
78 3300031733 Ga0316577_10569793 Ga0316577_105697931 126
79 3300037853 Ga0436364_0162742 Ga0436364_0162742_163_546 126
80 3300042005 Ga0439448_0307299 Ga0439448_0307299_79_528 126
81 3300044712 Ga0453684_1586278 Ga0453684_1586278_136_516 126
82 3300005545 Ga0070695_100048347 Ga0070695_1000483472 127
83 3300021388 Ga0213875_10023590 Ga0213875_100235902 127
84 3300031691 Ga0316579_10084316 Ga0316579_100843162 127
85 3300031727 Ga0316576_10021976 Ga0316576_100219762 127
86 3300031733 Ga0316577_10000403 Ga0316577_100004036 127
87 3300035398 Ga0316574_0165506 Ga0316574_0165506_355_741 127
88 3300036712 Ga0316584_0000036 Ga0316584_0000036_31638_32024 127
89 3300037853 Ga0436364_0515841 Ga0436364_0515841_8344_8730 127
90 3300039450 Ga0436363_1588567 Ga0436363_1588567_204_593 127
91 3300044673 Ga0453683_0075927 Ga0453683_0075927_1394_1777 127
92 3300044712 Ga0453684_1014537 Ga0453684_1014537_60_443 127
93 3300045051 Ga0451576_0000189 Ga0451576_0000189_1555_1938 127
94 3300005336 Ga0070680_100130944 Ga0070680_1001309442 128
95 3300005458 Ga0070681_10337873 Ga0070681_103378733 128
96 3300009093 Ga0105240_10158708 Ga0105240_101587083 128
97 3300013104 Ga0157370_10033803 Ga0157370_100338034 128
98 3300025913 Ga0207695_10099174 Ga0207695_100991741 128
99 3300025917 Ga0207660_10166372 Ga0207660_101663722 128
100 3300025919 Ga0207657_10033731 Ga0207657_100337316 128
101 3300025949 Ga0207667_11651966 Ga0207667_116519661 128
102 3300031728 Ga0316578_10103496 Ga0316578_101034962 128
103 3300035398 Ga0316574_0183419 Ga0316574_0183419_49_435 128
104 3300039450 Ga0436363_0474768 Ga0436363_0474768_187_576 128
105 3300049574 Ga0501038_0102012 Ga0501038_0102012_1426_1815 128
106 3300049575 Ga0501039_0022714 Ga0501039_0022714_163_552 128
107 3300049584 Ga0501068_0145560 Ga0501068_0145560_548_934 128
108 3300049587 Ga0501071_0962194 Ga0501071_0962194_159_545 128
109 3300049588 Ga0501072_0023948 Ga0501072_0023948_574_963 128
110 3300054114 Ga0501084_0081607 Ga0501084_0081607_1831_2220 128
111 3300005327 Ga0070658_10070138 Ga0070658_100701382 129
112 3300005329 Ga0070683_100033003 Ga0070683_1000330035 129
113 3300005336 Ga0070680_100060124 Ga0070680_1000601245 129
114 3300005336 Ga0070680_100344119 Ga0070680_1003441192 129
115 3300005339 Ga0070660_100046541 Ga0070660_1000465415 129
116 3300005339 Ga0070660_100055895 Ga0070660_1000558953 129
117 3300005339 Ga0070660_100153385 Ga0070660_1001533853 129
118 3300005344 Ga0070661_100028594 Ga0070661_1000285945 129
119 3300005344 Ga0070661_100079914 Ga0070661_1000799144 129
120 3300005366 Ga0070659_100042245 Ga0070659_1000422452 129
121 3300005366 Ga0070659_100042305 Ga0070659_1000423056 129
122 3300005366 Ga0070659_100189326 Ga0070659_1001893261 129
123 3300005435 Ga0070714_100051898 Ga0070714_1000518982 129
124 3300005437 Ga0070710_10208848 Ga0070710_102088483 129
125 3300005455 Ga0070663_100086748 Ga0070663_1000867484 129
126 3300005530 Ga0070679_100016232 Ga0070679_1000162324 129
127 3300005530 Ga0070679_100555841 Ga0070679_1005558411 129
128 3300005535 Ga0070684_100029885 Ga0070684_1000298854 129
129 3300005535 Ga0070684_100139864 Ga0070684_1001398642 129
130 3300005539 Ga0068853_100126609 Ga0068853_1001266092 129
131 3300005547 Ga0070693_100255701 Ga0070693_1002557012 129
132 3300005564 Ga0070664_100320896 Ga0070664_1003208963 129
133 3300005564 Ga0070664_101154020 Ga0070664_1011540203 129
134 3300005577 Ga0068857_100351771 Ga0068857_1003517712 129
135 3300005577 Ga0068857_101295843 Ga0068857_1012958431 129
136 3300005578 Ga0068854_100032709 Ga0068854_1000327092 129
137 3300005578 Ga0068854_100061497 Ga0068854_1000614972 129
138 3300005614 Ga0068856_100031085 Ga0068856_1000310852 129
139 3300005616 Ga0068852_100226508 Ga0068852_1002265082 129
140 3300005834 Ga0068851_10158790 Ga0068851_101587904 129
141 3300009093 Ga0105240_10876688 Ga0105240_108766882 129
142 3300009174 Ga0105241_10072657 Ga0105241_100726572 129
143 3300009545 Ga0105237_10048297 Ga0105237_100482975 129
144 3300009545 Ga0105237_10074403 Ga0105237_100744034 129
145 3300009551 Ga0105238_10034584 Ga0105238_100345846 129
146 3300009551 Ga0105238_10140000 Ga0105238_101400004 129
147 3300010375 Ga0105239_10421082 Ga0105239_104210822 129
148 3300013100 Ga0157373_10004592 Ga0157373_100045927 129
149 3300013105 Ga0157369_11451073 Ga0157369_114510732 129
150 3300013105 Ga0157369_11451074 Ga0157369_114510742 129
151 3300013307 Ga0157372_10022864 Ga0157372_100228647 129
152 3300013307 Ga0157372_10278056 Ga0157372_102780562 129
153 3300013307 Ga0157372_12846315 Ga0157372_128463152 129
154 3300020070 Ga0206356_10995553 Ga0206356_109955531 129
155 3300020082 Ga0206353_10230230 Ga0206353_102302301 129
156 3300025904 Ga0207647_10195259 Ga0207647_101952592 129
157 3300025909 Ga0207705_10081824 Ga0207705_100818242 129
158 3300025909 Ga0207705_11266450 Ga0207705_112664501 129
159 3300025911 Ga0207654_10031490 Ga0207654_100314904 129
160 3300025912 Ga0207707_10105565 Ga0207707_101055652 129
161 3300025913 Ga0207695_10263498 Ga0207695_102634982 129
162 3300025914 Ga0207671_10163691 Ga0207671_101636914 129
163 3300025914 Ga0207671_10480133 Ga0207671_104801332 129
164 3300025916 Ga0207663_10031069 Ga0207663_100310692 129
165 3300025917 Ga0207660_10016970 Ga0207660_100169706 129
166 3300025917 Ga0207660_10924904 Ga0207660_109249041 129
167 3300025919 Ga0207657_10006614 Ga0207657_100066143 129
168 3300025920 Ga0207649_10193689 Ga0207649_101936892 129
169 3300025920 Ga0207649_11367651 Ga0207649_113676511 129
170 3300025921 Ga0207652_10005927 Ga0207652_100059278 129
171 3300025924 Ga0207694_10061112 Ga0207694_100611123 129
172 3300025929 Ga0207664_10106349 Ga0207664_101063492 129
173 3300025932 Ga0207690_10040953 Ga0207690_100409532 129
174 3300025932 Ga0207690_10299092 Ga0207690_102990922 129
175 3300025944 Ga0207661_10696308 Ga0207661_106963082 129
176 3300025945 Ga0207679_10228093 Ga0207679_102280932 129
177 3300025949 Ga0207667_10016950 Ga0207667_1001695010 129
178 3300025949 Ga0207667_10059855 Ga0207667_100598556 129
179 3300025981 Ga0207640_10029332 Ga0207640_100293326 129
180 3300025981 Ga0207640_10056543 Ga0207640_100565434 129
181 3300026041 Ga0207639_10313194 Ga0207639_103131942 129
182 3300026067 Ga0207678_10043371 Ga0207678_100433712 129
183 3300026078 Ga0207702_10101977 Ga0207702_101019772 129
184 3300026116 Ga0207674_10008769 Ga0207674_100087692 129
185 3300026116 Ga0207674_10067648 Ga0207674_100676483 129
186 3300037312 Ga0395899_0603531 Ga0395899_0603531_216_605 129
187 3300037418 Ga0395900_0565709 Ga0395900_0565709_84_473 129
188 3300037471 Ga0395905_0270502 Ga0395905_0270502_593_982 129
189 3300042876 Ga0451577_0001377 Ga0451577_0001377_15029_15418 129
190 3300042876 Ga0451577_0598574 Ga0451577_0598574_432_821 129
191 3300044706 Ga0466964_0852409 Ga0466964_0852409_56_445 129
192 3300045051 Ga0451576_0592429 Ga0451576_0592429_206_595 129
193 3300049573 Ga0501037_0076344 Ga0501037_0076344_179_577 129
194 3300009551 Ga0105238_11043880 Ga0105238_110438801 130
195 3300025924 Ga0207694_10782163 Ga0207694_107821632 130
196 3300045836 Ga0466958_0079993 Ga0466958_0079993_187_585 130
197 3300005327 Ga0070658_10033243 Ga0070658_100332433 131
198 3300005435 Ga0070714_100256223 Ga0070714_1002562233 131
199 3300021358 Ga0213873_10119424 Ga0213873_101194242 131
200 3300021361 Ga0213872_10012181 Ga0213872_100121813 131
201 3300021388 Ga0213875_10015726 Ga0213875_100157262 131
202 3300021388 Ga0213875_10218165 Ga0213875_102181652 131
203 3300021388 Ga0213875_10252315 Ga0213875_102523152 131
204 3300021441 Ga0213871_10000239 Ga0213871_100002397 131
205 3300025909 Ga0207705_10028848 Ga0207705_100288483 131
206 3300025929 Ga0207664_10370060 Ga0207664_103700603 131
207 3300037853 Ga0436364_0185420 Ga0436364_0185420_735_1136 131
208 3300037853 Ga0436364_0314824 Ga0436364_0314824_213_620 131
209 3300037853 Ga0436364_0914385 Ga0436364_0914385_702_1109 131
210 3300039438 Ga0436360_0888261 Ga0436360_0888261_16175_16576 131
211 3300039447 Ga0436361_0919035 Ga0436361_0919035_10100_10501 131
212 3300039453 Ga0436362_0144170 Ga0436362_0144170_2201_2602 131
213 3300039453 Ga0436362_0427475 Ga0436362_0427475_179_586 131
214 3300039453 Ga0436362_0462721 Ga0436362_0462721_41_448 131
215 3300039453 Ga0436362_0552605 Ga0436362_0552605_25_432 131
216 3300044712 Ga0453684_0137991 Ga0453684_0137991_358_816 131
217 3300045051 Ga0451576_0007675 Ga0451576_0007675_8572_9033 131
218 3300049568 Ga0501031_0115449 Ga0501031_0115449_442_840 131
219 3300049570 Ga0501033_0585337 Ga0501033_0585337_312_710 131
220 3300049572 Ga0501036_0694228 Ga0501036_0694228_253_651 131
221 3300049574 Ga0501038_0478292 Ga0501038_0478292_328_726 131
222 3300049575 Ga0501039_0171492 Ga0501039_0171492_347_745 131
223 3300049576 Ga0501040_0901697 Ga0501040_0901697_25_423 131
224 3300049577 Ga0501041_0265684 Ga0501041_0265684_173_571 131
225 3300049584 Ga0501068_0132021 Ga0501068_0132021_855_1253 131
226 3300049585 Ga0501069_0252275 Ga0501069_0252275_254_652 131
227 3300049586 Ga0501070_0056277 Ga0501070_0056277_2380_2778 131
228 3300049587 Ga0501071_0011320 Ga0501071_0011320_2109_2507 131
229 3300049588 Ga0501072_0047874 Ga0501072_0047874_265_663 131
230 3300049589 Ga0501073_0158126 Ga0501073_0158126_532_930 131
231 3300049590 Ga0501074_0026143 Ga0501074_0026143_717_1115 131
232 3300049591 Ga0501075_0292751 Ga0501075_0292751_180_578 131
233 3300049592 Ga0501076_0092552 Ga0501076_0092552_1599_1997 131
234 3300049593 Ga0501077_0035873 Ga0501077_0035873_505_903 131
235 3300049741 Ga0501079_0093366 Ga0501079_0093366_1278_1676 131
236 3300049742 Ga0501080_0050289 Ga0501080_0050289_913_1311 131
237 3300049743 Ga0501081_0207831 Ga0501081_0207831_897_1295 131
238 3300049744 Ga0501083_0314896 Ga0501083_0314896_113_511 131
239 3300049824 Ga0501045_0291827 Ga0501045_0291827_439_837 131
240 3300054114 Ga0501084_0022229 Ga0501084_0022229_2060_2458 131
241 3300060353 Ga0501082_0262388 Ga0501082_0262388_65_463 131
242 3300005336 Ga0070680_100168270 Ga0070680_1001682702 132
243 3300005338 Ga0068868_100737310 Ga0068868_1007373101 132
244 3300005339 Ga0070660_100027491 Ga0070660_1000274914 132
245 3300005344 Ga0070661_100886681 Ga0070661_1008866811 132
246 3300005344 Ga0070661_101010710 Ga0070661_1010107101 132
247 3300005434 Ga0070709_10286376 Ga0070709_102863762 132
248 3300005435 Ga0070714_100688836 Ga0070714_1006888361 132
249 3300005439 Ga0070711_100116393 Ga0070711_1001163934 132
250 3300005458 Ga0070681_10009030 Ga0070681_100090303 132
251 3300005458 Ga0070681_11331519 Ga0070681_113315191 132
252 3300005530 Ga0070679_100107292 Ga0070679_1001072922 132
253 3300005563 Ga0068855_100098821 Ga0068855_1000988215 132
254 3300005614 Ga0068856_100000623 Ga0068856_1000006233 132
255 3300005616 Ga0068852_100029973 Ga0068852_1000299733 132
256 3300009174 Ga0105241_10089699 Ga0105241_100896992 132
257 3300009551 Ga0105238_10182537 Ga0105238_101825372 132
258 3300013100 Ga0157373_10141518 Ga0157373_101415182 132
259 3300013104 Ga0157370_10390050 Ga0157370_103900501 132
260 3300013105 Ga0157369_11452028 Ga0157369_114520282 132
261 3300013307 Ga0157372_10005816 Ga0157372_100058169 132
262 3300013307 Ga0157372_10184516 Ga0157372_101845162 132
263 3300025906 Ga0207699_10367615 Ga0207699_103676152 132
264 3300025916 Ga0207663_10071065 Ga0207663_100710651 132
265 3300025917 Ga0207660_10106697 Ga0207660_101066974 132
266 3300025919 Ga0207657_10039300 Ga0207657_100393004 132
267 3300025920 Ga0207649_11015901 Ga0207649_110159011 132
268 3300025921 Ga0207652_10068455 Ga0207652_100684553 132
269 3300025924 Ga0207694_10111881 Ga0207694_101118812 132
270 3300025924 Ga0207694_10898973 Ga0207694_108989732 132
271 3300025929 Ga0207664_10335862 Ga0207664_103358623 132
272 3300026078 Ga0207702_10059999 Ga0207702_100599993 132
273 3300026078 Ga0207702_11225248 Ga0207702_112252482 132
274 3300031727 Ga0316576_10141453 Ga0316576_101414532 132
275 3300031728 Ga0316578_10166138 Ga0316578_101661382 132
276 3300036712 Ga0316584_0350307 Ga0316584_0350307_363_806 132
277 3300039437 Ga0436365_0373800 Ga0436365_0373800_568_978 132
278 3300045976 Ga0466967_0163358 Ga0466967_0163358_1276_1722 132
279 3300048904 Ga0496101_1042838 Ga0496101_1042838_47_493 132
280 3300049571 Ga0501034_0039023 Ga0501034_0039023_1326_1772 132
281 3300049581 Ga0501047_0034154 Ga0501047_0034154_3989_4435 132
282 3300049581 Ga0501047_0566515 Ga0501047_0566515_371_778 132
283 3300049583 Ga0501067_0031740 Ga0501067_0031740_540_986 132
284 3300049584 Ga0501068_0069909 Ga0501068_0069909_1224_1670 132
285 3300049585 Ga0501069_0101580 Ga0501069_0101580_997_1443 132
286 3300049586 Ga0501070_0009407 Ga0501070_0009407_5938_6384 132
287 3300049586 Ga0501070_0839802 Ga0501070_0839802_53_502 132
288 3300049588 Ga0501072_0006805 Ga0501072_0006805_7056_7502 132
289 3300049589 Ga0501073_0005057 Ga0501073_0005057_1029_1475 132
290 3300049742 Ga0501080_0003540 Ga0501080_0003540_3632_4078 132
291 3300049742 Ga0501080_0109359 Ga0501080_0109359_748_1197 132
292 3300049742 Ga0501080_1013546 Ga0501080_1013546_223_630 132
293 3300049744 Ga0501083_0007271 Ga0501083_0007271_1768_2214 132
294 3300049744 Ga0501083_0061741 Ga0501083_0061741_732_1181 132
295 3300049823 Ga0501044_0241295 Ga0501044_0241295_1189_1596 132
296 3300005327 Ga0070658_10000043 Ga0070658_1000004315 133
297 3300005327 Ga0070658_10285797 Ga0070658_102857973 133
298 3300005339 Ga0070660_100637298 Ga0070660_1006372982 133
299 3300005435 Ga0070714_101803826 Ga0070714_1018038261 133
300 3300005455 Ga0070663_100161400 Ga0070663_1001614002 133
301 3300005455 Ga0070663_100286522 Ga0070663_1002865222 133
302 3300005563 Ga0068855_100155378 Ga0068855_1001553782 133
303 3300005563 Ga0068855_100164632 Ga0068855_1001646322 133
304 3300005563 Ga0068855_101362734 Ga0068855_1013627341 133
305 3300005616 Ga0068852_100598191 Ga0068852_1005981912 133
306 3300013102 Ga0157371_10254657 Ga0157371_102546573 133
307 3300013104 Ga0157370_10055037 Ga0157370_100550374 133
308 3300013104 Ga0157370_10056652 Ga0157370_100566525 133
309 3300013307 Ga0157372_10620898 Ga0157372_106208982 133
310 3300025909 Ga0207705_10000034 Ga0207705_10000034173 133
311 3300025909 Ga0207705_10284691 Ga0207705_102846912 133
312 3300025919 Ga0207657_11416099 Ga0207657_114160991 133
313 3300025949 Ga0207667_10000251 Ga0207667_1000025157 133
314 3300025949 Ga0207667_10197337 Ga0207667_101973374 133
315 3300026067 Ga0207678_10009211 Ga0207678_100092116 133
316 3300026067 Ga0207678_10320234 Ga0207678_103202342 133
317 3300013307 Ga0157372_10717167 Ga0157372_107171672 134
318 2162886007 SwRhRL2b_contig_1117078 SwRhRL2b_0847.00007560 136
319 3300005289 Ga0065704_10071224 Ga0065704_100712249 136
320 3300005289 Ga0065704_10150620 Ga0065704_101506202 136
321 3300005289 Ga0065704_10300263 Ga0065704_103002632 136
322 3300005295 Ga0065707_10000506 Ga0065707_1000050610 136
323 3300005295 Ga0065707_10089757 Ga0065707_100897574 136
324 3300005295 Ga0065707_10440084 Ga0065707_104400842 136
325 3300005336 Ga0070680_101762880 Ga0070680_1017628801 136
326 3300005340 Ga0070689_100233239 Ga0070689_1002332392 136
327 3300005345 Ga0070692_10927814 Ga0070692_109278141 136
328 3300005440 Ga0070705_100276594 Ga0070705_1002765942 136
329 3300005440 Ga0070705_101054563 Ga0070705_1010545632 136
330 3300005444 Ga0070694_100738960 Ga0070694_1007389601 136
331 3300005445 Ga0070708_100841110 Ga0070708_1008411101 136
332 3300005457 Ga0070662_101754369 Ga0070662_1017543691 136
333 3300005467 Ga0070706_100475283 Ga0070706_1004752832 136
334 3300005468 Ga0070707_100069756 Ga0070707_1000697561 136
335 3300005471 Ga0070698_100081138 Ga0070698_1000811383 136
336 3300005471 Ga0070698_100511050 Ga0070698_1005110502 136
337 3300005471 Ga0070698_101001247 Ga0070698_1010012471 136
338 3300005471 Ga0070698_101425694 Ga0070698_1014256942 136
339 3300005518 Ga0070699_100002719 Ga0070699_1000027194 136
340 3300005518 Ga0070699_100553920 Ga0070699_1005539202 136
341 3300005545 Ga0070695_101276450 Ga0070695_1012764502 136
342 3300005546 Ga0070696_100201013 Ga0070696_1002010132 136
343 3300005546 Ga0070696_100421312 Ga0070696_1004213122 136
344 3300005546 Ga0070696_100621923 Ga0070696_1006219232 136
345 3300005549 Ga0070704_100622076 Ga0070704_1006220762 136
346 3300005577 Ga0068857_100063538 Ga0068857_1000635384 136
347 3300005617 Ga0068859_101541848 Ga0068859_1015418482 136
348 3300005618 Ga0068864_100509516 Ga0068864_1005095161 136
349 3300005718 Ga0068866_10199610 Ga0068866_101996102 136
350 3300005843 Ga0068860_100616035 Ga0068860_1006160351 136
351 3300005985 Ga0081539_10161884 Ga0081539_101618842 136
352 3300005985 Ga0081539_10257501 Ga0081539_102575012 136
353 3300006844 Ga0075428_100148255 Ga0075428_1001482553 136
354 3300006844 Ga0075428_100299933 Ga0075428_1002999333 136
355 3300006844 Ga0075428_100883036 Ga0075428_1008830362 136
356 3300006844 Ga0075428_102727274 Ga0075428_1027272741 136
357 3300006846 Ga0075430_100114617 Ga0075430_1001146172 136
358 3300006846 Ga0075430_100186662 Ga0075430_1001866621 136
359 3300006847 Ga0075431_100024046 Ga0075431_1000240465 136
360 3300006847 Ga0075431_100977202 Ga0075431_1009772021 136
361 3300006847 Ga0075431_101237198 Ga0075431_1012371981 136
362 3300006852 Ga0075433_10025088 Ga0075433_100250886 136
363 3300006852 Ga0075433_10103120 Ga0075433_101031203 136
364 3300006871 Ga0075434_101059272 Ga0075434_1010592722 136
365 3300006880 Ga0075429_100034313 Ga0075429_1000343133 136
366 3300006880 Ga0075429_100096070 Ga0075429_1000960702 136
367 3300006880 Ga0075429_100219694 Ga0075429_1002196942 136
368 3300006880 Ga0075429_100253841 Ga0075429_1002538412 136
369 3300006880 Ga0075429_100296623 Ga0075429_1002966232 136
370 3300006880 Ga0075429_100605752 Ga0075429_1006057522 136
371 3300006880 Ga0075429_101489052 Ga0075429_1014890521 136
372 3300006931 Ga0097620_101541909 Ga0097620_1015419092 136
373 3300009094 Ga0111539_10019878 Ga0111539_100198782 136
374 3300009147 Ga0114129_10026326 Ga0114129_100263264 136
375 3300009147 Ga0114129_10079528 Ga0114129_100795285 136
376 3300009147 Ga0114129_10099287 Ga0114129_100992872 136
377 3300009147 Ga0114129_10140900 Ga0114129_101409002 136
378 3300009147 Ga0114129_10197899 Ga0114129_101978994 136
379 3300009147 Ga0114129_10390551 Ga0114129_103905512 136
380 3300009147 Ga0114129_10479443 Ga0114129_104794432 136
381 3300009147 Ga0114129_10611405 Ga0114129_106114052 136
382 3300009148 Ga0105243_10129920 Ga0105243_101299202 136
383 3300009553 Ga0105249_10053320 Ga0105249_100533202 136
384 3300009553 Ga0105249_10578210 Ga0105249_105782102 136
385 3300009553 Ga0105249_11524092 Ga0105249_115240921 136
386 3300011119 Ga0105246_10515044 Ga0105246_105150442 136
387 3300011119 Ga0105246_10529125 Ga0105246_105291251 136
388 3300025885 Ga0207653_10144910 Ga0207653_101449102 136
389 3300025910 Ga0207684_10315524 Ga0207684_103155242 136
390 3300025935 Ga0207709_11703194 Ga0207709_117031941 136
391 3300025961 Ga0207712_10502344 Ga0207712_105023442 136
392 3300026095 Ga0207676_11268102 Ga0207676_112681022 136
393 3300028380 Ga0268265_10669003 Ga0268265_106690031 136
394 3300028381 Ga0268264_11104688 Ga0268264_111046881 136
395 3300031665 Ga0316575_10107898 Ga0316575_101078982 136
396 3300031691 Ga0316579_10054244 Ga0316579_100542443 136
397 3300031691 Ga0316579_10484793 Ga0316579_104847931 136
398 3300031691 Ga0316579_10506015 Ga0316579_105060151 136
399 3300031728 Ga0316578_10060133 Ga0316578_100601332 136
400 3300031911 Ga0307412_11880936 Ga0307412_118809361 136
401 3300032002 Ga0307416_100637651 Ga0307416_1006376512 136
402 3300032002 Ga0307416_101195236 Ga0307416_1011952361 136
403 3300032005 Ga0307411_10922558 Ga0307411_109225582 136
404 3300032126 Ga0307415_100706168 Ga0307415_1007061682 136
405 3300032126 Ga0307415_101329370 Ga0307415_1013293701 136
406 3300035115 Ga0373941_0222897 Ga0373941_0222897_83_493 136
407 3300035398 Ga0316574_0216265 Ga0316574_0216265_151_615 136
408 3300036401 Ga0373937_1048783 Ga0373937_1048783_15_476 136
409 3300036647 Ga0316582_0012633 Ga0316582_0012633_286_696 136
410 3300036647 Ga0316582_0897155 Ga0316582_0897155_78_488 136
411 3300036712 Ga0316584_0094158 Ga0316584_0094158_617_1027 136
412 3300036712 Ga0316584_0135317 Ga0316584_0135317_256_666 136
413 3300036712 Ga0316584_0416777 Ga0316584_0416777_285_695 136
414 3300042876 Ga0451577_0303520 Ga0451577_0303520_423_833 136
415 3300044673 Ga0453683_0026791 Ga0453683_0026791_1762_2175 136
416 3300044673 Ga0453683_0059636 Ga0453683_0059636_756_1169 136
417 3300044673 Ga0453683_0220297 Ga0453683_0220297_255_665 136
418 3300044673 Ga0453683_0418554 Ga0453683_0418554_394_804 136
419 3300044673 Ga0453683_0454818 Ga0453683_0454818_21_431 136
420 3300044712 Ga0453684_0072547 Ga0453684_0072547_647_1057 136
421 3300044712 Ga0453684_0153927 Ga0453684_0153927_2115_2525 136
422 3300044712 Ga0453684_0193946 Ga0453684_0193946_1562_1972 136
423 3300044712 Ga0453684_0284258 Ga0453684_0284258_769_1179 136
424 3300044712 Ga0453684_0344779 Ga0453684_0344779_1041_1451 136
425 3300044712 Ga0453684_0483860 Ga0453684_0483860_247_657 136
426 3300044712 Ga0453684_0540841 Ga0453684_0540841_152_562 136
427 3300044712 Ga0453684_2349287 Ga0453684_2349287_52_465 136
428 3300045051 Ga0451576_0045044 Ga0451576_0045044_1258_1668 136
429 3300045051 Ga0451576_0801896 Ga0451576_0801896_383_793 136
430 3300049522 Ga0501299_010749 Ga0501299_010749_805_1215 136
431 3300049577 Ga0501041_0862879 Ga0501041_0862879_144_554 136
432 3300049580 Ga0501046_0344016 Ga0501046_0344016_52_462 136
433 3300049588 Ga0501072_0056700 Ga0501072_0056700_1076_1486 136
434 3300049590 Ga0501074_0784771 Ga0501074_0784771_88_498 136
435 3300049591 Ga0501075_0100479 Ga0501075_0100479_1317_1727 136
436 3300049592 Ga0501076_0004233 Ga0501076_0004233_3698_4108 136
437 3300049592 Ga0501076_0142013 Ga0501076_0142013_95_505 136
438 3300049592 Ga0501076_0630047 Ga0501076_0630047_395_805 136
439 3300049592 Ga0501076_0669104 Ga0501076_0669104_36_446 136
440 3300049741 Ga0501079_0031668 Ga0501079_0031668_169_579 136
441 3300049741 Ga0501079_0074868 Ga0501079_0074868_835_1245 136
442 3300049741 Ga0501079_0761890 Ga0501079_0761890_102_512 136
443 3300049743 Ga0501081_0488431 Ga0501081_0488431_415_825 136
444 3300049824 Ga0501045_1001044 Ga0501045_1001044_59_469 136
445 3300050507 nmdc:mga05p37_1021177_c1 nmdc:mga05p37_1021177_c1_365_775 136
446 3300050507 nmdc:mga05p37_130445_c1 nmdc:mga05p37_130445_c1_313_723 136
447 3300050507 nmdc:mga05p37_317834_c1 nmdc:mga05p37_317834_c1_1334_1774 136
448 3300050507 nmdc:mga05p37_38945_c1 nmdc:mga05p37_38945_c1_454_864 136
449 3300050507 nmdc:mga05p37_71934_c1 nmdc:mga05p37_71934_c1_27_437 136
450 3300050507 nmdc:mga05p37_771258_c1 nmdc:mga05p37_771258_c1_264_674 136
451 3300050508 nmdc:mga09592_1240519_c1 nmdc:mga09592_1240519_c1_89_499 136
452 3300050508 nmdc:mga09592_204567_c1 nmdc:mga09592_204567_c1_663_1073 136
453 3300050508 nmdc:mga09592_20628_c1 nmdc:mga09592_20628_c1_2694_3104 136
454 3300050508 nmdc:mga09592_21325_c1 nmdc:mga09592_21325_c1_4066_4476 136
455 3300050508 nmdc:mga09592_253546_c1 nmdc:mga09592_253546_c1_593_1003 136
456 3300050508 nmdc:mga09592_47743_c1 nmdc:mga09592_47743_c1_1154_1564 136
457 3300050509 nmdc:mga0qj67_168155_c1 nmdc:mga0qj67_168155_c1_87_497 136
458 3300050509 nmdc:mga0qj67_95304_c1 nmdc:mga0qj67_95304_c1_360_770 136
459 3300050510 nmdc:mga06r32_1594000_c1 nmdc:mga06r32_1594000_c1_170_580 136
460 3300050510 nmdc:mga06r32_1754516_c1 nmdc:mga06r32_1754516_c1_38_448 136
461 3300050510 nmdc:mga06r32_420384_c1 nmdc:mga06r32_420384_c1_238_648 136
462 3300050510 nmdc:mga06r32_934153_c1 nmdc:mga06r32_934153_c1_349_759 136
463 3300050511 nmdc:mga08y16_1963380_c1 nmdc:mga08y16_1963380_c1_95_505 136
464 3300050512 nmdc:mga0n895_31753_c1 nmdc:mga0n895_31753_c1_2497_2937 136
465 3300050512 nmdc:mga0n895_899105_c1 nmdc:mga0n895_899105_c1_149_559 136
466 3300050515 nmdc:mga0a205_130624_c1 nmdc:mga0a205_130624_c1_1902_2312 136
467 3300050515 nmdc:mga0a205_7075_c1 nmdc:mga0a205_7075_c1_3353_3793 136
468 3300054114 Ga0501084_0300273 Ga0501084_0300273_752_1162 136
469 3300060353 Ga0501082_0234746 Ga0501082_0234746_37_447 136
470 3300061734 Ga0530510_0131520 Ga0530510_0131520_980_1390 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

30

148

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tcc-assembly1.cif.gz_A crystal structure of salmo salar rida-1 0.988 7 132
1xrg-assembly1.cif.gz_A conserved hypothetical protein from clostridium thermocellum cth-2968 0.9866 7 129
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.9855 7 131
1oni-assembly2.cif.gz_D crystal structure of a human p14.5, a translational inhibitor reveals different mode of ligand binding near the invariant residues of the yjgf/uk114 protein family 0.9846 7 132
1nq3-assembly2.cif.gz_E crystal structure of the mammalian tumor associated antigen uk114 0.984 7 132
ID Description Score Start End Superfamily
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9855 7 131 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9846 7 132 3.30.1330.40
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9818 6 130 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9807 6 131 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9799 23 130 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A650CY14-F1-model_v4 Deaminase 1 7 130 GO:0005829
GO:0019239
AF-A0A355EUG6-F1-model_v4 Reactive intermediate/imine deaminase 0.9996 7 129 GO:0005829
GO:0019239
AF-A0A131XL15-F1-model_v4 Putative translation initiation inhibitor 0.9984 7 129 GO:0005739
GO:0005829
GO:0019239
AF-A0A7C7LN84-F1-model_v4 RidA family protein 0.9983 7 128 GO:0005829
GO:0019239
AF-A0A1V5KQ36-F1-model_v4 Enamine/imine deaminase (EC 3.5.4.-) 0.9972 7 131 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
95.17 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map