F450402

General Info

Members Datasets Scaffolds Average Seq Length
470 263 470 286

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10587056|Ga0105245_105870562
Length 307
Sequence LELTTLQGKFNRIVNLWQREEPMTAAERNPEPKNPLGIDGIEFIEYTTSQAQAFGALLQKMGFAAVARHRSREVMLYRQGSMNLIVNSHGAADPVPTVNAIALRVRDAAFAHQHSIDLGAWDMPTRASAMELHIPGIHGVGDSLIYFVDRYADFSIYDVDFIFESNIKNAKPPALAGLHWFGVVQAILPDRTADWLDFYESLFGFEVLPRGQYFGVLPKGTLLESPCHKFYLQLIEPPPGAEDVHWDEGLVRVGLGAPDVPKAVKTLQERGIVFVDNGAVQPSDKGALTQVYLGGVTFELVVSHLKP

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
257 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
258 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 0.21
Rhizosphere 97.45
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10166755 3300005295 Bacteria 1513
2 Ga0070690_100019686 3300005330 Bacteria 4102
3 Ga0070690_100194887 3300005330 Bacteria 1407
4 Ga0070670_100544775 3300005331 Bacteria 1035
5 Ga0068869_100003269 3300005334 Bacteria 9895
6 Ga0070680_100001207 3300005336 Bacteria 18617
7 Ga0070680_100129592 3300005336 Bacteria 2109
8 Ga0070680_100168242 3300005336 Bacteria 1844
9 Ga0070682_100005094 3300005337 Bacteria 7304
10 Ga0068868_100003224 3300005338 Bacteria 11348
11 Ga0068868_100403460 3300005338 Bacteria 1180
12 Ga0070660_100020136 3300005339 Bacteria 4899
13 Ga0070689_100025269 3300005340 Bacteria 4461
14 Ga0070689_100067054 3300005340 Bacteria 2797
15 Ga0070691_10024683 3300005341 Bacteria 2795
16 Ga0070691_10051400 3300005341 Bacteria 1968
17 Ga0070687_100000139 3300005343 Bacteria 25149
18 Ga0070687_100284559 3300005343 Bacteria 1042
19 Ga0070661_100091961 3300005344 Bacteria 2247
20 Ga0070669_100012963 3300005353 Bacteria 5921
21 Ga0070669_100015269 3300005353 Bacteria 5471
22 Ga0070674_100151888 3300005356 Bacteria 1748
23 Ga0070673_100536433 3300005364 Bacteria 1062
24 Ga0070688_100232758 3300005365 Bacteria 1304
25 Ga0070688_100235597 3300005365 Bacteria 1297
26 Ga0070688_100239080 3300005365 Bacteria 1288
27 Ga0070659_100191801 3300005366 Bacteria 1680
28 Ga0070703_10027397 3300005406 Bacteria 1698
29 Ga0070709_10008140 3300005434 Bacteria 5755
30 Ga0070714_100157331 3300005435 Bacteria 2053
31 Ga0070714_100345277 3300005435 Bacteria 1397
32 Ga0070713_100000106 3300005436 Bacteria 54308
33 Ga0070713_100059395 3300005436 Bacteria 3194
34 Ga0070710_10018345 3300005437 Bacteria 3599
35 Ga0070701_10002277 3300005438 Bacteria 7355
36 Ga0070701_10009384 3300005438 Bacteria 4283
37 Ga0070711_100035971 3300005439 Bacteria 3315
38 Ga0070711_100381593 3300005439 Bacteria 1140
39 Ga0070705_100019347 3300005440 Bacteria 3583
40 Ga0070705_100159989 3300005440 Bacteria 1504
41 Ga0070700_100000374 3300005441 Bacteria 22955
42 Ga0070700_100418756 3300005441 Bacteria 1012
43 Ga0070694_100001221 3300005444 Bacteria 14849
44 Ga0070694_100003498 3300005444 Bacteria 9390
45 Ga0070694_100014012 3300005444 Bacteria 5014
46 Ga0070694_100025093 3300005444 Bacteria 3855
47 Ga0070694_100112898 3300005444 Bacteria 1938
48 Ga0070694_100157123 3300005444 Bacteria 1665
49 Ga0070694_100251536 3300005444 Bacteria 1337
50 Ga0070681_10000525 3300005458 Bacteria 31394
51 Ga0070681_10032924 3300005458 Bacteria 5204
52 Ga0070681_10041463 3300005458 Bacteria 4614
53 Ga0068867_100001755 3300005459 Bacteria 15105
54 Ga0068867_100008492 3300005459 Bacteria 7249
55 Ga0070706_100209986 3300005467 Bacteria 1818
56 Ga0070698_100031207 3300005471 Bacteria 5525
57 Ga0070699_100155215 3300005518 Bacteria 2025
58 Ga0070679_100025788 3300005530 Bacteria 5769
59 Ga0070679_100108605 3300005530 Bacteria 2760
60 Ga0070679_100394095 3300005530 Bacteria 1331
61 Ga0070697_100000662 3300005536 Bacteria 25954
62 Ga0070697_100001293 3300005536 Bacteria 18848
63 Ga0068853_100033145 3300005539 Bacteria 4381
64 Ga0070686_100006732 3300005544 Bacteria 6396
65 Ga0070686_100107551 3300005544 Bacteria 1894
66 Ga0070695_100011120 3300005545 Bacteria 5379
67 Ga0070695_100017123 3300005545 Bacteria 4395
68 Ga0070696_100001256 3300005546 Bacteria 16481
69 Ga0070696_100006014 3300005546 Bacteria 8098
70 Ga0070696_100020343 3300005546 Bacteria 4499
71 Ga0070696_100086742 3300005546 Bacteria 2222
72 Ga0070693_100000301 3300005547 Bacteria 22835
73 Ga0070704_100006411 3300005549 Bacteria 6936
74 Ga0070704_100008762 3300005549 Bacteria 6085
75 Ga0070704_100009088 3300005549 Bacteria 5995
76 Ga0070704_100012557 3300005549 Bacteria 5234
77 Ga0070704_100137212 3300005549 Bacteria 1904
78 Ga0070704_100184884 3300005549 Bacteria 1670
79 Ga0068855_100011048 3300005563 Bacteria 10893
80 Ga0068855_100043381 3300005563 Bacteria 5327
81 Ga0068857_100444386 3300005577 Bacteria 1212
82 Ga0068854_100015977 3300005578 Bacteria 4990
83 Ga0068856_100023606 3300005614 Bacteria 5980
84 Ga0068856_100080238 3300005614 Bacteria 3236
85 Ga0068856_100591175 3300005614 Unclassified 1131
86 Ga0070702_100007791 3300005615 Bacteria 5149
87 Ga0068852_100085995 3300005616 Bacteria 2802
88 Ga0068852_100218882 3300005616 Bacteria 1810
89 Ga0068859_100283493 3300005617 Bacteria 1749
90 Ga0068864_100180926 3300005618 Bacteria 1927
91 Ga0068866_10005419 3300005718 Bacteria 5266
92 Ga0068861_100001610 3300005719 Bacteria 14384
93 Ga0068861_100011915 3300005719 Bacteria 6055
94 Ga0068861_100344171 3300005719 Bacteria 1306
95 Ga0068863_100072481 3300005841 Bacteria 3258
96 Ga0068863_100162768 3300005841 Bacteria 2138
97 Ga0068858_100052547 3300005842 Bacteria 3770
98 Ga0068860_100055014 3300005843 Bacteria 3782
99 Ga0068860_100080998 3300005843 Bacteria 3087
100 Ga0068862_100025739 3300005844 Bacteria 4941
101 Ga0068862_100423778 3300005844 Bacteria 1249
102 Ga0075368_10002604 3300006042 Bacteria 5915
103 Ga0070715_10007278 3300006163 Bacteria 3805
104 Ga0070715_10198208 3300006163 Bacteria 1018
105 Ga0070716_100018789 3300006173 Bacteria 3605
106 Ga0070716_100189988 3300006173 Bacteria 1356
107 Ga0075366_10119486 3300006195 Bacteria 1588
108 Ga0097621_100004433 3300006237 Bacteria 9772
109 Ga0097621_100308765 3300006237 Bacteria 1399
110 Ga0068871_100001947 3300006358 Bacteria 13973
111 Ga0068871_100009293 3300006358 Bacteria 7114
112 Ga0075428_100265601 3300006844 Bacteria 1847
113 Ga0075428_100283477 3300006844 Bacteria 1782
114 Ga0075428_100324054 3300006844 Bacteria 1655
115 Ga0075430_100000910 3300006846 Bacteria 23204
116 Ga0075430_100008955 3300006846 Bacteria 8454
117 Ga0075430_100035554 3300006846 Bacteria 4226
118 Ga0075430_100060633 3300006846 Bacteria 3179
119 Ga0075430_100188555 3300006846 Bacteria 1714
120 Ga0075431_100015043 3300006847 Bacteria 7835
121 Ga0075431_100028736 3300006847 Bacteria 5717
122 Ga0075431_100101804 3300006847 Bacteria 2964
123 Ga0075431_100209998 3300006847 Bacteria 1989
124 Ga0075431_100264617 3300006847 Bacteria 1744
125 Ga0075434_100061393 3300006871 Bacteria 3739
126 Ga0075434_100179049 3300006871 Bacteria 2140
127 Ga0075429_100012725 3300006880 Bacteria 7300
128 Ga0075429_100035579 3300006880 Bacteria 4331
129 Ga0075429_100054153 3300006880 Bacteria 3490
130 Ga0075429_100128294 3300006880 Bacteria 2218
131 Ga0075429_100386764 3300006880 Bacteria 1225
132 Ga0068865_100008422 3300006881 Bacteria 6377
133 Ga0068865_100058970 3300006881 Bacteria 2683
134 Ga0075436_100021526 3300006914 Bacteria 4426
135 Ga0075436_100064153 3300006914 Bacteria 2539
136 Ga0075436_100073046 3300006914 Bacteria 2374
137 Ga0075436_100112959 3300006914 Bacteria 1897
138 Ga0097620_100283494 3300006931 Bacteria 1749
139 Ga0075435_100009758 3300007076 Bacteria 6981
140 Ga0105240_10241100 3300009093 Bacteria 2096
141 Ga0111539_10098990 3300009094 Bacteria 3425
142 Ga0111539_10247411 3300009094 Bacteria 2076
143 Ga0111539_10826793 3300009094 Bacteria 1078
144 Ga0105245_10007955 3300009098 Bacteria 9273
145 Ga0105245_10056553 3300009098 Bacteria 3526
146 Ga0105245_10587056 3300009098 Bacteria 1139
147 Ga0105247_10153203 3300009101 Bacteria 1520
148 Ga0114129_10058594 3300009147 Bacteria 5387
149 Ga0114129_10117666 3300009147 Bacteria 3661
150 Ga0114129_10299922 3300009147 Bacteria 2142
151 Ga0114129_10430407 3300009147 Bacteria 1734
152 Ga0105243_10025361 3300009148 Bacteria 4529
153 Ga0105243_10158566 3300009148 Bacteria 1949
154 Ga0105241_10029626 3300009174 Bacteria 4086
155 Ga0105241_10286308 3300009174 Bacteria 1409
156 Ga0105242_10009978 3300009176 Bacteria 7271
157 Ga0105242_10037001 3300009176 Bacteria 3919
158 Ga0105248_10084124 3300009177 Bacteria 3579
159 Ga0105248_10244902 3300009177 Bacteria 2018
160 Ga0105248_10656802 3300009177 Bacteria 1183
161 Ga0105249_10010159 3300009553 Bacteria 8264
162 Ga0105249_10230483 3300009553 Bacteria 1826
163 Ga0105249_10321631 3300009553 Bacteria 1558
164 Ga0105239_10019323 3300010375 Bacteria 7524
165 Ga0105246_10058068 3300011119 Bacteria 2680
166 Ga0157370_10003812 3300013104 Bacteria 17590
167 Ga0157370_10029366 3300013104 Bacteria 5397
168 Ga0157370_10181647 3300013104 Bacteria 1955
169 Ga0157369_10044991 3300013105 Bacteria 4803
170 Ga0157369_10159745 3300013105 Bacteria 2379
171 Ga0157378_10028624 3300013297 Bacteria 4918
172 Ga0163162_10311916 3300013306 Bacteria 1705
173 Ga0157372_10024035 3300013307 Bacteria 6612
174 Ga0157372_10050586 3300013307 Bacteria 4622
175 Ga0157372_10083640 3300013307 Bacteria 3615
176 Ga0157380_10076631 3300014326 Bacteria 2722
177 Ga0157379_10112541 3300014968 Bacteria 2446
178 Ga0157376_10062102 3300014969 Bacteria 3143
179 Ga0157376_10159378 3300014969 Bacteria 2044
180 Ga0207642_10049834 3300025899 Bacteria 1885
181 Ga0207688_10109830 3300025901 Bacteria 1600
182 Ga0207685_10005367 3300025905 Bacteria 3376
183 Ga0207645_10084867 3300025907 Bacteria 2033
184 Ga0207643_10076948 3300025908 Bacteria 1928
185 Ga0207684_10444849 3300025910 Bacteria 1113
186 Ga0207707_10028202 3300025912 Bacteria 4907
187 Ga0207707_10227864 3300025912 Bacteria 1621
188 Ga0207695_10079437 3300025913 Bacteria 3325
189 Ga0207663_10039421 3300025916 Bacteria 2862
190 Ga0207663_10201216 3300025916 Bacteria 1437
191 Ga0207663_10335479 3300025916 Bacteria 1140
192 Ga0207660_10074819 3300025917 Bacteria 2473
193 Ga0207660_10136828 3300025917 Bacteria 1870
194 Ga0207662_10000214 3300025918 Bacteria 26908
195 Ga0207662_10291706 3300025918 Bacteria 1082
196 Ga0207657_10014696 3300025919 Bacteria 7624
197 Ga0207657_10199258 3300025919 Bacteria 1611
198 Ga0207649_10042091 3300025920 Bacteria 2784
199 Ga0207652_10191519 3300025921 Bacteria 1839
200 Ga0207652_10385094 3300025921 Bacteria 1265
201 Ga0207681_10027131 3300025923 Bacteria 3701
202 Ga0207650_10251919 3300025925 Bacteria 1430
203 Ga0207659_10037036 3300025926 Bacteria 3384
204 Ga0207687_10027741 3300025927 Bacteria 3801
205 Ga0207700_10000576 3300025928 Bacteria 21441
206 Ga0207664_10058946 3300025929 Bacteria 3056
207 Ga0207664_10137764 3300025929 Bacteria 2061
208 Ga0207690_10222336 3300025932 Bacteria 1445
209 Ga0207706_10302306 3300025933 Bacteria 1394
210 Ga0207686_10025759 3300025934 Bacteria 3426
211 Ga0207709_10003645 3300025935 Bacteria 9081
212 Ga0207709_10074751 3300025935 Bacteria 2164
213 Ga0207670_10025832 3300025936 Bacteria 3692
214 Ga0207670_10042382 3300025936 Bacteria 2999
215 Ga0207704_10002449 3300025938 Bacteria 8353
216 Ga0207689_10001553 3300025942 Bacteria 21776
217 Ga0207689_10052862 3300025942 Bacteria 3346
218 Ga0207679_10105436 3300025945 Bacteria 2213
219 Ga0207712_10078133 3300025961 Bacteria 2401
220 Ga0207712_10226636 3300025961 Bacteria 1497
221 Ga0207640_10008105 3300025981 Bacteria 5816
222 Ga0207677_10006898 3300026023 Bacteria 6243
223 Ga0207703_10244040 3300026035 Bacteria 1616
224 Ga0207708_10016731 3300026075 Bacteria 5518
225 Ga0207708_10021927 3300026075 Bacteria 4821
226 Ga0207708_10097911 3300026075 Bacteria 2267
227 Ga0207708_10558613 3300026075 Bacteria 966
228 Ga0207702_10016649 3300026078 Bacteria 6085
229 Ga0207702_10299471 3300026078 Bacteria 1526
230 Ga0207702_10537722 3300026078 Bacteria 1142
231 Ga0207648_10002022 3300026089 Bacteria 22142
232 Ga0207648_10014618 3300026089 Bacteria 7247
233 Ga0207648_10225790 3300026089 Bacteria 1665
234 Ga0207674_10228202 3300026116 Bacteria 1810
235 Ga0207675_100001190 3300026118 Bacteria 25909
236 Ga0207675_100007177 3300026118 Bacteria 10530
237 Ga0207698_10208571 3300026142 Bacteria 1756
238 Ga0209967_1011383 3300027364 Bacteria 1247
239 Ga0209996_1005203 3300027395 Bacteria 1665
240 Ga0210000_1012375 3300027462 Bacteria 1268
241 Ga0209995_1024830 3300027471 Bacteria 998
242 Ga0209999_1018938 3300027543 Bacteria 1261
243 Ga0209966_1001192 3300027695 Bacteria 4645
244 Ga0209974_10046218 3300027876 Bacteria 1455
245 Ga0207428_10087926 3300027907 Bacteria 2417
246 Ga0268265_10000291 3300028380 Bacteria 56604
247 Ga0268265_10187599 3300028380 Bacteria 1782
248 Ga0307511_10000001 3300030521 Bacteria 206079
249 Ga0307408_100214962 3300031548 Bacteria 1565
250 Ga0307409_100283707 3300031995 Bacteria 1532
251 Ga0307507_10046211 3300033179 Bacteria 4271
252 Ga0373930_0002616 3300034816 Bacteria 2798
253 Ga0373926_0001761 3300035083 Bacteria 6721
254 Ga0373928_0011984 3300035084 Bacteria 1724
255 Ga0373940_0001255 3300035088 Bacteria 4505
256 Ga0373944_0002710 3300035089 Bacteria 4521
257 Ga0373923_0056282 3300035111 Bacteria 1660
258 Ga0373936_0012199 3300035113 Bacteria 3266
259 Ga0373941_0062748 3300035115 Bacteria 1214
260 Ga0373945_0004103 3300035116 Bacteria 4617
261 Ga0373954_0000494 3300035118 Bacteria 14817
262 Ga0373954_0007630 3300035118 Bacteria 4738
263 Ga0373954_0053672 3300035118 Bacteria 1895
264 Ga0373946_0017490 3300035171 Bacteria 2743
265 Ga0373955_0160368 3300035172 Bacteria 1327
266 Ga0373955_0389400 3300035172 Unclassified 846
267 Ga0373942_0067642 3300035207 Bacteria 1036
268 Ga0373961_0032635 3300035241 Bacteria 1461
269 Ga0373924_0001301 3300035410 Bacteria 8017
270 Ga0373924_0026020 3300035410 Bacteria 2317
271 Ga0373924_0063453 3300035410 Bacteria 1549
272 Ga0373931_0019397 3300035691 Bacteria 3394
273 Ga0373931_0042103 3300035691 Bacteria 2400
274 Ga0373935_0020689 3300035692 Bacteria 4022
275 Ga0373935_0063421 3300035692 Bacteria 2368
276 Ga0373927_0004974 3300035695 Bacteria 9213
277 Ga0373927_0012033 3300035695 Bacteria 5756
278 Ga0373933_0014405 3300035724 Bacteria 4398
279 Ga0373933_0129918 3300035724 Bacteria 1583
280 Ga0373947_0093802 3300035725 Bacteria 1876
281 Ga0373937_0001375 3300036401 Bacteria 20333
282 Ga0373937_0052314 3300036401 Bacteria 3744
283 Ga0373937_0398661 3300036401 Bacteria 1305
284 Ga0373925_0109469 3300037068 Bacteria 2132
285 Ga0395905_0148808 3300037471 Bacteria 2203
286 Ga0395901_0105842 3300038443 Bacteria 2953
287 Ga0451807_2130962 3300041486 Bacteria 1077
288 Ga0451853_0111693 3300041512 Bacteria 1828
289 Ga0439443_003058 3300042003 Bacteria 2070
290 Ga0439435_0000631 3300042436 Bacteria 5768
291 Ga0439435_0001664 3300042436 Bacteria 4183
292 Ga0439435_0020642 3300042436 Bacteria 1701
293 Ga0439435_0066793 3300042436 Bacteria 1058
294 Ga0439444_0002607 3300042437 Bacteria 2481
295 Ga0439460_0011903 3300042461 Bacteria 2249
296 Ga0439460_0044883 3300042461 Bacteria 1309
297 Ga0451577_0062880 3300042876 Bacteria 3310
298 Ga0451577_0220003 3300042876 Bacteria 1716
299 Ga0466965_0128452 3300044683 Bacteria 1313
300 Ga0466963_0081031 3300044694 Bacteria 2198
301 Ga0451576_0000220 3300045051 Bacteria 141261
302 Ga0451576_0089381 3300045051 Bacteria 3204
303 Ga0451576_0375160 3300045051 Bacteria 1490
304 Ga0466958_0206945 3300045836 Bacteria 1249
305 Ga0495592_0004570 3300046454 Bacteria 10137
306 Ga0495592_0007353 3300046454 Bacteria 8240
307 Ga0495580_0003258 3300046472 Bacteria 13879
308 Ga0495639_0020270 3300046475 Bacteria 2905
309 Ga0495662_0007965 3300046476 Bacteria 5219
310 Ga0495662_0020804 3300046476 Bacteria 3173
311 Ga0495664_0266184 3300046477 Bacteria 1036
312 Ga0495584_0134943 3300046491 Bacteria 1253
313 Ga0495608_0000699 3300046511 Bacteria 23284
314 Ga0495608_0056975 3300046511 Bacteria 2579
315 Ga0495618_0050946 3300046514 Bacteria 2616
316 Ga0495628_0001543 3300046516 Bacteria 21073
317 Ga0495628_0014046 3300046516 Bacteria 6722
318 Ga0495628_0191848 3300046516 Bacteria 1542
319 Ga0495630_0022893 3300046517 Bacteria 4615
320 Ga0495630_0024492 3300046517 Bacteria 4461
321 Ga0495630_0168566 3300046517 Bacteria 1668
322 Ga0495643_0016192 3300046522 Bacteria 4385
323 Ga0495666_0002362 3300046526 Bacteria 9412
324 Ga0495642_0015225 3300046528 Bacteria 2986
325 Ga0495642_0076512 3300046528 Bacteria 1405
326 Ga0495652_0003234 3300046529 Bacteria 16239
327 Ga0495652_0040509 3300046529 Bacteria 4026
328 Ga0495665_0010183 3300046531 Bacteria 5095
329 Ga0495640_0002581 3300046533 Bacteria 14557
330 Ga0495586_0003330 3300046535 Bacteria 8623
331 Ga0495586_0003540 3300046535 Bacteria 8368
332 Ga0495586_0054845 3300046535 Bacteria 2160
333 Ga0495587_0022022 3300046536 Bacteria 3927
334 Ga0495597_0057734 3300046542 Bacteria 1697
335 Ga0495667_0000885 3300046559 Bacteria 19363
336 Ga0495668_0014457 3300046616 Bacteria 4627
337 Ga0495634_0002579 3300046642 Bacteria 14950
338 Ga0495635_0002244 3300046663 Bacteria 13134
339 Ga0495635_0008198 3300046663 Bacteria 7297
340 Ga0495588_0008086 3300046674 Bacteria 4811
341 Ga0495599_0006419 3300046678 Bacteria 7096
342 Ga0495646_0321403 3300046680 Bacteria 815
343 Ga0495647_0000969 3300046681 Bacteria 8685
344 Ga0495647_0042953 3300046681 Bacteria 1728
345 Ga0495658_0001458 3300046683 Bacteria 12454
346 Ga0495658_0196746 3300046683 Bacteria 1255
347 Ga0495669_0006466 3300046684 Bacteria 4895
348 Ga0495613_0003814 3300046689 Bacteria 11293
349 Ga0495624_0026419 3300046690 Bacteria 3805
350 Ga0495624_0075930 3300046690 Bacteria 2086
351 Ga0495600_0009278 3300046809 Bacteria 6072
352 Ga0495581_0007160 3300047315 Bacteria 6458
353 Ga0495581_0056381 3300047315 Bacteria 2268
354 Ga0495604_0000911 3300047317 Bacteria 24567
355 Ga0495636_0004078 3300047318 Bacteria 5716
356 Ga0495674_0057486 3300047319 Bacteria 3404
357 Ga0495674_0253644 3300047319 Bacteria 1447
358 Ga0495676_0004858 3300047321 Bacteria 12334
359 Ga0495680_0003156 3300047322 Bacteria 16416
360 Ga0495680_0031472 3300047322 Bacteria 4318
361 Ga0495680_0088807 3300047322 Bacteria 2322
362 Ga0495675_0018523 3300047444 Bacteria 4420
363 Ga0495681_0084969 3300047470 Bacteria 1406
364 Ga0495684_0049984 3300047471 Bacteria 3194
365 Ga0495593_0041573 3300047673 Bacteria 2471
366 Ga0495593_0138500 3300047673 Bacteria 1233
367 Ga0501299_038306 3300049522 Bacteria 953
368 Ga0501032_0347903 3300049569 Bacteria 955
369 Ga0501036_0007624 3300049572 Bacteria 8833
370 Ga0501036_0235255 3300049572 Bacteria 1537
371 Ga0501037_0319027 3300049573 Bacteria 1076
372 Ga0501038_0007405 3300049574 Bacteria 10124
373 Ga0501039_0056109 3300049575 Bacteria 3051
374 Ga0501039_0068773 3300049575 Bacteria 2749
375 Ga0501039_0207388 3300049575 Bacteria 1541
376 Ga0501040_0013931 3300049576 Bacteria 5295
377 Ga0501040_0037600 3300049576 Bacteria 3289
378 Ga0501040_0085569 3300049576 Bacteria 2188
379 Ga0501041_0008365 3300049577 Bacteria 6084
380 Ga0501041_0010800 3300049577 Bacteria 5386
381 Ga0501041_0015700 3300049577 Bacteria 4498
382 Ga0501041_0037766 3300049577 Bacteria 2927
383 Ga0501042_0035538 3300049578 Bacteria 3535
384 Ga0501042_0090916 3300049578 Bacteria 2191
385 Ga0501042_0136812 3300049578 Bacteria 1766
386 Ga0501043_0076719 3300049579 Bacteria 2626
387 Ga0501043_0286361 3300049579 Bacteria 1262
388 Ga0501046_0026538 3300049580 Bacteria 4731
389 Ga0501046_0062309 3300049580 Bacteria 2915
390 Ga0501046_0227207 3300049580 Bacteria 1380
391 Ga0501048_0008775 3300049582 Bacteria 7618
392 Ga0501048_0021038 3300049582 Bacteria 4779
393 Ga0501048_0048391 3300049582 Bacteria 3033
394 Ga0501068_0092320 3300049584 Bacteria 1869
395 Ga0501069_0199305 3300049585 Bacteria 1160
396 Ga0501070_0345531 3300049586 Bacteria 1208
397 Ga0501071_0074612 3300049587 Bacteria 2476
398 Ga0501072_0000978 3300049588 Bacteria 21105
399 Ga0501072_0030966 3300049588 Bacteria 4186
400 Ga0501072_0127193 3300049588 Bacteria 2030
401 Ga0501072_0280670 3300049588 Bacteria 1325
402 Ga0501073_0122716 3300049589 Bacteria 1801
403 Ga0501074_0237980 3300049590 Bacteria 1295
404 Ga0501074_0277639 3300049590 Bacteria 1191
405 Ga0501075_0000016 3300049591 Bacteria 70964
406 Ga0501075_0007403 3300049591 Bacteria 7617
407 Ga0501075_0034197 3300049591 Bacteria 3783
408 Ga0501075_0044972 3300049591 Bacteria 3313
409 Ga0501075_0065675 3300049591 Bacteria 2738
410 Ga0501076_0000053 3300049592 Bacteria 56853
411 Ga0501076_0025821 3300049592 Bacteria 4548
412 Ga0501077_0031675 3300049593 Bacteria 3365
413 Ga0501077_0155770 3300049593 Bacteria 1450
414 Ga0501077_0325849 3300049593 Bacteria 979
415 Ga0501079_0032187 3300049741 Bacteria 4031
416 Ga0501079_0063858 3300049741 Bacteria 2840
417 Ga0501080_0029008 3300049742 Bacteria 5151
418 Ga0501081_0015484 3300049743 Bacteria 5033
419 Ga0501081_0053111 3300049743 Bacteria 2797
420 Ga0501081_0107730 3300049743 Bacteria 1976
421 Ga0501035_0082255 3300049822 Bacteria 2842
422 Ga0501035_0103535 3300049822 Bacteria 2497
423 Ga0501045_0006931 3300049824 Bacteria 7854
424 Ga0501045_0030612 3300049824 Bacteria 3896
425 Ga0501045_0069342 3300049824 Bacteria 2592
426 nmdc:mga00v17_139351_c1 3300050491 Bacteria 1554
427 nmdc:mga05p37_138978_c1 3300050507 Bacteria 2977
428 nmdc:mga05p37_408921_c1 3300050507 Bacteria 1582
429 nmdc:mga09592_153568_c1 3300050508 Bacteria 1987
430 nmdc:mga09592_258780_c1 3300050508 Bacteria 1509
431 nmdc:mga09592_260862_c1 3300050508 Bacteria 1503
432 nmdc:mga09592_561716_c1 3300050508 Bacteria 980
433 nmdc:mga09592_76118_c1 3300050508 Bacteria 2854
434 nmdc:mga0qj67_284_c1 3300050509 Bacteria 35291
435 nmdc:mga0qj67_31851_c1 3300050509 Bacteria 4110
436 nmdc:mga06r32_335596_c1 3300050510 Bacteria 1497
437 nmdc:mga06r32_36181_c1 3300050510 Bacteria 4663
438 nmdc:mga06r32_401961_c1 3300050510 Bacteria 1352
439 nmdc:mga08y16_152242_c1 3300050511 Bacteria 1971
440 nmdc:mga08y16_44771_c1 3300050511 Bacteria 4638
441 nmdc:mga08y16_85033_c1 3300050511 Bacteria 3297
442 nmdc:mga08y16_96661_c1 3300050511 Bacteria 3076
443 nmdc:mga0n895_3440_c1 3300050512 Bacteria 12779
444 nmdc:mga0n895_7117_c1 3300050512 Bacteria 9565
445 nmdc:mga0rr50_32532_c1 3300050513 Bacteria 3717
446 nmdc:mga08x19_111444_c1 3300050514 Bacteria 1826
447 nmdc:mga08x19_11694_c1 3300050514 Bacteria 5286
448 nmdc:mga08x19_261_c1 3300050514 Bacteria 40081
449 nmdc:mga08x19_4927_c1 3300050514 Bacteria 2575
450 nmdc:mga08x19_80882_c1 3300050514 Bacteria 2133
451 nmdc:mga0a205_111277_c1 3300050515 Bacteria 2637
452 nmdc:mga0a205_315597_c1 3300050515 Bacteria 1434
453 nmdc:mga0a205_32819_c1 3300050515 Bacteria 4977
454 nmdc:mga0a205_419424_c1 3300050515 Bacteria 1200
455 Ga0495601_0013026 3300053077 Bacteria 4997
456 Ga0495601_0308677 3300053077 Bacteria 1030
457 Ga0500646_0016527 3300053090 Bacteria 1927
458 Ga0500583_0003461 3300053092 Bacteria 4966
459 Ga0500566_0104305 3300053094 Bacteria 1550
460 Ga0500568_0012514 3300053139 Bacteria 3899
461 Ga0500604_0060950 3300053151 Bacteria 1185
462 Ga0501084_0007936 3300054114 Bacteria 8740
463 Ga0501084_0053408 3300054114 Bacteria 3380
464 Ga0501082_0007898 3300060353 Bacteria 9186
465 Ga0501082_0016953 3300060353 Bacteria 6272
466 Ga0501082_0133825 3300060353 Bacteria 2151
467 Ga0501082_0139093 3300060353 Bacteria 2107
468 Ga0530510_0000002 3300061734 Bacteria 284155
469 Ga0530510_0000711 3300061734 Bacteria 21610
470 Ga0530510_0072905 3300061734 Bacteria 2492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042436 Ga0439435_0066793 Ga0439435_0066793_345_1043 232
2 3300049589 Ga0501073_0122716 Ga0501073_0122716_19_717 232
3 3300049591 Ga0501075_0007403 Ga0501075_0007403_6867_7607 246
4 3300035171 Ga0373946_0017490 Ga0373946_0017490_20_790 250
5 3300035172 Ga0373955_0389400 Ga0373955_0389400_64_825 250
6 3300046680 Ga0495646_0321403 Ga0495646_0321403_14_787 250
7 3300025913 Ga0207695_10079437 Ga0207695_100794372 266
8 3300049743 Ga0501081_0015484 Ga0501081_0015484_3060_3869 269
9 3300005719 Ga0068861_100344171 Ga0068861_1003441712 273
10 3300009101 Ga0105247_10153203 Ga0105247_101532032 273
11 3300035410 Ga0373924_0001301 Ga0373924_0001301_7157_7996 273
12 3300046454 Ga0495592_0004570 Ga0495592_0004570_6000_6857 273
13 3300046516 Ga0495628_0001543 Ga0495628_0001543_2788_3645 273
14 3300046529 Ga0495652_0003234 Ga0495652_0003234_10372_11229 273
15 3300046678 Ga0495599_0006419 Ga0495599_0006419_3500_4357 273
16 3300005353 Ga0070669_100015269 Ga0070669_1000152697 274
17 3300005365 Ga0070688_100232758 Ga0070688_1002327582 274
18 3300005438 Ga0070701_10009384 Ga0070701_100093844 274
19 3300005549 Ga0070704_100012557 Ga0070704_1000125574 274
20 3300005618 Ga0068864_100180926 Ga0068864_1001809262 274
21 3300005843 Ga0068860_100055014 Ga0068860_1000550142 274
22 3300005844 Ga0068862_100423778 Ga0068862_1004237782 274
23 3300009177 Ga0105248_10084124 Ga0105248_100841241 274
24 3300025923 Ga0207681_10027131 Ga0207681_100271312 274
25 3300025925 Ga0207650_10251919 Ga0207650_102519192 274
26 3300028380 Ga0268265_10187599 Ga0268265_101875992 274
27 3300005467 Ga0070706_100209986 Ga0070706_1002099862 276
28 3300005536 Ga0070697_100000662 Ga0070697_10000066222 276
29 3300006173 Ga0070716_100189988 Ga0070716_1001899882 276
30 3300025910 Ga0207684_10444849 Ga0207684_104448492 276
31 3300035692 Ga0373935_0063421 Ga0373935_0063421_333_1181 276
32 3300049578 Ga0501042_0090916 Ga0501042_0090916_135_989 276
33 3300005343 Ga0070687_100284559 Ga0070687_1002845591 280
34 3300025918 Ga0207662_10291706 Ga0207662_102917062 280
35 3300005338 Ga0068868_100403460 Ga0068868_1004034602 281
36 3300005340 Ga0070689_100067054 Ga0070689_1000670542 281
37 3300005341 Ga0070691_10051400 Ga0070691_100514002 281
38 3300005440 Ga0070705_100159989 Ga0070705_1001599891 281
39 3300005444 Ga0070694_100112898 Ga0070694_1001128982 281
40 3300005471 Ga0070698_100031207 Ga0070698_1000312075 281
41 3300005549 Ga0070704_100006411 Ga0070704_1000064116 281
42 3300006871 Ga0075434_100179049 Ga0075434_1001790492 281
43 3300006880 Ga0075429_100386764 Ga0075429_1003867642 281
44 3300009094 Ga0111539_10098990 Ga0111539_100989903 281
45 3300009553 Ga0105249_10230483 Ga0105249_102304832 281
46 3300025936 Ga0207670_10042382 Ga0207670_100423822 281
47 3300025961 Ga0207712_10078133 Ga0207712_100781333 281
48 3300027907 Ga0207428_10087926 Ga0207428_100879263 281
49 3300035115 Ga0373941_0062748 Ga0373941_0062748_305_1180 281
50 3300046491 Ga0495584_0134943 Ga0495584_0134943_348_1193 281
51 3300046542 Ga0495597_0057734 Ga0495597_0057734_114_1007 281
52 3300047470 Ga0495681_0084969 Ga0495681_0084969_65_958 281
53 3300049522 Ga0501299_038306 Ga0501299_038306_18_863 281
54 3300050508 nmdc:mga09592_258780_c1 nmdc:mga09592_258780_c1_360_1205 281
55 3300050511 nmdc:mga08y16_44771_c1 nmdc:mga08y16_44771_c1_2412_3257 281
56 3300050512 nmdc:mga0n895_7117_c1 nmdc:mga0n895_7117_c1_7034_7879 281
57 3300050515 nmdc:mga0a205_111277_c1 nmdc:mga0a205_111277_c1_722_1567 281
58 3300050515 nmdc:mga0a205_315597_c1 nmdc:mga0a205_315597_c1_292_1137 281
59 3300005435 Ga0070714_100345277 Ga0070714_1003452772 282
60 3300005444 Ga0070694_100157123 Ga0070694_1001571231 282
61 3300005614 Ga0068856_100591175 Ga0068856_1005911751 282
62 3300006163 Ga0070715_10198208 Ga0070715_101982081 282
63 3300006846 Ga0075430_100060633 Ga0075430_1000606333 282
64 3300006914 Ga0075436_100112959 Ga0075436_1001129592 282
65 3300007076 Ga0075435_100009758 Ga0075435_1000097583 282
66 3300026075 Ga0207708_10097911 Ga0207708_100979112 282
67 3300026078 Ga0207702_10537722 Ga0207702_105377221 282
68 3300026089 Ga0207648_10225790 Ga0207648_102257902 282
69 3300027364 Ga0209967_1011383 Ga0209967_10113832 282
70 3300027395 Ga0209996_1005203 Ga0209996_10052032 282
71 3300034816 Ga0373930_0002616 Ga0373930_0002616_446_1303 282
72 3300035724 Ga0373933_0129918 Ga0373933_0129918_65_913 282
73 3300049577 Ga0501041_0037766 Ga0501041_0037766_1405_2253 282
74 3300050514 nmdc:mga08x19_11694_c1 nmdc:mga08x19_11694_c1_2103_2951 282
75 3300054114 Ga0501084_0053408 Ga0501084_0053408_1830_2678 282
76 3300005441 Ga0070700_100418756 Ga0070700_1004187561 283
77 3300005444 Ga0070694_100014012 Ga0070694_1000140122 283
78 3300009147 Ga0114129_10299922 Ga0114129_102999222 283
79 3300025917 Ga0207660_10136828 Ga0207660_101368282 283
80 3300025942 Ga0207689_10052862 Ga0207689_100528623 283
81 3300026075 Ga0207708_10558613 Ga0207708_105586131 283
82 3300036401 Ga0373937_0052314 Ga0373937_0052314_20_871 283
83 3300046454 Ga0495592_0007353 Ga0495592_0007353_1463_2314 283
84 3300046476 Ga0495662_0020804 Ga0495662_0020804_1428_2279 283
85 3300046511 Ga0495608_0000699 Ga0495608_0000699_20452_21303 283
86 3300046514 Ga0495618_0050946 Ga0495618_0050946_847_1698 283
87 3300046516 Ga0495628_0014046 Ga0495628_0014046_3756_4607 283
88 3300046517 Ga0495630_0024492 Ga0495630_0024492_2037_2888 283
89 3300046526 Ga0495666_0002362 Ga0495666_0002362_5826_6677 283
90 3300046529 Ga0495652_0040509 Ga0495652_0040509_979_1830 283
91 3300046533 Ga0495640_0002581 Ga0495640_0002581_9045_9896 283
92 3300046535 Ga0495586_0003540 Ga0495586_0003540_5927_6778 283
93 3300046536 Ga0495587_0022022 Ga0495587_0022022_2417_3268 283
94 3300046559 Ga0495667_0000885 Ga0495667_0000885_18249_19100 283
95 3300046642 Ga0495634_0002579 Ga0495634_0002579_10343_11194 283
96 3300046663 Ga0495635_0002244 Ga0495635_0002244_1649_2500 283
97 3300046689 Ga0495613_0003814 Ga0495613_0003814_6286_7137 283
98 3300046690 Ga0495624_0026419 Ga0495624_0026419_2268_3119 283
99 3300046809 Ga0495600_0009278 Ga0495600_0009278_5141_5992 283
100 3300047315 Ga0495581_0007160 Ga0495581_0007160_117_968 283
101 3300047317 Ga0495604_0000911 Ga0495604_0000911_1320_2171 283
102 3300047319 Ga0495674_0057486 Ga0495674_0057486_737_1588 283
103 3300047322 Ga0495680_0003156 Ga0495680_0003156_6529_7380 283
104 3300047444 Ga0495675_0018523 Ga0495675_0018523_144_995 283
105 3300047471 Ga0495684_0049984 Ga0495684_0049984_2274_3125 283
106 3300047673 Ga0495593_0041573 Ga0495593_0041573_775_1626 283
107 3300050515 nmdc:mga0a205_419424_c1 nmdc:mga0a205_419424_c1_75_926 283
108 3300053077 Ga0495601_0013026 Ga0495601_0013026_2112_2963 283
109 3300053094 Ga0500566_0104305 Ga0500566_0104305_179_1030 283
110 3300005330 Ga0070690_100194887 Ga0070690_1001948871 284
111 3300005331 Ga0070670_100544775 Ga0070670_1005447751 284
112 3300005336 Ga0070680_100129592 Ga0070680_1001295923 284
113 3300005353 Ga0070669_100012963 Ga0070669_1000129632 284
114 3300005356 Ga0070674_100151888 Ga0070674_1001518882 284
115 3300005364 Ga0070673_100536433 Ga0070673_1005364331 284
116 3300005365 Ga0070688_100235597 Ga0070688_1002355971 284
117 3300005434 Ga0070709_10008140 Ga0070709_100081406 284
118 3300005436 Ga0070713_100059395 Ga0070713_1000593953 284
119 3300005437 Ga0070710_10018345 Ga0070710_100183453 284
120 3300005439 Ga0070711_100035971 Ga0070711_1000359712 284
121 3300005444 Ga0070694_100003498 Ga0070694_1000034983 284
122 3300005444 Ga0070694_100251536 Ga0070694_1002515361 284
123 3300005458 Ga0070681_10000525 Ga0070681_1000052526 284
124 3300005459 Ga0068867_100001755 Ga0068867_1000017553 284
125 3300005518 Ga0070699_100155215 Ga0070699_1001552152 284
126 3300005530 Ga0070679_100108605 Ga0070679_1001086053 284
127 3300005536 Ga0070697_100001293 Ga0070697_1000012934 284
128 3300005544 Ga0070686_100107551 Ga0070686_1001075512 284
129 3300005545 Ga0070695_100017123 Ga0070695_1000171232 284
130 3300005546 Ga0070696_100006014 Ga0070696_1000060148 284
131 3300005546 Ga0070696_100020343 Ga0070696_1000203432 284
132 3300005546 Ga0070696_100086742 Ga0070696_1000867422 284
133 3300005549 Ga0070704_100008762 Ga0070704_1000087623 284
134 3300005549 Ga0070704_100009088 Ga0070704_1000090885 284
135 3300005577 Ga0068857_100444386 Ga0068857_1004443862 284
136 3300005719 Ga0068861_100001610 Ga0068861_1000016102 284
137 3300005844 Ga0068862_100025739 Ga0068862_1000257393 284
138 3300006237 Ga0097621_100308765 Ga0097621_1003087652 284
139 3300006358 Ga0068871_100009293 Ga0068871_1000092932 284
140 3300006844 Ga0075428_100324054 Ga0075428_1003240541 284
141 3300006846 Ga0075430_100000910 Ga0075430_1000009107 284
142 3300006846 Ga0075430_100008955 Ga0075430_1000089555 284
143 3300006846 Ga0075430_100035554 Ga0075430_1000355544 284
144 3300006846 Ga0075430_100188555 Ga0075430_1001885552 284
145 3300006847 Ga0075431_100015043 Ga0075431_1000150435 284
146 3300006847 Ga0075431_100101804 Ga0075431_1001018043 284
147 3300006847 Ga0075431_100264617 Ga0075431_1002646172 284
148 3300006871 Ga0075434_100061393 Ga0075434_1000613934 284
149 3300006880 Ga0075429_100054153 Ga0075429_1000541533 284
150 3300006880 Ga0075429_100128294 Ga0075429_1001282943 284
151 3300006881 Ga0068865_100008422 Ga0068865_1000084223 284
152 3300006914 Ga0075436_100021526 Ga0075436_1000215265 284
153 3300006914 Ga0075436_100064153 Ga0075436_1000641532 284
154 3300006914 Ga0075436_100073046 Ga0075436_1000730462 284
155 3300009093 Ga0105240_10241100 Ga0105240_102411002 284
156 3300009098 Ga0105245_10056553 Ga0105245_100565532 284
157 3300009098 Ga0105245_10587056 Ga0105245_105870562 284
158 3300009147 Ga0114129_10430407 Ga0114129_104304071 284
159 3300009148 Ga0105243_10158566 Ga0105243_101585662 284
160 3300009176 Ga0105242_10009978 Ga0105242_100099789 284
161 3300009177 Ga0105248_10656802 Ga0105248_106568022 284
162 3300009553 Ga0105249_10321631 Ga0105249_103216312 284
163 3300013104 Ga0157370_10029366 Ga0157370_100293665 284
164 3300013307 Ga0157372_10024035 Ga0157372_100240352 284
165 3300014969 Ga0157376_10159378 Ga0157376_101593782 284
166 3300025907 Ga0207645_10084867 Ga0207645_100848673 284
167 3300025908 Ga0207643_10076948 Ga0207643_100769483 284
168 3300025912 Ga0207707_10227864 Ga0207707_102278642 284
169 3300025916 Ga0207663_10039421 Ga0207663_100394211 284
170 3300025921 Ga0207652_10191519 Ga0207652_101915192 284
171 3300025921 Ga0207652_10385094 Ga0207652_103850942 284
172 3300025926 Ga0207659_10037036 Ga0207659_100370363 284
173 3300025929 Ga0207664_10058946 Ga0207664_100589462 284
174 3300025934 Ga0207686_10025759 Ga0207686_100257594 284
175 3300025935 Ga0207709_10003645 Ga0207709_100036455 284
176 3300025938 Ga0207704_10002449 Ga0207704_100024494 284
177 3300025961 Ga0207712_10226636 Ga0207712_102266362 284
178 3300026035 Ga0207703_10244040 Ga0207703_102440402 284
179 3300026075 Ga0207708_10021927 Ga0207708_100219273 284
180 3300026089 Ga0207648_10014618 Ga0207648_100146186 284
181 3300026116 Ga0207674_10228202 Ga0207674_102282022 284
182 3300026118 Ga0207675_100007177 Ga0207675_1000071776 284
183 3300027462 Ga0210000_1012375 Ga0210000_10123752 284
184 3300027471 Ga0209995_1024830 Ga0209995_10248302 284
185 3300027543 Ga0209999_1018938 Ga0209999_10189382 284
186 3300027695 Ga0209966_1001192 Ga0209966_10011925 284
187 3300027876 Ga0209974_10046218 Ga0209974_100462182 284
188 3300028380 Ga0268265_10000291 Ga0268265_1000029162 284
189 3300030521 Ga0307511_10000001 Ga0307511_1000000130 284
190 3300031548 Ga0307408_100214962 Ga0307408_1002149622 284
191 3300031995 Ga0307409_100283707 Ga0307409_1002837072 284
192 3300035113 Ga0373936_0012199 Ga0373936_0012199_1915_2769 284
193 3300035241 Ga0373961_0032635 Ga0373961_0032635_421_1278 284
194 3300035691 Ga0373931_0019397 Ga0373931_0019397_2291_3148 284
195 3300035692 Ga0373935_0020689 Ga0373935_0020689_116_970 284
196 3300035695 Ga0373927_0012033 Ga0373927_0012033_4140_4994 284
197 3300042003 Ga0439443_003058 Ga0439443_003058_879_1733 284
198 3300042436 Ga0439435_0000631 Ga0439435_0000631_1993_2847 284
199 3300042436 Ga0439435_0001664 Ga0439435_0001664_575_1429 284
200 3300042436 Ga0439435_0020642 Ga0439435_0020642_50_904 284
201 3300042437 Ga0439444_0002607 Ga0439444_0002607_932_1786 284
202 3300042461 Ga0439460_0011903 Ga0439460_0011903_171_1025 284
203 3300042461 Ga0439460_0044883 Ga0439460_0044883_229_1083 284
204 3300042876 Ga0451577_0220003 Ga0451577_0220003_263_1117 284
205 3300044683 Ga0466965_0128452 Ga0466965_0128452_98_952 284
206 3300045051 Ga0451576_0000220 Ga0451576_0000220_107907_108761 284
207 3300045051 Ga0451576_0089381 Ga0451576_0089381_192_1046 284
208 3300046476 Ga0495662_0007965 Ga0495662_0007965_2153_3007 284
209 3300046516 Ga0495628_0191848 Ga0495628_0191848_258_1112 284
210 3300046517 Ga0495630_0022893 Ga0495630_0022893_3444_4298 284
211 3300046528 Ga0495642_0076512 Ga0495642_0076512_160_1014 284
212 3300046535 Ga0495586_0054845 Ga0495586_0054845_166_1020 284
213 3300046663 Ga0495635_0008198 Ga0495635_0008198_1277_2131 284
214 3300046681 Ga0495647_0042953 Ga0495647_0042953_517_1371 284
215 3300046683 Ga0495658_0196746 Ga0495658_0196746_387_1241 284
216 3300046684 Ga0495669_0006466 Ga0495669_0006466_2206_3072 284
217 3300046690 Ga0495624_0075930 Ga0495624_0075930_792_1646 284
218 3300047318 Ga0495636_0004078 Ga0495636_0004078_1567_2421 284
219 3300047319 Ga0495674_0253644 Ga0495674_0253644_41_895 284
220 3300047322 Ga0495680_0088807 Ga0495680_0088807_1281_2135 284
221 3300047673 Ga0495593_0138500 Ga0495593_0138500_351_1205 284
222 3300049569 Ga0501032_0347903 Ga0501032_0347903_86_940 284
223 3300049572 Ga0501036_0007624 Ga0501036_0007624_5959_6813 284
224 3300049572 Ga0501036_0235255 Ga0501036_0235255_588_1442 284
225 3300049573 Ga0501037_0319027 Ga0501037_0319027_150_1004 284
226 3300049574 Ga0501038_0007405 Ga0501038_0007405_7298_8152 284
227 3300049575 Ga0501039_0056109 Ga0501039_0056109_357_1211 284
228 3300049575 Ga0501039_0068773 Ga0501039_0068773_1657_2511 284
229 3300049575 Ga0501039_0207388 Ga0501039_0207388_372_1226 284
230 3300049576 Ga0501040_0013931 Ga0501040_0013931_4205_5059 284
231 3300049576 Ga0501040_0037600 Ga0501040_0037600_372_1226 284
232 3300049576 Ga0501040_0085569 Ga0501040_0085569_83_937 284
233 3300049577 Ga0501041_0008365 Ga0501041_0008365_259_1113 284
234 3300049577 Ga0501041_0010800 Ga0501041_0010800_1183_2037 284
235 3300049577 Ga0501041_0015700 Ga0501041_0015700_1707_2561 284
236 3300049578 Ga0501042_0035538 Ga0501042_0035538_2269_3123 284
237 3300049578 Ga0501042_0136812 Ga0501042_0136812_89_943 284
238 3300049579 Ga0501043_0076719 Ga0501043_0076719_365_1219 284
239 3300049579 Ga0501043_0286361 Ga0501043_0286361_99_953 284
240 3300049580 Ga0501046_0026538 Ga0501046_0026538_1868_2722 284
241 3300049580 Ga0501046_0062309 Ga0501046_0062309_601_1455 284
242 3300049580 Ga0501046_0227207 Ga0501046_0227207_256_1110 284
243 3300049582 Ga0501048_0008775 Ga0501048_0008775_6397_7251 284
244 3300049582 Ga0501048_0021038 Ga0501048_0021038_997_1851 284
245 3300049582 Ga0501048_0048391 Ga0501048_0048391_1344_2198 284
246 3300049584 Ga0501068_0092320 Ga0501068_0092320_219_1073 284
247 3300049585 Ga0501069_0199305 Ga0501069_0199305_258_1112 284
248 3300049586 Ga0501070_0345531 Ga0501070_0345531_146_1000 284
249 3300049587 Ga0501071_0074612 Ga0501071_0074612_454_1308 284
250 3300049588 Ga0501072_0000978 Ga0501072_0000978_15631_16485 284
251 3300049588 Ga0501072_0030966 Ga0501072_0030966_996_1850 284
252 3300049588 Ga0501072_0127193 Ga0501072_0127193_1008_1862 284
253 3300049588 Ga0501072_0280670 Ga0501072_0280670_53_907 284
254 3300049590 Ga0501074_0237980 Ga0501074_0237980_374_1228 284
255 3300049590 Ga0501074_0277639 Ga0501074_0277639_134_988 284
256 3300049591 Ga0501075_0000016 Ga0501075_0000016_28976_29830 284
257 3300049591 Ga0501075_0034197 Ga0501075_0034197_2297_3151 284
258 3300049591 Ga0501075_0044972 Ga0501075_0044972_1470_2324 284
259 3300049591 Ga0501075_0065675 Ga0501075_0065675_511_1365 284
260 3300049592 Ga0501076_0000053 Ga0501076_0000053_44712_45566 284
261 3300049592 Ga0501076_0025821 Ga0501076_0025821_665_1519 284
262 3300049593 Ga0501077_0031675 Ga0501077_0031675_2315_3169 284
263 3300049593 Ga0501077_0155770 Ga0501077_0155770_88_942 284
264 3300049593 Ga0501077_0325849 Ga0501077_0325849_105_959 284
265 3300049741 Ga0501079_0032187 Ga0501079_0032187_2908_3762 284
266 3300049741 Ga0501079_0063858 Ga0501079_0063858_1453_2307 284
267 3300049742 Ga0501080_0029008 Ga0501080_0029008_45_899 284
268 3300049743 Ga0501081_0053111 Ga0501081_0053111_1188_2042 284
269 3300049743 Ga0501081_0107730 Ga0501081_0107730_660_1514 284
270 3300049822 Ga0501035_0082255 Ga0501035_0082255_1559_2413 284
271 3300049822 Ga0501035_0103535 Ga0501035_0103535_985_1839 284
272 3300049824 Ga0501045_0006931 Ga0501045_0006931_4244_5098 284
273 3300049824 Ga0501045_0030612 Ga0501045_0030612_2537_3391 284
274 3300049824 Ga0501045_0069342 Ga0501045_0069342_1622_2476 284
275 3300050507 nmdc:mga05p37_408921_c1 nmdc:mga05p37_408921_c1_273_1127 284
276 3300050508 nmdc:mga09592_260862_c1 nmdc:mga09592_260862_c1_528_1382 284
277 3300050508 nmdc:mga09592_561716_c1 nmdc:mga09592_561716_c1_70_924 284
278 3300050508 nmdc:mga09592_76118_c1 nmdc:mga09592_76118_c1_1766_2620 284
279 3300050509 nmdc:mga0qj67_284_c1 nmdc:mga0qj67_284_c1_19838_20692 284
280 3300050509 nmdc:mga0qj67_31851_c1 nmdc:mga0qj67_31851_c1_2091_2945 284
281 3300050510 nmdc:mga06r32_335596_c1 nmdc:mga06r32_335596_c1_394_1248 284
282 3300050510 nmdc:mga06r32_36181_c1 nmdc:mga06r32_36181_c1_353_1207 284
283 3300050511 nmdc:mga08y16_152242_c1 nmdc:mga08y16_152242_c1_676_1530 284
284 3300050511 nmdc:mga08y16_96661_c1 nmdc:mga08y16_96661_c1_217_1071 284
285 3300050512 nmdc:mga0n895_3440_c1 nmdc:mga0n895_3440_c1_708_1562 284
286 3300050514 nmdc:mga08x19_111444_c1 nmdc:mga08x19_111444_c1_534_1388 284
287 3300050514 nmdc:mga08x19_261_c1 nmdc:mga08x19_261_c1_20895_21749 284
288 3300050514 nmdc:mga08x19_4927_c1 nmdc:mga08x19_4927_c1_289_1143 284
289 3300050514 nmdc:mga08x19_80882_c1 nmdc:mga08x19_80882_c1_327_1181 284
290 3300050515 nmdc:mga0a205_32819_c1 nmdc:mga0a205_32819_c1_2258_3112 284
291 3300053077 Ga0495601_0308677 Ga0495601_0308677_15_869 284
292 3300054114 Ga0501084_0007936 Ga0501084_0007936_1453_2307 284
293 3300060353 Ga0501082_0007898 Ga0501082_0007898_1113_1967 284
294 3300060353 Ga0501082_0016953 Ga0501082_0016953_3457_4311 284
295 3300060353 Ga0501082_0133825 Ga0501082_0133825_566_1420 284
296 3300060353 Ga0501082_0139093 Ga0501082_0139093_865_1719 284
297 3300061734 Ga0530510_0000002 Ga0530510_0000002_268366_269220 284
298 3300061734 Ga0530510_0000711 Ga0530510_0000711_19476_20330 284
299 3300061734 Ga0530510_0072905 Ga0530510_0072905_1069_1923 284
300 3300005444 Ga0070694_100025093 Ga0070694_1000250932 285
301 3300005549 Ga0070704_100184884 Ga0070704_1001848842 285
302 3300006163 Ga0070715_10007278 Ga0070715_100072784 285
303 3300006195 Ga0075366_10119486 Ga0075366_101194862 285
304 3300025905 Ga0207685_10005367 Ga0207685_100053673 285
305 3300033179 Ga0307507_10046211 Ga0307507_100462113 285
306 3300036401 Ga0373937_0398661 Ga0373937_0398661_363_1226 285
307 3300050491 nmdc:mga00v17_139351_c1 nmdc:mga00v17_139351_c1_424_1287 285
308 3300053090 Ga0500646_0016527 Ga0500646_0016527_502_1368 285
309 3300053092 Ga0500583_0003461 Ga0500583_0003461_1364_2230 285
310 3300053139 Ga0500568_0012514 Ga0500568_0012514_634_1500 285
311 3300053151 Ga0500604_0060950 Ga0500604_0060950_141_1007 285
312 3300005330 Ga0070690_100019686 Ga0070690_1000196865 286
313 3300005334 Ga0068869_100003269 Ga0068869_1000032695 286
314 3300005336 Ga0070680_100001207 Ga0070680_10000120717 286
315 3300005337 Ga0070682_100005094 Ga0070682_1000050943 286
316 3300005338 Ga0068868_100003224 Ga0068868_1000032245 286
317 3300005340 Ga0070689_100025269 Ga0070689_1000252695 286
318 3300005341 Ga0070691_10024683 Ga0070691_100246833 286
319 3300005343 Ga0070687_100000139 Ga0070687_10000013921 286
320 3300005365 Ga0070688_100239080 Ga0070688_1002390802 286
321 3300005406 Ga0070703_10027397 Ga0070703_100273972 286
322 3300005438 Ga0070701_10002277 Ga0070701_100022773 286
323 3300005439 Ga0070711_100381593 Ga0070711_1003815931 286
324 3300005440 Ga0070705_100019347 Ga0070705_1000193472 286
325 3300005441 Ga0070700_100000374 Ga0070700_10000037417 286
326 3300005444 Ga0070694_100001221 Ga0070694_1000012216 286
327 3300005458 Ga0070681_10041463 Ga0070681_100414632 286
328 3300005459 Ga0068867_100008492 Ga0068867_1000084926 286
329 3300005530 Ga0070679_100025788 Ga0070679_1000257881 286
330 3300005539 Ga0068853_100033145 Ga0068853_1000331453 286
331 3300005544 Ga0070686_100006732 Ga0070686_1000067325 286
332 3300005545 Ga0070695_100011120 Ga0070695_1000111204 286
333 3300005546 Ga0070696_100001256 Ga0070696_10000125616 286
334 3300005547 Ga0070693_100000301 Ga0070693_1000003012 286
335 3300005549 Ga0070704_100137212 Ga0070704_1001372121 286
336 3300005563 Ga0068855_100011048 Ga0068855_1000110482 286
337 3300005578 Ga0068854_100015977 Ga0068854_1000159775 286
338 3300005614 Ga0068856_100023606 Ga0068856_1000236065 286
339 3300005615 Ga0070702_100007791 Ga0070702_1000077916 286
340 3300005616 Ga0068852_100085995 Ga0068852_1000859953 286
341 3300005617 Ga0068859_100283493 Ga0068859_1002834932 286
342 3300005718 Ga0068866_10005419 Ga0068866_100054192 286
343 3300005719 Ga0068861_100011915 Ga0068861_1000119152 286
344 3300005841 Ga0068863_100072481 Ga0068863_1000724812 286
345 3300005841 Ga0068863_100162768 Ga0068863_1001627682 286
346 3300005842 Ga0068858_100052547 Ga0068858_1000525472 286
347 3300005843 Ga0068860_100080998 Ga0068860_1000809983 286
348 3300006237 Ga0097621_100004433 Ga0097621_10000443311 286
349 3300006358 Ga0068871_100001947 Ga0068871_1000019475 286
350 3300006881 Ga0068865_100058970 Ga0068865_1000589701 286
351 3300006931 Ga0097620_100283494 Ga0097620_1002834942 286
352 3300009094 Ga0111539_10826793 Ga0111539_108267932 286
353 3300009098 Ga0105245_10007955 Ga0105245_100079556 286
354 3300009148 Ga0105243_10025361 Ga0105243_100253613 286
355 3300009174 Ga0105241_10029626 Ga0105241_100296264 286
356 3300009176 Ga0105242_10037001 Ga0105242_100370014 286
357 3300009177 Ga0105248_10244902 Ga0105248_102449023 286
358 3300009553 Ga0105249_10010159 Ga0105249_100101595 286
359 3300010375 Ga0105239_10019323 Ga0105239_100193236 286
360 3300011119 Ga0105246_10058068 Ga0105246_100580683 286
361 3300013297 Ga0157378_10028624 Ga0157378_100286244 286
362 3300013306 Ga0163162_10311916 Ga0163162_103119162 286
363 3300013307 Ga0157372_10083640 Ga0157372_100836404 286
364 3300014326 Ga0157380_10076631 Ga0157380_100766312 286
365 3300014968 Ga0157379_10112541 Ga0157379_101125413 286
366 3300014969 Ga0157376_10062102 Ga0157376_100621024 286
367 3300025899 Ga0207642_10049834 Ga0207642_100498343 286
368 3300025901 Ga0207688_10109830 Ga0207688_101098301 286
369 3300025916 Ga0207663_10201216 Ga0207663_102012162 286
370 3300025918 Ga0207662_10000214 Ga0207662_1000021422 286
371 3300025927 Ga0207687_10027741 Ga0207687_100277414 286
372 3300025933 Ga0207706_10302306 Ga0207706_103023062 286
373 3300025935 Ga0207709_10074751 Ga0207709_100747512 286
374 3300025936 Ga0207670_10025832 Ga0207670_100258324 286
375 3300025942 Ga0207689_10001553 Ga0207689_100015538 286
376 3300025981 Ga0207640_10008105 Ga0207640_100081052 286
377 3300026023 Ga0207677_10006898 Ga0207677_100068986 286
378 3300026075 Ga0207708_10016731 Ga0207708_100167311 286
379 3300026089 Ga0207648_10002022 Ga0207648_100020223 286
380 3300026118 Ga0207675_100001190 Ga0207675_1000011907 286
381 3300035118 Ga0373954_0053672 Ga0373954_0053672_803_1669 286
382 3300035172 Ga0373955_0160368 Ga0373955_0160368_29_895 286
383 3300035207 Ga0373942_0067642 Ga0373942_0067642_92_958 286
384 3300035410 Ga0373924_0026020 Ga0373924_0026020_1407_2273 286
385 3300035724 Ga0373933_0014405 Ga0373933_0014405_2035_2901 286
386 3300042876 Ga0451577_0062880 Ga0451577_0062880_264_1130 286
387 3300046477 Ga0495664_0266184 Ga0495664_0266184_41_910 286
388 3300046517 Ga0495630_0168566 Ga0495630_0168566_132_998 286
389 3300047322 Ga0495680_0031472 Ga0495680_0031472_1827_2693 286
390 3300005336 Ga0070680_100168242 Ga0070680_1001682422 287
391 3300005339 Ga0070660_100020136 Ga0070660_1000201363 287
392 3300005344 Ga0070661_100091961 Ga0070661_1000919613 287
393 3300005366 Ga0070659_100191801 Ga0070659_1001918011 287
394 3300005435 Ga0070714_100157331 Ga0070714_1001573312 287
395 3300005436 Ga0070713_100000106 Ga0070713_10000010633 287
396 3300005458 Ga0070681_10032924 Ga0070681_100329242 287
397 3300005530 Ga0070679_100394095 Ga0070679_1003940952 287
398 3300005563 Ga0068855_100043381 Ga0068855_1000433816 287
399 3300005614 Ga0068856_100080238 Ga0068856_1000802384 287
400 3300005616 Ga0068852_100218882 Ga0068852_1002188822 287
401 3300009174 Ga0105241_10286308 Ga0105241_102863082 287
402 3300013104 Ga0157370_10003812 Ga0157370_100038124 287
403 3300013104 Ga0157370_10181647 Ga0157370_101816472 287
404 3300013105 Ga0157369_10044991 Ga0157369_100449914 287
405 3300013105 Ga0157369_10159745 Ga0157369_101597452 287
406 3300013307 Ga0157372_10050586 Ga0157372_100505862 287
407 3300025912 Ga0207707_10028202 Ga0207707_100282022 287
408 3300025916 Ga0207663_10335479 Ga0207663_103354791 287
409 3300025917 Ga0207660_10074819 Ga0207660_100748192 287
410 3300025919 Ga0207657_10014696 Ga0207657_100146966 287
411 3300025919 Ga0207657_10199258 Ga0207657_101992582 287
412 3300025920 Ga0207649_10042091 Ga0207649_100420912 287
413 3300025928 Ga0207700_10000576 Ga0207700_100005769 287
414 3300025929 Ga0207664_10137764 Ga0207664_101377642 287
415 3300025932 Ga0207690_10222336 Ga0207690_102223362 287
416 3300025945 Ga0207679_10105436 Ga0207679_101054362 287
417 3300026078 Ga0207702_10016649 Ga0207702_100166494 287
418 3300026078 Ga0207702_10299471 Ga0207702_102994712 287
419 3300026142 Ga0207698_10208571 Ga0207698_102085712 287
420 3300044694 Ga0466963_0081031 Ga0466963_0081031_935_1828 287
421 3300045836 Ga0466958_0206945 Ga0466958_0206945_292_1194 287
422 3300005295 Ga0065707_10166755 Ga0065707_101667552 288
423 3300006042 Ga0075368_10002604 Ga0075368_100026042 288
424 3300006173 Ga0070716_100018789 Ga0070716_1000187893 288
425 3300006844 Ga0075428_100265601 Ga0075428_1002656012 288
426 3300006844 Ga0075428_100283477 Ga0075428_1002834772 288
427 3300006847 Ga0075431_100028736 Ga0075431_1000287362 288
428 3300006847 Ga0075431_100209998 Ga0075431_1002099981 288
429 3300006880 Ga0075429_100012725 Ga0075429_1000127253 288
430 3300006880 Ga0075429_100035579 Ga0075429_1000355794 288
431 3300009094 Ga0111539_10247411 Ga0111539_102474112 288
432 3300009147 Ga0114129_10058594 Ga0114129_100585944 288
433 3300009147 Ga0114129_10117666 Ga0114129_101176663 288
434 3300035083 Ga0373926_0001761 Ga0373926_0001761_4382_5251 288
435 3300035084 Ga0373928_0011984 Ga0373928_0011984_588_1457 288
436 3300035088 Ga0373940_0001255 Ga0373940_0001255_404_1273 288
437 3300035089 Ga0373944_0002710 Ga0373944_0002710_3316_4185 288
438 3300035111 Ga0373923_0056282 Ga0373923_0056282_540_1409 288
439 3300035116 Ga0373945_0004103 Ga0373945_0004103_3442_4311 288
440 3300035118 Ga0373954_0000494 Ga0373954_0000494_12763_13644 288
441 3300035118 Ga0373954_0007630 Ga0373954_0007630_3758_4660 288
442 3300035410 Ga0373924_0063453 Ga0373924_0063453_377_1258 288
443 3300035691 Ga0373931_0042103 Ga0373931_0042103_439_1308 288
444 3300035695 Ga0373927_0004974 Ga0373927_0004974_4903_5772 288
445 3300035725 Ga0373947_0093802 Ga0373947_0093802_558_1427 288
446 3300036401 Ga0373937_0001375 Ga0373937_0001375_4515_5396 288
447 3300037068 Ga0373925_0109469 Ga0373925_0109469_971_1840 288
448 3300037471 Ga0395905_0148808 Ga0395905_0148808_1136_2032 288
449 3300038443 Ga0395901_0105842 Ga0395901_0105842_490_1386 288
450 3300041486 Ga0451807_2130962 Ga0451807_2130962_185_1054 288
451 3300041512 Ga0451853_0111693 Ga0451853_0111693_39_908 288
452 3300045051 Ga0451576_0375160 Ga0451576_0375160_217_1086 288
453 3300046472 Ga0495580_0003258 Ga0495580_0003258_5391_6260 288
454 3300046475 Ga0495639_0020270 Ga0495639_0020270_125_994 288
455 3300046511 Ga0495608_0056975 Ga0495608_0056975_1561_2448 288
456 3300046522 Ga0495643_0016192 Ga0495643_0016192_916_1824 288
457 3300046528 Ga0495642_0015225 Ga0495642_0015225_885_1793 288
458 3300046531 Ga0495665_0010183 Ga0495665_0010183_2002_2871 288
459 3300046535 Ga0495586_0003330 Ga0495586_0003330_2916_3785 288
460 3300046616 Ga0495668_0014457 Ga0495668_0014457_992_1900 288
461 3300046674 Ga0495588_0008086 Ga0495588_0008086_1650_2519 288
462 3300046681 Ga0495647_0000969 Ga0495647_0000969_6842_7711 288
463 3300046683 Ga0495658_0001458 Ga0495658_0001458_5234_6103 288
464 3300047315 Ga0495581_0056381 Ga0495581_0056381_226_1095 288
465 3300047321 Ga0495676_0004858 Ga0495676_0004858_4189_5058 288
466 3300050507 nmdc:mga05p37_138978_c1 nmdc:mga05p37_138978_c1_527_1396 288
467 3300050508 nmdc:mga09592_153568_c1 nmdc:mga09592_153568_c1_588_1457 288
468 3300050510 nmdc:mga06r32_401961_c1 nmdc:mga06r32_401961_c1_16_885 288
469 3300050511 nmdc:mga08y16_85033_c1 nmdc:mga08y16_85033_c1_2119_2988 288
470 3300050513 nmdc:mga0rr50_32532_c1 nmdc:mga0rr50_32532_c1_2745_3635 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14696

Glyoxalase_5

Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal

32

162

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x8e-assembly3.cif.gz_D-3 crystal structure of pfhppd-y13287 complex 0.8205 12 287
7xnt-assembly1.cif.gz_G crystal structure of pfhppd-y13161 complex 0.8186 12 287
7x8e-assembly2.cif.gz_F crystal structure of pfhppd-y13287 complex 0.8161 12 287
7x8e-assembly1.cif.gz_A crystal structure of pfhppd-y13287 complex 0.8153 12 287
7x8e-assembly1.cif.gz_E crystal structure of pfhppd-y13287 complex 0.8133 12 287
ID Description Score Start End Superfamily
1cjxD01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8554 12 153 3.10.180.10
1cjxD01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8071 12 153 3.10.180.10
af_E7FH29_2_166_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7688 16 147 3.10.180.10
3p8aB02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7508 159 284 2.60.40.4320
af_Q18347_1_154_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7489 15 146 3.10.180.10
ID Description Score Start End GO Terms
AF-N6Z3L8-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9646 17 288 GO:0046872
GO:0051213
AF-A0A1H7S467-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9545 11 288 GO:0046872
GO:0051213
AF-N6Z3L8-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9542 17 288 GO:0046872
GO:0051213
AF-W8X881-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) 0.9389 14 288 GO:0003868
AF-A0A1F4B8T9-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9368 1 286 GO:0051213

Feature Viewer

pLDDT pTM Quality
84.94 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map