F450278

General Info

Members Datasets Scaffolds Average Seq Length
469 241 458 473

Family's Representative Sequence

Representative Sequence 3300038741|Ga0400488_58354|Ga0400488_58354_971_2500
Length 509
Sequence LSDGDKKVVANQSQPDLPLNENSWSFMPRRTKVVATLGPATDDPKMLDKLIHAGVDVVRLNLSHDVHESQRQRAERIRNRARACGRQIGVLCDLQGPKIRIGKFKQGPIELEENGEFILDASCALDAGDQERVGLTYPDLVKDVARGDTLLLDDGAIVFWISEVKGLEIHCKVVVGGKLSNNKGINKQGGGLSAPALTDKDRDDIKFAAEIDADYVAVSFVRSAEDVTETRRLLEEAGGHGGIVAKIERAEALDCITDIIQASDAIMVARGDLGVEIGDAELPAVQKELIKTAREMNCVVITATQMMQSMIESPIPTRAEVFDVANAVLDGTDAVMLSAETSVGKYPNKVVEAMDRVCIEAEKQSSARRSQHRLDSVFGRVDEAIAMSTMYTANHLGVKAIAALTESGSTVKWMSRISSDIPIYALTRHVHTRRKVTLYRGVYPVSFDVASTDVDQVNEEVIDELLRRGEVRENDLVIITKGDRSGVEGQTNIMKVMRVGEHVLADRVD

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
4 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
5 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
6 2885266251 Ralstonia sp. SET104 Isolate Nodule
7 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
8 2928058823 Ralstonia sp. 1138 Isolate Unclassified
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
144 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
158 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
159 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
160 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
173 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
174 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
175 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
176 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
177 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
178 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
179 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
180 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
181 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
182 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
239 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
240 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
241 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.29
Metatranscriptomes 12.37
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.81
Nodule 1.28
Rhizoplane 1.49
Rhizosphere 77.19
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001552 3300001915 Bacteria 6495
2 JGI25156J39149_1002320 3300002705 Bacteria 6938
3 JGI25154J39366_1000592 3300002738 Bacteria 17494
4 Ga0006562J51391_1055797 3300003578 Bacteria 5089
5 Ga0055538_1001890 3300003751 Bacteria 3494
6 Ga0055539_1000220 3300003752 Bacteria 40561
7 Ga0055533_1006356 3300003756 Bacteria 1752
8 Ga0055532_1000006 3300003758 Bacteria 451244
9 Ga0055525_1000427 3300003759 Bacteria 25058
10 Ga0055535_1000004 3300003761 Bacteria 451244
11 Ga0055542_1000407 3300003762 Bacteria 42032
12 Ga0055529_1000022 3300003763 Bacteria 320108
13 Ga0055526_1003944 3300003771 Bacteria 9160
14 Ga0055524_1000389 3300003775 Bacteria 37746
15 Ga0055524_1006716 3300003775 Bacteria 4966
16 Ga0055536_1000364 3300003781 Bacteria 33640
17 Ga0055541_1000949 3300003841 Bacteria 6841
18 Ga0065715_10005833 3300005293 Bacteria 3778
19 Ga0070690_100030083 3300005330 Bacteria 3372
20 Ga0070677_10015139 3300005333 Bacteria 2728
21 Ga0070666_10015953 3300005335 Bacteria 4798
22 Ga0070682_100030633 3300005337 Bacteria 3250
23 Ga0070682_100045104 3300005337 Bacteria 2731
24 Ga0070689_100003069 3300005340 Bacteria 10999
25 Ga0070661_100000123 3300005344 Bacteria 63559
26 Ga0070668_100082684 3300005347 Bacteria 2519
27 Ga0070668_100131850 3300005347 Bacteria 2006
28 Ga0070669_100147963 3300005353 Bacteria 1816
29 Ga0070675_100014226 3300005354 Bacteria 6273
30 Ga0070675_100015779 3300005354 Bacteria 5978
31 Ga0070671_100004553 3300005355 Bacteria 10979
32 Ga0070674_100033358 3300005356 Bacteria 3426
33 Ga0070674_100066690 3300005356 Bacteria 2530
34 Ga0070673_100024694 3300005364 Bacteria 4411
35 Ga0070688_100039766 3300005365 Bacteria 2879
36 Ga0070659_100002250 3300005366 Bacteria 13738
37 Ga0070667_100180864 3300005367 Bacteria 1864
38 Ga0070700_100017894 3300005441 Bacteria 4063
39 Ga0070700_100083440 3300005441 Bacteria 2069
40 Ga0070663_100000020 3300005455 Bacteria 112469
41 Ga0070678_100044264 3300005456 Bacteria 3178
42 Ga0070678_100077427 3300005456 Bacteria 2508
43 Ga0070678_100134177 3300005456 Bacteria 1972
44 Ga0068867_100094285 3300005459 Bacteria 2276
45 Ga0070672_100004654 3300005543 Bacteria 8993
46 Ga0070672_100034372 3300005543 Bacteria 3847
47 Ga0070665_100001680 3300005548 Bacteria 25502
48 Ga0070664_100000003 3300005564 Bacteria 325604
49 Ga0070664_100194576 3300005564 Bacteria 1807
50 Ga0068857_100006996 3300005577 Bacteria 9705
51 Ga0068854_100000100 3300005578 Bacteria 60250
52 Ga0068856_100000011 3300005614 Bacteria 170419
53 Ga0070702_100009884 3300005615 Bacteria 4683
54 Ga0068870_10021806 3300005840 Bacteria 3140
55 Ga0068870_10043081 3300005840 Bacteria 2353
56 Ga0068863_100073204 3300005841 Bacteria 3241
57 Ga0068863_100084104 3300005841 Bacteria 3016
58 Ga0068862_100051259 3300005844 Bacteria 3529
59 Ga0081455_10002185 3300005937 Bacteria 23311
60 Ga0097621_100044635 3300006237 Bacteria 3576
61 Ga0097621_100053638 3300006237 Bacteria 3287
62 Ga0068871_100005565 3300006358 Bacteria 8829
63 Ga0068871_100023593 3300006358 Bacteria 4761
64 Ga0075430_100053146 3300006846 Bacteria 3411
65 Ga0075431_100005433 3300006847 Bacteria 12588
66 Ga0075433_10000655 3300006852 Bacteria 23337
67 Ga0075434_100002324 3300006871 Bacteria 16654
68 Ga0099826_10000014 3300006948 Bacteria 258520
69 Ga0075435_100037901 3300007076 Bacteria 3842
70 Ga0105240_10139074 3300009093 Bacteria 2905
71 Ga0111539_10111412 3300009094 Bacteria 3211
72 Ga0111539_10150656 3300009094 Bacteria 2722
73 Ga0111539_10181058 3300009094 Bacteria 2461
74 Ga0111539_10407553 3300009094 Bacteria 1583
75 Ga0114129_10186956 3300009147 Bacteria 2815
76 Ga0105243_10049931 3300009148 Bacteria 3303
77 Ga0105242_10026861 3300009176 Bacteria 4565
78 Ga0105246_10110278 3300011119 Bacteria 2020
79 Ga0157373_10010706 3300013100 Bacteria 6746
80 Ga0157371_10000083 3300013102 Bacteria 149633
81 Ga0157370_10000302 3300013104 Bacteria 62696
82 Ga0157369_10003136 3300013105 Bacteria 19748
83 Ga0157374_10001794 3300013296 Bacteria 18065
84 Ga0163162_10041360 3300013306 Bacteria 4611
85 Ga0157372_10000577 3300013307 Bacteria 40077
86 Ga0157372_10040109 3300013307 Bacteria 5170
87 Ga0157375_10335461 3300013308 Bacteria 1677
88 Ga0157380_10004861 3300014326 Bacteria 9360
89 Ga0157380_10006003 3300014326 Bacteria 8503
90 Ga0157380_10012567 3300014326 Bacteria 6144
91 Ga0157376_10082474 3300014969 Bacteria 2763
92 Ga0182006_1000657 3300015261 Bacteria 24440
93 Ga0163161_10065806 3300017792 Bacteria 2645
94 Ga0197907_11217678 3300020069 Bacteria 3049
95 Ga0206351_10055363 3300020077 Bacteria 9167
96 Ga0206350_10943148 3300020080 Bacteria 2851
97 Ga0154015_1096764 3300020610 Bacteria 26201
98 Ga0209784_100195 3300025224 Bacteria 46751
99 Ga0209566_100002 3300025225 Bacteria 2614868
100 Ga0209566_100477 3300025225 Bacteria 28418
101 Ga0209566_101307 3300025225 Bacteria 8068
102 Ga0209674_100010 3300025226 Bacteria 1038638
103 Ga0209674_100050 3300025226 Bacteria 341738
104 Ga0209674_100205 3300025226 Bacteria 59434
105 Ga0209672_100123 3300025228 Bacteria 81654
106 Ga0209672_100313 3300025228 Bacteria 32379
107 Ga0209147_100015 3300025229 Bacteria 565073
108 Ga0209563_100004 3300025230 Bacteria 1814108
109 Ga0209563_100026 3300025230 Bacteria 559453
110 Ga0209258_100021 3300025242 Bacteria 565073
111 Ga0209646_1000075 3300025246 Bacteria 221755
112 Ga0209026_1004195 3300025250 Bacteria 4396
113 Ga0209026_1008945 3300025250 Bacteria 2026
114 Ga0209677_100013 3300025253 Bacteria 548200
115 Ga0209677_103654 3300025253 Bacteria 4848
116 Ga0209148_1000043 3300025254 Bacteria 461531
117 Ga0209148_1003927 3300025254 Bacteria 3841
118 Ga0209759_1003087 3300025256 Bacteria 6844
119 Ga0209759_1008279 3300025256 Bacteria 3254
120 Ga0209565_1000045 3300025263 Bacteria 226864
121 Ga0209455_1000028 3300025272 Bacteria 565073
122 Ga0209673_1007510 3300025273 Bacteria 5005
123 Ga0209675_1000173 3300025291 Bacteria 74892
124 Ga0209675_1000636 3300025291 Bacteria 24928
125 Ga0209675_1012687 3300025291 Bacteria 2694
126 Ga0209676_1000064 3300025292 Bacteria 321700
127 Ga0209025_1000554 3300025294 Bacteria 69453
128 Ga0209025_1001692 3300025294 Bacteria 26926
129 Ga0209025_1004115 3300025294 Bacteria 12936
130 Ga0209564_1000107 3300025295 Bacteria 214040
131 Ga0209564_1000371 3300025295 Bacteria 83128
132 Ga0209564_1000741 3300025295 Bacteria 46301
133 Ga0209256_1000105 3300025299 Bacteria 188238
134 Ga0209256_1000340 3300025299 Bacteria 76961
135 Ga0207697_10006349 3300025315 Bacteria 5359
136 Ga0207682_10002225 3300025893 Bacteria 8752
137 Ga0207682_10004380 3300025893 Bacteria 5915
138 Ga0207682_10004713 3300025893 Bacteria 5658
139 Ga0207688_10006786 3300025901 Bacteria 6230
140 Ga0207645_10036188 3300025907 Bacteria 3170
141 Ga0207643_10014319 3300025908 Bacteria 4307
142 Ga0207643_10044173 3300025908 Bacteria 2515
143 Ga0207649_10002331 3300025920 Bacteria 10653
144 Ga0207681_10128972 3300025923 Bacteria 1867
145 Ga0207650_10003030 3300025925 Bacteria 11576
146 Ga0207690_10001166 3300025932 Bacteria 16638
147 Ga0207706_10030356 3300025933 Bacteria 4822
148 Ga0207706_10071865 3300025933 Bacteria 3044
149 Ga0207691_10002911 3300025940 Bacteria 16702
150 Ga0207691_10050259 3300025940 Bacteria 3817
151 Ga0207691_10160051 3300025940 Bacteria 1975
152 Ga0207679_10000083 3300025945 Bacteria 83025
153 Ga0207651_10033860 3300025960 Bacteria 3300
154 Ga0207640_10000111 3300025981 Bacteria 61830
155 Ga0207678_10000030 3300026067 Bacteria 112455
156 Ga0207708_10026639 3300026075 Bacteria 4377
157 Ga0207702_10000054 3300026078 Bacteria 137192
158 Ga0207648_10094319 3300026089 Bacteria 2617
159 Ga0207648_10151830 3300026089 Bacteria 2044
160 Ga0207674_10004613 3300026116 Bacteria 16544
161 Ga0207674_10187756 3300026116 Bacteria 2017
162 Ga0207675_100004010 3300026118 Bacteria 14277
163 Ga0207675_100061202 3300026118 Bacteria 3515
164 Ga0207675_100178560 3300026118 Bacteria 2032
165 Ga0207683_10018053 3300026121 Bacteria 6016
166 Ga0207683_10026616 3300026121 Bacteria 4994
167 Ga0207683_10196583 3300026121 Bacteria 1832
168 Ga0209282_1000046 3300027666 Bacteria 115032
169 Ga0207428_10071265 3300027907 Bacteria 2730
170 Ga0268266_10034774 3300028379 Bacteria 4286
171 Ga0268266_10057506 3300028379 Bacteria 3347
172 Ga0268265_10046663 3300028380 Bacteria 3240
173 Ga0265318_10004875 3300028577 Bacteria 6406
174 Ga0307515_10096763 3300028794 Bacteria 3616
175 Ga0265330_10019467 3300031235 Bacteria 3110
176 Ga0265332_10006309 3300031238 Bacteria 5390
177 Ga0265328_10000034 3300031239 Bacteria 99505
178 Ga0265331_10000024 3300031250 Bacteria 235118
179 Ga0265331_10003750 3300031250 Bacteria 9655
180 Ga0265331_10004021 3300031250 Bacteria 9279
181 Ga0265331_10006789 3300031250 Bacteria 6706
182 Ga0265327_10000079 3300031251 Bacteria 206892
183 Ga0265327_10000734 3300031251 Bacteria 51220
184 Ga0265327_10000923 3300031251 Bacteria 43037
185 Ga0265327_10001605 3300031251 Bacteria 27421
186 Ga0265327_10001709 3300031251 Bacteria 26222
187 Ga0265327_10005432 3300031251 Bacteria 10628
188 Ga0265327_10007065 3300031251 Bacteria 8785
189 Ga0265316_10001175 3300031344 Bacteria 28360
190 Ga0265316_10036476 3300031344 Bacteria 3975
191 Ga0307513_10030332 3300031456 Bacteria 6144
192 Ga0307509_10049795 3300031507 Bacteria 4489
193 Ga0307408_100035214 3300031548 Bacteria 3511
194 Ga0307408_100071472 3300031548 Bacteria 2566
195 Ga0265313_10039574 3300031595 Bacteria 2338
196 Ga0316575_10001740 3300031665 Bacteria 7127
197 Ga0316579_10000037 3300031691 Bacteria 30469
198 Ga0316579_10001095 3300031691 Bacteria 9616
199 Ga0316579_10001631 3300031691 Bacteria 8225
200 Ga0316579_10009383 3300031691 Bacteria 4112
201 Ga0316579_10014354 3300031691 Bacteria 3423
202 Ga0316579_10039399 3300031691 Bacteria 2189
203 Ga0265314_10001689 3300031711 Bacteria 24021
204 Ga0265342_10007072 3300031712 Bacteria 8270
205 Ga0316576_10000271 3300031727 Bacteria 22695
206 Ga0316576_10001673 3300031727 Bacteria 12163
207 Ga0316576_10002749 3300031727 Bacteria 10091
208 Ga0316576_10004989 3300031727 Bacteria 8041
209 Ga0316576_10005366 3300031727 Bacteria 7817
210 Ga0316576_10041426 3300031727 Bacteria 3315
211 Ga0316576_10058897 3300031727 Bacteria 2810
212 Ga0316576_10075685 3300031727 Bacteria 2490
213 Ga0316576_10089262 3300031727 Bacteria 2296
214 Ga0316578_10000044 3300031728 Bacteria 25781
215 Ga0316578_10016152 3300031728 Bacteria 4033
216 Ga0316578_10016304 3300031728 Bacteria 4017
217 Ga0316578_10023155 3300031728 Bacteria 3474
218 Ga0316578_10026597 3300031728 Bacteria 3264
219 Ga0316578_10048150 3300031728 Bacteria 2489
220 Ga0316578_10048932 3300031728 Bacteria 2469
221 Ga0316577_10000086 3300031733 Bacteria 24604
222 Ga0316577_10001780 3300031733 Bacteria 10388
223 Ga0316577_10010275 3300031733 Bacteria 5048
224 Ga0316577_10016565 3300031733 Bacteria 4065
225 Ga0316577_10026866 3300031733 Bacteria 3207
226 Ga0316577_10031171 3300031733 Bacteria 2979
227 Ga0307413_10026165 3300031824 Bacteria 3212
228 Ga0307410_10006125 3300031852 Bacteria 6454
229 Ga0307410_10011816 3300031852 Bacteria 5014
230 Ga0307406_10163669 3300031901 Bacteria 1602
231 Ga0307409_100023083 3300031995 Bacteria 4303
232 Ga0307409_100108655 3300031995 Bacteria 2320
233 Ga0307416_100007763 3300032002 Bacteria 6858
234 Ga0307416_100052331 3300032002 Bacteria 3269
235 Ga0307411_10004256 3300032005 Bacteria 6820
236 Ga0307415_100017302 3300032126 Bacteria 4320
237 Ga0316583_10002267 3300032133 Bacteria 6623
238 Ga0316583_10004196 3300032133 Bacteria 5125
239 Ga0316583_10005905 3300032133 Bacteria 4402
240 Ga0316583_10008186 3300032133 Bacteria 3766
241 Ga0316585_10000011 3300032137 Bacteria 28942
242 Ga0316585_10001737 3300032137 Bacteria 5803
243 Ga0316585_10009971 3300032137 Bacteria 2781
244 Ga0316585_10018434 3300032137 Bacteria 2118
245 Ga0316580_10000021 3300032139 Bacteria 24429
246 Ga0316580_10000411 3300032139 Bacteria 9712
247 Ga0316580_10000923 3300032139 Bacteria 7275
248 Ga0316580_10001800 3300032139 Bacteria 5739
249 Ga0316580_10007371 3300032139 Bacteria 3274
250 Ga0316593_10000287 3300032168 Bacteria 8531
251 Ga0316593_10000744 3300032168 Bacteria 6416
252 Ga0316593_10001012 3300032168 Bacteria 5815
253 Ga0316593_10002542 3300032168 Bacteria 4353
254 Ga0316593_10002545 3300032168 Bacteria 4351
255 Ga0316593_10002732 3300032168 Bacteria 4254
256 Ga0316593_10003466 3300032168 Bacteria 3919
257 Ga0316593_10003846 3300032168 Bacteria 3777
258 Ga0316593_10005546 3300032168 Bacteria 3339
259 Ga0316593_10006369 3300032168 Bacteria 3179
260 Ga0316593_10008434 3300032168 Bacteria 2874
261 Ga0316593_10008457 3300032168 Bacteria 2871
262 Ga0316593_10012842 3300032168 Bacteria 2466
263 Ga0316593_10016761 3300032168 Bacteria 2226
264 Ga0316593_10018626 3300032168 Bacteria 2136
265 Ga0316592_1000090 3300033524 Bacteria 8949
266 Ga0316592_1001253 3300033524 Bacteria 4023
267 Ga0316592_1001269 3300033524 Bacteria 3999
268 Ga0316592_1001438 3300033524 Bacteria 3827
269 Ga0316592_1001545 3300033524 Bacteria 3739
270 Ga0316592_1001753 3300033524 Bacteria 3609
271 Ga0316592_1003262 3300033524 Bacteria 2902
272 Ga0316586_1000057 3300033527 Bacteria 8069
273 Ga0316586_1000096 3300033527 Bacteria 6380
274 Ga0316586_1001479 3300033527 Bacteria 2706
275 Ga0316586_1002195 3300033527 Bacteria 2397
276 Ga0316586_1004445 3300033527 Bacteria 1915
277 Ga0316588_1000974 3300033528 Bacteria 4447
278 Ga0316588_1001193 3300033528 Bacteria 4149
279 Ga0316588_1002468 3300033528 Bacteria 3226
280 Ga0316588_1005743 3300033528 Bacteria 2440
281 Ga0316588_1006405 3300033528 Bacteria 2352
282 Ga0316588_1006570 3300033528 Bacteria 2329
283 Ga0316587_1006800 3300033529 Bacteria 1760
284 Ga0316596_1000084 3300033541 Bacteria 11347
285 Ga0316596_1000583 3300033541 Bacteria 6405
286 Ga0316596_1000941 3300033541 Bacteria 5541
287 Ga0316596_1000963 3300033541 Bacteria 5500
288 Ga0316596_1001417 3300033541 Bacteria 4824
289 Ga0316596_1002239 3300033541 Bacteria 4102
290 Ga0316596_1002509 3300033541 Bacteria 3929
291 Ga0316596_1002696 3300033541 Bacteria 3816
292 Ga0316596_1002839 3300033541 Bacteria 3743
293 Ga0316596_1004058 3300033541 Bacteria 3253
294 Ga0316596_1005010 3300033541 Bacteria 3003
295 Ga0316596_1005222 3300033541 Bacteria 2959
296 Ga0316596_1007337 3300033541 Bacteria 2604
297 Ga0316596_1007420 3300033541 Bacteria 2591
298 Ga0316596_1008288 3300033541 Bacteria 2474
299 Ga0316596_1015278 3300033541 Bacteria 1912
300 Ga0316596_1018847 3300033541 Bacteria 1747
301 Ga0373952_0010275 3300035092 Bacteria 1806
302 Ga0316574_0000004 3300035398 Bacteria 49638
303 Ga0316574_0000986 3300035398 Bacteria 12788
304 Ga0316574_0001150 3300035398 Bacteria 12194
305 Ga0316574_0001423 3300035398 Bacteria 11343
306 Ga0316574_0004147 3300035398 Bacteria 7550
307 Ga0316574_0004460 3300035398 Bacteria 7343
308 Ga0316574_0004741 3300035398 Bacteria 7178
309 Ga0316574_0006201 3300035398 Bacteria 6439
310 Ga0316574_0009233 3300035398 Bacteria 5516
311 Ga0316574_0011479 3300035398 Bacteria 5034
312 Ga0316574_0020305 3300035398 Bacteria 3931
313 Ga0316574_0027039 3300035398 Bacteria 3454
314 Ga0316574_0028277 3300035398 Bacteria 3380
315 Ga0316574_0037444 3300035398 Bacteria 2975
316 Ga0316574_0073835 3300035398 Bacteria 2157
317 Ga0316582_0000710 3300036647 Bacteria 13199
318 Ga0316582_0000925 3300036647 Bacteria 12092
319 Ga0316582_0002481 3300036647 Bacteria 8683
320 Ga0316582_0006733 3300036647 Bacteria 6063
321 Ga0316582_0008775 3300036647 Bacteria 5448
322 Ga0316582_0011271 3300036647 Bacteria 4936
323 Ga0316582_0015263 3300036647 Bacteria 4387
324 Ga0316582_0017423 3300036647 Bacteria 4156
325 Ga0316582_0017532 3300036647 Bacteria 4146
326 Ga0316582_0020650 3300036647 Bacteria 3877
327 Ga0316582_0026651 3300036647 Bacteria 3481
328 Ga0316582_0068887 3300036647 Bacteria 2286
329 Ga0316584_0000070 3300036712 Bacteria 40891
330 Ga0316584_0000765 3300036712 Bacteria 17929
331 Ga0316584_0002072 3300036712 Bacteria 12553
332 Ga0316584_0004595 3300036712 Bacteria 9150
333 Ga0316584_0005309 3300036712 Bacteria 8630
334 Ga0316584_0006534 3300036712 Bacteria 7898
335 Ga0316584_0011636 3300036712 Bacteria 6188
336 Ga0316584_0011672 3300036712 Bacteria 6181
337 Ga0316584_0013120 3300036712 Bacteria 5856
338 Ga0316584_0013136 3300036712 Bacteria 5853
339 Ga0316584_0027051 3300036712 Bacteria 4220
340 Ga0316584_0030679 3300036712 Bacteria 3971
341 Ga0316584_0046749 3300036712 Bacteria 3233
342 Ga0316584_0051782 3300036712 Bacteria 3070
343 Ga0316584_0053203 3300036712 Bacteria 3030
344 Ga0316584_0105258 3300036712 Bacteria 2111
345 Ga0316584_0147605 3300036712 Bacteria 1752
346 Ga0395900_0002002 3300037418 Bacteria 23000
347 Ga0395905_0108108 3300037471 Bacteria 2611
348 Ga0316581_0001305 3300037588 Bacteria 5537
349 Ga0316581_0002713 3300037588 Bacteria 4286
350 Ga0316581_0005687 3300037588 Bacteria 3264
351 Ga0316581_0006329 3300037588 Bacteria 3127
352 Ga0400484_15756 3300038725 Bacteria 14988
353 Ga0400484_23801 3300038725 Bacteria 8306
354 Ga0400484_26404 3300038725 Bacteria 7047
355 Ga0400490_00822 3300038726 Bacteria 38098
356 Ga0400490_15107 3300038726 Bacteria 71074
357 Ga0400490_19738 3300038726 Bacteria 21312
358 Ga0400490_27043 3300038726 Bacteria 22747
359 Ga0400490_32012 3300038726 Bacteria 3978
360 Ga0400491_18213 3300038727 Bacteria 4906
361 Ga0400485_10051 3300038735 Bacteria 70678
362 Ga0400488_32695 3300038741 Bacteria 3216
363 Ga0400488_34617 3300038741 Bacteria 7733
364 Ga0400488_51923 3300038741 Bacteria 2633
365 Ga0400488_58354 3300038741 Bacteria 6529
366 Ga0400486_13908 3300038742 Bacteria 10087
367 Ga0400486_18851 3300038742 Bacteria 47783
368 Ga0400486_19627 3300038742 Bacteria 369894
369 Ga0400483_006887 3300039062 Bacteria 8465
370 Ga0400483_017590 3300039062 Bacteria 18725
371 Ga0400483_029154 3300039062 Bacteria 20593
372 Ga0400483_091069 3300039062 Bacteria 8983
373 Ga0400483_094064 3300039062 Bacteria 15100
374 Ga0400483_153804 3300039062 Bacteria 17790
375 Ga0400487_01437 3300039110 Bacteria 4901
376 Ga0400487_17307 3300039110 Bacteria 1684
377 Ga0400487_25945 3300039110 Bacteria 95730
378 Ga0400487_31693 3300039110 Bacteria 3727
379 Ga0400487_45565 3300039110 Bacteria 12177
380 Ga0400487_51369 3300039110 Bacteria 98129
381 Ga0400487_61225 3300039110 Bacteria 55886
382 Ga0400487_61452 3300039110 Bacteria 3907
383 Ga0451789_0234135 3300041443 Bacteria 3391
384 Ga0451798_0481630 3300041458 Bacteria 2282
385 Ga0451807_2705572 3300041486 Bacteria 1716
386 Ga0451853_1407983 3300041512 Bacteria 1841
387 Ga0450923_000107 3300042125 Bacteria 6979
388 Ga0439446_0001798 3300042156 Bacteria 5002
389 Ga0439434_0000995 3300042435 Bacteria 8182
390 Ga0439444_0000199 3300042437 Bacteria 5670
391 Ga0453684_0002496 3300044712 Bacteria 44445
392 Ga0453684_0003828 3300044712 Bacteria 33189
393 Ga0495590_0001964 3300046457 Bacteria 8674
394 Ga0495605_0008720 3300046474 Bacteria 5723
395 Ga0495639_0039275 3300046475 Bacteria 2128
396 Ga0495616_0000449 3300046513 Bacteria 31380
397 Ga0495616_0003844 3300046513 Bacteria 9572
398 Ga0495609_0000524 3300046538 Bacteria 30733
399 Ga0495625_0036079 3300046660 Bacteria 3638
400 Ga0495661_0056454 3300046665 Bacteria 2349
401 Ga0495658_0056001 3300046683 Bacteria 2248
402 Ga0495658_0059435 3300046683 Bacteria 2189
403 Ga0496104_0126422 3300048907 Bacteria 2455
404 Ga0496109_0168548 3300048912 Bacteria 2054
405 Ga0496114_0049628 3300048917 Bacteria 3492
406 Ga0496121_0021478 3300048924 Bacteria 6319
407 Ga0501032_0002393 3300049569 Bacteria 14623
408 Ga0501033_0007037 3300049570 Bacteria 8788
409 Ga0501033_0046689 3300049570 Bacteria 3220
410 Ga0501034_0000911 3300049571 Bacteria 43146
411 Ga0501034_0012744 3300049571 Bacteria 8672
412 Ga0501037_0003077 3300049573 Bacteria 12091
413 Ga0501038_0001855 3300049574 Bacteria 19530
414 Ga0501038_0039793 3300049574 Bacteria 4112
415 Ga0501040_0002291 3300049576 Bacteria 12299
416 Ga0501040_0009012 3300049576 Bacteria 6490
417 Ga0501041_0062739 3300049577 Bacteria 2276
418 Ga0501042_0000196 3300049578 Bacteria 28694
419 Ga0501042_0000995 3300049578 Bacteria 16076
420 Ga0501043_0008325 3300049579 Bacteria 8164
421 Ga0501046_0159485 3300049580 Bacteria 1697
422 Ga0501047_0019503 3300049581 Bacteria 6505
423 Ga0501067_0012722 3300049583 Bacteria 4664
424 Ga0501068_0023164 3300049584 Bacteria 3637
425 Ga0501071_0000638 3300049587 Bacteria 18217
426 Ga0501071_0027031 3300049587 Bacteria 4034
427 Ga0501072_0057236 3300049588 Bacteria 3072
428 Ga0501072_0079217 3300049588 Bacteria 2602
429 Ga0501073_0001565 3300049589 Bacteria 16962
430 Ga0501073_0010989 3300049589 Bacteria 6621
431 Ga0501074_0005863 3300049590 Bacteria 8860
432 Ga0501075_0004371 3300049591 Bacteria 9560
433 Ga0501076_0030251 3300049592 Bacteria 4218
434 Ga0501076_0043607 3300049592 Bacteria 3535
435 Ga0501077_0000734 3300049593 Bacteria 19837
436 Ga0501079_0001419 3300049741 Bacteria 16907
437 Ga0501079_0002367 3300049741 Bacteria 13698
438 Ga0501079_0119609 3300049741 Bacteria 2048
439 Ga0501079_0121296 3300049741 Bacteria 2033
440 Ga0501080_0008026 3300049742 Bacteria 9564
441 Ga0501080_0008522 3300049742 Bacteria 9297
442 Ga0501080_0036169 3300049742 Bacteria 4610
443 Ga0501081_0007552 3300049743 Bacteria 7049
444 Ga0501081_0075244 3300049743 Bacteria 2357
445 Ga0501083_0025973 3300049744 Bacteria 4052
446 Ga0501035_0213874 3300049822 Bacteria 1649
447 Ga0501044_0002050 3300049823 Bacteria 23253
448 nmdc:mga09592_21866_c1 3300050508 Bacteria 5274
449 nmdc:mga0qj67_101014_c1 3300050509 Bacteria 2325
450 nmdc:mga08y16_101973_c1 3300050511 Bacteria 2988
451 nmdc:mga0n895_3558_c1 3300050512 Bacteria 12607
452 nmdc:mga0rr50_31449_c1 3300050513 Bacteria 3769
453 nmdc:mga0a205_300_c1 3300050515 Bacteria 32739
454 Ga0500637_0002422 3300053178 Bacteria 8298
455 Ga0501084_0015457 3300054114 Bacteria 6329
456 Ga0587062_001700 3300059639 Bacteria 1965
457 Ga0587067_001033 3300059640 Bacteria 2843
458 Ga0530510_0018723 3300061734 Bacteria 4911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059639 Ga0587062_001700 Ga0587062_001700_243_1427 392
2 3300041486 Ga0451807_2705572 Ga0451807_2705572_47_1333 410
3 3300049741 Ga0501079_0121296 Ga0501079_0121296_36_1283 411
4 3300048907 Ga0496104_0126422 Ga0496104_0126422_1105_2436 412
5 3300031691 Ga0316579_10014354 Ga0316579_100143542 436
6 3300031507 Ga0307509_10049795 Ga0307509_100497952 438
7 3300039110 Ga0400487_25945 Ga0400487_25945_76191_77642 440
8 3300032168 Ga0316593_10000287 Ga0316593_100002872 441
9 3300038726 Ga0400490_19738 Ga0400490_19738_2522_3898 441
10 3300031456 Ga0307513_10030332 Ga0307513_100303322 442
11 3300006846 Ga0075430_100053146 Ga0075430_1000531462 446
12 3300006847 Ga0075431_100005433 Ga0075431_1000054336 446
13 3300031727 Ga0316576_10004989 Ga0316576_100049895 446
14 3300033524 Ga0316592_1001545 Ga0316592_10015452 446
15 3300033528 Ga0316588_1006405 Ga0316588_10064052 446
16 3300033541 Ga0316596_1002839 Ga0316596_10028392 446
17 3300036712 Ga0316584_0006534 Ga0316584_0006534_4011_5453 446
18 3300050508 nmdc:mga09592_21866_c1 nmdc:mga09592_21866_c1_3806_5236 446
19 3300050509 nmdc:mga0qj67_101014_c1 nmdc:mga0qj67_101014_c1_716_2146 446
20 3300005548 Ga0070665_100001680 Ga0070665_10000168022 447
21 3300025933 Ga0207706_10071865 Ga0207706_100718652 447
22 3300028379 Ga0268266_10034774 Ga0268266_100347743 447
23 3300031824 Ga0307413_10026165 Ga0307413_100261652 448
24 3300036712 Ga0316584_0027051 Ga0316584_0027051_2756_4111 448
25 3300005456 Ga0070678_100134177 Ga0070678_1001341771 451
26 3300026121 Ga0207683_10196583 Ga0207683_101965831 451
27 3300031691 Ga0316579_10001631 Ga0316579_100016312 451
28 3300031733 Ga0316577_10001780 Ga0316577_100017804 451
29 3300032168 Ga0316593_10006369 Ga0316593_100063692 451
30 3300033524 Ga0316592_1000090 Ga0316592_10000902 451
31 3300033527 Ga0316586_1000057 Ga0316586_10000572 451
32 3300033541 Ga0316596_1000084 Ga0316596_10000844 451
33 3300033541 Ga0316596_1005222 Ga0316596_10052222 451
34 3300035398 Ga0316574_0037444 Ga0316574_0037444_1053_2498 451
35 3300036647 Ga0316582_0002481 Ga0316582_0002481_1950_3395 451
36 3300036712 Ga0316584_0013120 Ga0316584_0013120_2648_4093 451
37 3300037588 Ga0316581_0001305 Ga0316581_0001305_352_1797 451
38 3300049569 Ga0501032_0002393 Ga0501032_0002393_8812_10266 451
39 3300049574 Ga0501038_0001855 Ga0501038_0001855_9671_11122 451
40 3300049822 Ga0501035_0213874 Ga0501035_0213874_59_1510 451
41 3300031691 Ga0316579_10001095 Ga0316579_100010954 453
42 3300031728 Ga0316578_10048932 Ga0316578_100489322 453
43 3300032139 Ga0316580_10000923 Ga0316580_100009234 453
44 3300035398 Ga0316574_0020305 Ga0316574_0020305_1244_2686 453
45 3300036647 Ga0316582_0008775 Ga0316582_0008775_368_1810 453
46 3300036712 Ga0316584_0005309 Ga0316584_0005309_6730_8172 453
47 3300036712 Ga0316584_0147605 Ga0316584_0147605_308_1696 453
48 3300039110 Ga0400487_45565 Ga0400487_45565_9601_10989 453
49 3300041512 Ga0451853_1407983 Ga0451853_1407983_338_1741 453
50 3300031727 Ga0316576_10005366 Ga0316576_100053664 454
51 3300031728 Ga0316578_10016152 Ga0316578_100161523 454
52 3300032139 Ga0316580_10001800 Ga0316580_100018004 454
53 3300032168 Ga0316593_10003466 Ga0316593_100034662 454
54 3300035398 Ga0316574_0001423 Ga0316574_0001423_5320_6765 454
55 3300035398 Ga0316574_0009233 Ga0316574_0009233_4001_5443 454
56 3300036647 Ga0316582_0020650 Ga0316582_0020650_2371_3774 454
57 3300038725 Ga0400484_15756 Ga0400484_15756_1788_3239 454
58 3300039062 Ga0400483_029154 Ga0400483_029154_13446_14897 454
59 3300044712 Ga0453684_0002496 Ga0453684_0002496_35859_37235 454
60 3300031728 Ga0316578_10016304 Ga0316578_100163043 455
61 3300032168 Ga0316593_10002545 Ga0316593_100025452 455
62 3300033524 Ga0316592_1001253 Ga0316592_10012532 455
63 3300033527 Ga0316586_1001479 Ga0316586_10014792 455
64 3300033528 Ga0316588_1001193 Ga0316588_10011932 455
65 3300033541 Ga0316596_1001417 Ga0316596_10014173 455
66 3300035398 Ga0316574_0004147 Ga0316574_0004147_1031_2479 455
67 3300005293 Ga0065715_10005833 Ga0065715_100058331 456
68 3300005330 Ga0070690_100030083 Ga0070690_1000300831 456
69 3300005335 Ga0070666_10015953 Ga0070666_100159535 456
70 3300005347 Ga0070668_100131850 Ga0070668_1001318501 456
71 3300005355 Ga0070671_100004553 Ga0070671_10000455310 456
72 3300005356 Ga0070674_100033358 Ga0070674_1000333582 456
73 3300005367 Ga0070667_100180864 Ga0070667_1001808641 456
74 3300005441 Ga0070700_100017894 Ga0070700_1000178943 456
75 3300005456 Ga0070678_100077427 Ga0070678_1000774272 456
76 3300005459 Ga0068867_100094285 Ga0068867_1000942852 456
77 3300005564 Ga0070664_100194576 Ga0070664_1001945761 456
78 3300005615 Ga0070702_100009884 Ga0070702_1000098842 456
79 3300005844 Ga0068862_100051259 Ga0068862_1000512591 456
80 3300005937 Ga0081455_10002185 Ga0081455_1000218514 456
81 3300006237 Ga0097621_100044635 Ga0097621_1000446353 456
82 3300009094 Ga0111539_10111412 Ga0111539_101114124 456
83 3300009148 Ga0105243_10049931 Ga0105243_100499312 456
84 3300009176 Ga0105242_10026861 Ga0105242_100268612 456
85 3300011119 Ga0105246_10110278 Ga0105246_101102782 456
86 3300014326 Ga0157380_10012567 Ga0157380_100125672 456
87 3300025315 Ga0207697_10006349 Ga0207697_100063494 456
88 3300025893 Ga0207682_10004713 Ga0207682_100047132 456
89 3300025901 Ga0207688_10006786 Ga0207688_100067864 456
90 3300025907 Ga0207645_10036188 Ga0207645_100361881 456
91 3300025908 Ga0207643_10014319 Ga0207643_100143193 456
92 3300025923 Ga0207681_10128972 Ga0207681_101289722 456
93 3300025925 Ga0207650_10003030 Ga0207650_100030305 456
94 3300025933 Ga0207706_10030356 Ga0207706_100303564 456
95 3300025960 Ga0207651_10033860 Ga0207651_100338602 456
96 3300026075 Ga0207708_10026639 Ga0207708_100266393 456
97 3300026089 Ga0207648_10094319 Ga0207648_100943192 456
98 3300026116 Ga0207674_10187756 Ga0207674_101877562 456
99 3300026118 Ga0207675_100061202 Ga0207675_1000612022 456
100 3300026118 Ga0207675_100178560 Ga0207675_1001785602 456
101 3300028379 Ga0268266_10057506 Ga0268266_100575062 456
102 3300028577 Ga0265318_10004875 Ga0265318_100048754 456
103 3300031235 Ga0265330_10019467 Ga0265330_100194671 456
104 3300031238 Ga0265332_10006309 Ga0265332_100063095 456
105 3300031250 Ga0265331_10006789 Ga0265331_100067892 456
106 3300031344 Ga0265316_10036476 Ga0265316_100364763 456
107 3300031595 Ga0265313_10039574 Ga0265313_100395742 456
108 3300031711 Ga0265314_10001689 Ga0265314_1000168911 456
109 3300031712 Ga0265342_10007072 Ga0265342_100070722 456
110 3300038742 Ga0400486_18851 Ga0400486_18851_9739_11190 456
111 3300039110 Ga0400487_31693 Ga0400487_31693_1254_2705 456
112 3300046683 Ga0495658_0056001 Ga0495658_0056001_440_1867 456
113 3300048912 Ga0496109_0168548 Ga0496109_0168548_127_1554 456
114 3300005333 Ga0070677_10015139 Ga0070677_100151392 457
115 3300005347 Ga0070668_100082684 Ga0070668_1000826841 457
116 3300005354 Ga0070675_100014226 Ga0070675_1000142264 457
117 3300005354 Ga0070675_100015779 Ga0070675_1000157796 457
118 3300005356 Ga0070674_100066690 Ga0070674_1000666902 457
119 3300005364 Ga0070673_100024694 Ga0070673_1000246942 457
120 3300005365 Ga0070688_100039766 Ga0070688_1000397662 457
121 3300005456 Ga0070678_100044264 Ga0070678_1000442642 457
122 3300005543 Ga0070672_100004654 Ga0070672_1000046545 457
123 3300005543 Ga0070672_100034372 Ga0070672_1000343724 457
124 3300005840 Ga0068870_10021806 Ga0068870_100218062 457
125 3300005840 Ga0068870_10043081 Ga0068870_100430813 457
126 3300005841 Ga0068863_100073204 Ga0068863_1000732043 457
127 3300005841 Ga0068863_100084104 Ga0068863_1000841043 457
128 3300006358 Ga0068871_100023593 Ga0068871_1000235934 457
129 3300009094 Ga0111539_10181058 Ga0111539_101810582 457
130 3300013296 Ga0157374_10001794 Ga0157374_1000179413 457
131 3300013306 Ga0163162_10041360 Ga0163162_100413602 457
132 3300013308 Ga0157375_10335461 Ga0157375_103354612 457
133 3300014969 Ga0157376_10082474 Ga0157376_100824741 457
134 3300017792 Ga0163161_10065806 Ga0163161_100658061 457
135 3300025893 Ga0207682_10002225 Ga0207682_100022257 457
136 3300025893 Ga0207682_10004380 Ga0207682_100043802 457
137 3300025908 Ga0207643_10044173 Ga0207643_100441732 457
138 3300025940 Ga0207691_10002911 Ga0207691_1000291114 457
139 3300025940 Ga0207691_10050259 Ga0207691_100502592 457
140 3300026089 Ga0207648_10151830 Ga0207648_101518302 457
141 3300026121 Ga0207683_10018053 Ga0207683_100180534 457
142 3300026121 Ga0207683_10026616 Ga0207683_100266165 457
143 3300028380 Ga0268265_10046663 Ga0268265_100466633 457
144 3300028794 Ga0307515_10096763 Ga0307515_100967632 457
145 3300041443 Ga0451789_0234135 Ga0451789_0234135_1489_2937 457
146 3300041458 Ga0451798_0481630 Ga0451798_0481630_448_1896 457
147 3300046660 Ga0495625_0036079 Ga0495625_0036079_536_1984 457
148 3300005337 Ga0070682_100030633 Ga0070682_1000306332 458
149 3300005337 Ga0070682_100045104 Ga0070682_1000451042 458
150 3300014326 Ga0157380_10006003 Ga0157380_100060034 458
151 3300031727 Ga0316576_10075685 Ga0316576_100756852 458
152 3300033527 Ga0316586_1002195 Ga0316586_10021952 458
153 3300033528 Ga0316588_1002468 Ga0316588_10024682 458
154 3300033541 Ga0316596_1007420 Ga0316596_10074202 458
155 3300046457 Ga0495590_0001964 Ga0495590_0001964_5510_6958 458
156 3300046513 Ga0495616_0000449 Ga0495616_0000449_10130_11563 458
157 3300049577 Ga0501041_0062739 Ga0501041_0062739_76_1524 458
158 3300005441 Ga0070700_100083440 Ga0070700_1000834402 459
159 3300031852 Ga0307410_10011816 Ga0307410_100118163 459
160 3300031995 Ga0307409_100023083 Ga0307409_1000230834 459
161 3300032168 Ga0316593_10008434 Ga0316593_100084342 459
162 3300048917 Ga0496114_0049628 Ga0496114_0049628_1504_2937 461
163 3300032168 Ga0316593_10008457 Ga0316593_100084572 463
164 3300036647 Ga0316582_0015263 Ga0316582_0015263_2336_3778 463
165 3300049583 Ga0501067_0012722 Ga0501067_0012722_515_1948 463
166 3300049584 Ga0501068_0023164 Ga0501068_0023164_1404_2837 463
167 3300049587 Ga0501071_0027031 Ga0501071_0027031_1871_3304 463
168 3300049588 Ga0501072_0057236 Ga0501072_0057236_607_2040 463
169 3300049589 Ga0501073_0010989 Ga0501073_0010989_521_1954 463
170 3300049590 Ga0501074_0005863 Ga0501074_0005863_495_1928 463
171 3300049592 Ga0501076_0030251 Ga0501076_0030251_472_1905 463
172 3300049593 Ga0501077_0000734 Ga0501077_0000734_730_2163 463
173 3300049741 Ga0501079_0002367 Ga0501079_0002367_2704_4137 463
174 3300049742 Ga0501080_0008522 Ga0501080_0008522_6372_7805 463
175 3300049742 Ga0501080_0036169 Ga0501080_0036169_2249_3697 463
176 3300049743 Ga0501081_0075244 Ga0501081_0075244_338_1771 463
177 3300054114 Ga0501084_0015457 Ga0501084_0015457_634_2067 463
178 3300046475 Ga0495639_0039275 Ga0495639_0039275_10_1458 464
179 3300046683 Ga0495658_0059435 Ga0495658_0059435_315_1763 464
180 3300038741 Ga0400488_34617 Ga0400488_34617_2229_3680 465
181 3300035398 Ga0316574_0006201 Ga0316574_0006201_3439_4884 466
182 3300036647 Ga0316582_0011271 Ga0316582_0011271_1546_2967 466
183 3300037588 Ga0316581_0006329 Ga0316581_0006329_889_2310 466
184 iso_pu_bacteria 8001522603 8001524950 469
185 3300032168 Ga0316593_10016761 Ga0316593_100167612 470
186 3300033541 Ga0316596_1005010 Ga0316596_10050103 470
187 3300053178 Ga0500637_0002422 Ga0500637_0002422_1146_2576 470
188 3300031691 Ga0316579_10000037 Ga0316579_100000378 471
189 3300031691 Ga0316579_10009383 Ga0316579_100093832 471
190 3300031727 Ga0316576_10000271 Ga0316576_100002716 471
191 3300031727 Ga0316576_10002749 Ga0316576_100027496 471
192 3300031727 Ga0316576_10058897 Ga0316576_100588972 471
193 3300031728 Ga0316578_10000044 Ga0316578_100000445 471
194 3300031728 Ga0316578_10026597 Ga0316578_100265972 471
195 3300031733 Ga0316577_10000086 Ga0316577_100000868 471
196 3300031733 Ga0316577_10010275 Ga0316577_100102754 471
197 3300031733 Ga0316577_10016565 Ga0316577_100165652 471
198 3300032137 Ga0316585_10000011 Ga0316585_1000001120 471
199 3300032137 Ga0316585_10018434 Ga0316585_100184342 471
200 3300032139 Ga0316580_10000021 Ga0316580_100000217 471
201 3300032139 Ga0316580_10007371 Ga0316580_100073713 471
202 3300032168 Ga0316593_10012842 Ga0316593_100128422 471
203 3300032168 Ga0316593_10018626 Ga0316593_100186261 471
204 3300033524 Ga0316592_1001438 Ga0316592_10014382 471
205 3300033524 Ga0316592_1003262 Ga0316592_10032622 471
206 3300033527 Ga0316586_1000096 Ga0316586_10000964 471
207 3300033528 Ga0316588_1000974 Ga0316588_10009742 471
208 3300033529 Ga0316587_1006800 Ga0316587_10068002 471
209 3300033541 Ga0316596_1000941 Ga0316596_10009414 471
210 3300033541 Ga0316596_1002239 Ga0316596_10022392 471
211 3300033541 Ga0316596_1007337 Ga0316596_10073372 471
212 3300033541 Ga0316596_1018847 Ga0316596_10188471 471
213 3300035398 Ga0316574_0000004 Ga0316574_0000004_23260_24708 471
214 3300035398 Ga0316574_0004741 Ga0316574_0004741_1763_3205 471
215 3300035398 Ga0316574_0027039 Ga0316574_0027039_129_1556 471
216 3300036647 Ga0316582_0000710 Ga0316582_0000710_7154_8602 471
217 3300036712 Ga0316584_0000070 Ga0316584_0000070_24931_26379 471
218 3300036712 Ga0316584_0000765 Ga0316584_0000765_14036_15478 471
219 3300036712 Ga0316584_0011636 Ga0316584_0011636_3465_4913 471
220 3300036712 Ga0316584_0011672 Ga0316584_0011672_4366_5808 471
221 3300044712 Ga0453684_0003828 Ga0453684_0003828_19659_21089 471
222 3300031250 Ga0265331_10004021 Ga0265331_100040216 472
223 3300031251 Ga0265327_10000923 Ga0265327_1000092322 472
224 3300032133 Ga0316583_10005905 Ga0316583_100059053 472
225 3300032137 Ga0316585_10001737 Ga0316585_100017371 472
226 3300032168 Ga0316593_10005546 Ga0316593_100055462 472
227 3300033541 Ga0316596_1002509 Ga0316596_10025092 472
228 3300033541 Ga0316596_1004058 Ga0316596_10040582 472
229 3300036647 Ga0316582_0000925 Ga0316582_0000925_10575_12035 472
230 3300036712 Ga0316584_0002072 Ga0316584_0002072_1042_2502 472
231 3300049570 Ga0501033_0007037 Ga0501033_0007037_1896_3323 472
232 3300049571 Ga0501034_0012744 Ga0501034_0012744_5286_6713 472
233 3300049573 Ga0501037_0003077 Ga0501037_0003077_7138_8565 472
234 3300049574 Ga0501038_0039793 Ga0501038_0039793_688_2115 472
235 3300049579 Ga0501043_0008325 Ga0501043_0008325_4122_5549 472
236 3300049581 Ga0501047_0019503 Ga0501047_0019503_3078_4505 472
237 3300049589 Ga0501073_0001565 Ga0501073_0001565_5584_7011 472
238 3300049741 Ga0501079_0119609 Ga0501079_0119609_513_1940 472
239 3300049744 Ga0501083_0025973 Ga0501083_0025973_1286_2713 472
240 3300049823 Ga0501044_0002050 Ga0501044_0002050_2538_3965 472
241 3300005340 Ga0070689_100003069 Ga0070689_1000030692 473
242 3300005353 Ga0070669_100147963 Ga0070669_1001479631 473
243 3300006237 Ga0097621_100053638 Ga0097621_1000536384 473
244 3300006358 Ga0068871_100005565 Ga0068871_1000055655 473
245 3300006852 Ga0075433_10000655 Ga0075433_1000065511 473
246 3300006871 Ga0075434_100002324 Ga0075434_1000023249 473
247 3300007076 Ga0075435_100037901 Ga0075435_1000379012 473
248 3300009094 Ga0111539_10150656 Ga0111539_101506562 473
249 3300009094 Ga0111539_10407553 Ga0111539_104075531 473
250 3300009147 Ga0114129_10186956 Ga0114129_101869562 473
251 3300013307 Ga0157372_10040109 Ga0157372_100401093 473
252 3300014326 Ga0157380_10004861 Ga0157380_100048612 473
253 3300025940 Ga0207691_10160051 Ga0207691_101600512 473
254 3300026118 Ga0207675_100004010 Ga0207675_1000040104 473
255 3300027907 Ga0207428_10071265 Ga0207428_100712652 473
256 3300031239 Ga0265328_10000034 Ga0265328_1000003427 473
257 3300031250 Ga0265331_10000024 Ga0265331_1000002481 473
258 3300031250 Ga0265331_10003750 Ga0265331_100037503 473
259 3300031251 Ga0265327_10000079 Ga0265327_10000079163 473
260 3300031251 Ga0265327_10001605 Ga0265327_1000160510 473
261 3300031251 Ga0265327_10001709 Ga0265327_100017093 473
262 3300031251 Ga0265327_10005432 Ga0265327_100054327 473
263 3300031548 Ga0307408_100035214 Ga0307408_1000352142 473
264 3300031548 Ga0307408_100071472 Ga0307408_1000714722 473
265 3300031691 Ga0316579_10039399 Ga0316579_100393992 473
266 3300031727 Ga0316576_10001673 Ga0316576_100016736 473
267 3300031727 Ga0316576_10041426 Ga0316576_100414262 473
268 3300031727 Ga0316576_10089262 Ga0316576_100892622 473
269 3300031728 Ga0316578_10023155 Ga0316578_100231552 473
270 3300031728 Ga0316578_10048150 Ga0316578_100481502 473
271 3300031733 Ga0316577_10026866 Ga0316577_100268662 473
272 3300031733 Ga0316577_10031171 Ga0316577_100311712 473
273 3300031852 Ga0307410_10006125 Ga0307410_100061253 473
274 3300031901 Ga0307406_10163669 Ga0307406_101636691 473
275 3300031995 Ga0307409_100108655 Ga0307409_1001086551 473
276 3300032002 Ga0307416_100007763 Ga0307416_1000077634 473
277 3300032002 Ga0307416_100052331 Ga0307416_1000523312 473
278 3300032005 Ga0307411_10004256 Ga0307411_100042564 473
279 3300032126 Ga0307415_100017302 Ga0307415_1000173022 473
280 3300032133 Ga0316583_10002267 Ga0316583_100022674 473
281 3300032133 Ga0316583_10004196 Ga0316583_100041962 473
282 3300032133 Ga0316583_10008186 Ga0316583_100081862 473
283 3300032137 Ga0316585_10009971 Ga0316585_100099712 473
284 3300032139 Ga0316580_10000411 Ga0316580_100004115 473
285 3300032168 Ga0316593_10000744 Ga0316593_100007446 473
286 3300032168 Ga0316593_10001012 Ga0316593_100010122 473
287 3300032168 Ga0316593_10002542 Ga0316593_100025422 473
288 3300032168 Ga0316593_10002732 Ga0316593_100027322 473
289 3300032168 Ga0316593_10003846 Ga0316593_100038462 473
290 3300033524 Ga0316592_1001269 Ga0316592_10012692 473
291 3300033524 Ga0316592_1001753 Ga0316592_10017532 473
292 3300033527 Ga0316586_1004445 Ga0316586_10044451 473
293 3300033528 Ga0316588_1005743 Ga0316588_10057432 473
294 3300033528 Ga0316588_1006570 Ga0316588_10065702 473
295 3300033541 Ga0316596_1000583 Ga0316596_10005836 473
296 3300033541 Ga0316596_1000963 Ga0316596_10009632 473
297 3300033541 Ga0316596_1002696 Ga0316596_10026962 473
298 3300033541 Ga0316596_1008288 Ga0316596_10082882 473
299 3300033541 Ga0316596_1015278 Ga0316596_10152781 473
300 3300035092 Ga0373952_0010275 Ga0373952_0010275_262_1695 473
301 3300035398 Ga0316574_0001150 Ga0316574_0001150_844_2286 473
302 3300035398 Ga0316574_0004460 Ga0316574_0004460_4582_6027 473
303 3300035398 Ga0316574_0011479 Ga0316574_0011479_2272_3720 473
304 3300035398 Ga0316574_0028277 Ga0316574_0028277_1698_3143 473
305 3300035398 Ga0316574_0073835 Ga0316574_0073835_240_1676 473
306 3300036647 Ga0316582_0006733 Ga0316582_0006733_3021_4502 473
307 3300036647 Ga0316582_0017423 Ga0316582_0017423_2368_3816 473
308 3300036647 Ga0316582_0017532 Ga0316582_0017532_1307_2764 473
309 3300036647 Ga0316582_0026651 Ga0316582_0026651_1118_2563 473
310 3300036647 Ga0316582_0068887 Ga0316582_0068887_493_1932 473
311 3300036712 Ga0316584_0004595 Ga0316584_0004595_1307_2764 473
312 3300036712 Ga0316584_0013136 Ga0316584_0013136_1054_2502 473
313 3300036712 Ga0316584_0030679 Ga0316584_0030679_2326_3807 473
314 3300036712 Ga0316584_0046749 Ga0316584_0046749_1077_2510 473
315 3300036712 Ga0316584_0051782 Ga0316584_0051782_1051_2496 473
316 3300036712 Ga0316584_0053203 Ga0316584_0053203_586_2034 473
317 3300036712 Ga0316584_0105258 Ga0316584_0105258_20_1465 473
318 3300037588 Ga0316581_0002713 Ga0316581_0002713_681_2162 473
319 3300037588 Ga0316581_0005687 Ga0316581_0005687_140_1624 473
320 3300038725 Ga0400484_23801 Ga0400484_23801_1341_2813 473
321 3300038725 Ga0400484_26404 Ga0400484_26404_4784_6235 473
322 3300038726 Ga0400490_00822 Ga0400490_00822_13379_14830 473
323 3300038726 Ga0400490_15107 Ga0400490_15107_63765_65222 473
324 3300038726 Ga0400490_27043 Ga0400490_27043_9647_11089 473
325 3300038726 Ga0400490_32012 Ga0400490_32012_1162_2616 473
326 3300038727 Ga0400491_18213 Ga0400491_18213_2211_3653 473
327 3300038735 Ga0400485_10051 Ga0400485_10051_56872_58323 473
328 3300038741 Ga0400488_32695 Ga0400488_32695_903_2354 473
329 3300038741 Ga0400488_51923 Ga0400488_51923_266_1723 473
330 3300038741 Ga0400488_58354 Ga0400488_58354_971_2500 473
331 3300038742 Ga0400486_13908 Ga0400486_13908_7238_8689 473
332 3300038742 Ga0400486_19627 Ga0400486_19627_139143_140594 473
333 3300039062 Ga0400483_006887 Ga0400483_006887_6494_7945 473
334 3300039062 Ga0400483_017590 Ga0400483_017590_7999_9528 473
335 3300039062 Ga0400483_091069 Ga0400483_091069_5294_6745 473
336 3300039062 Ga0400483_094064 Ga0400483_094064_8676_10127 473
337 3300039062 Ga0400483_153804 Ga0400483_153804_15844_17295 473
338 3300039110 Ga0400487_01437 Ga0400487_01437_2433_3884 473
339 3300039110 Ga0400487_17307 Ga0400487_17307_97_1539 473
340 3300039110 Ga0400487_51369 Ga0400487_51369_29688_31139 473
341 3300039110 Ga0400487_61225 Ga0400487_61225_14630_16081 473
342 3300039110 Ga0400487_61452 Ga0400487_61452_2078_3541 473
343 3300042125 Ga0450923_000107 Ga0450923_000107_5246_6682 473
344 3300042156 Ga0439446_0001798 Ga0439446_0001798_3052_4485 473
345 3300042435 Ga0439434_0000995 Ga0439434_0000995_4317_5750 473
346 3300042437 Ga0439444_0000199 Ga0439444_0000199_1170_2603 473
347 3300049576 Ga0501040_0002291 Ga0501040_0002291_6503_7963 473
348 3300049576 Ga0501040_0009012 Ga0501040_0009012_3789_5222 473
349 3300049578 Ga0501042_0000196 Ga0501042_0000196_22910_24370 473
350 3300049578 Ga0501042_0000995 Ga0501042_0000995_4028_5461 473
351 3300049580 Ga0501046_0159485 Ga0501046_0159485_67_1500 473
352 3300049588 Ga0501072_0079217 Ga0501072_0079217_55_1488 473
353 3300049591 Ga0501075_0004371 Ga0501075_0004371_4969_6402 473
354 3300049592 Ga0501076_0043607 Ga0501076_0043607_1015_2448 473
355 3300049741 Ga0501079_0001419 Ga0501079_0001419_4850_6283 473
356 3300049742 Ga0501080_0008026 Ga0501080_0008026_4862_6295 473
357 3300049743 Ga0501081_0007552 Ga0501081_0007552_3598_5031 473
358 3300050511 nmdc:mga08y16_101973_c1 nmdc:mga08y16_101973_c1_753_2210 473
359 3300050512 nmdc:mga0n895_3558_c1 nmdc:mga0n895_3558_c1_5921_7360 473
360 3300050513 nmdc:mga0rr50_31449_c1 nmdc:mga0rr50_31449_c1_451_1890 473
361 3300050515 nmdc:mga0a205_300_c1 nmdc:mga0a205_300_c1_21585_23024 473
362 3300061734 Ga0530510_0018723 Ga0530510_0018723_1907_3340 473
363 iso_pu_bacteria 2513237150 2513954064 474
364 iso_pu_bacteria 2513237165 2514040191 474
365 iso_pu_bacteria 2834641062 2834645386 474
366 iso_pu_bacteria 644736347 644746853 474
367 iso_pu_bacteria 8003400568 8003400596 474
368 3300031251 Ga0265327_10000734 Ga0265327_1000073439 475
369 3300031251 Ga0265327_10007065 Ga0265327_100070657 475
370 3300031344 Ga0265316_10001175 Ga0265316_100011758 475
371 3300031665 Ga0316575_10001740 Ga0316575_100017406 475
372 3300035398 Ga0316574_0000986 Ga0316574_0000986_8908_10347 475
373 3300049570 Ga0501033_0046689 Ga0501033_0046689_178_1647 475
374 3300049587 Ga0501071_0000638 Ga0501071_0000638_8495_9934 475
375 iso_pu_bacteria 2596583598 2597030306 475
376 iso_pu_bacteria 2599185178 2599446934 475
377 iso_pu_bacteria 2885266251 2885267888 475
378 iso_pu_bacteria 2900577576 2900579239 475
379 iso_pu_bacteria 2928058823 2928061368 475
380 3300006948 Ga0099826_10000014 Ga0099826_1000001464 478
381 3300025294 Ga0209025_1000554 Ga0209025_10005542 478
382 3300027666 Ga0209282_1000046 Ga0209282_100004639 478
383 3300046474 Ga0495605_0008720 Ga0495605_0008720_2634_4070 478
384 3300046513 Ga0495616_0003844 Ga0495616_0003844_1937_3373 478
385 3300046538 Ga0495609_0000524 Ga0495609_0000524_12219_13655 478
386 3300046665 Ga0495661_0056454 Ga0495661_0056454_600_2036 478
387 3300048924 Ga0496121_0021478 Ga0496121_0021478_451_1887 478
388 3300049571 Ga0501034_0000911 Ga0501034_0000911_22132_23568 478
389 3300001915 JGI24741J21665_1001552 JGI24741J21665_10015525 479
390 3300002705 JGI25156J39149_1002320 JGI25156J39149_10023203 479
391 3300002738 JGI25154J39366_1000592 JGI25154J39366_100059215 479
392 3300003578 Ga0006562J51391_1055797 Ga0006562J51391_10557975 479
393 3300003751 Ga0055538_1001890 Ga0055538_10018902 479
394 3300003752 Ga0055539_1000220 Ga0055539_100022019 479
395 3300003756 Ga0055533_1006356 Ga0055533_10063561 479
396 3300003758 Ga0055532_1000006 Ga0055532_100000643 479
397 3300003759 Ga0055525_1000427 Ga0055525_100042719 479
398 3300003761 Ga0055535_1000004 Ga0055535_100000443 479
399 3300003762 Ga0055542_1000407 Ga0055542_100040720 479
400 3300003763 Ga0055529_1000022 Ga0055529_1000022278 479
401 3300003771 Ga0055526_1003944 Ga0055526_10039444 479
402 3300003775 Ga0055524_1000389 Ga0055524_10003897 479
403 3300003775 Ga0055524_1006716 Ga0055524_10067162 479
404 3300003781 Ga0055536_1000364 Ga0055536_100036423 479
405 3300003841 Ga0055541_1000949 Ga0055541_10009493 479
406 3300005344 Ga0070661_100000123 Ga0070661_10000012319 479
407 3300005366 Ga0070659_100002250 Ga0070659_1000022502 479
408 3300005455 Ga0070663_100000020 Ga0070663_10000002083 479
409 3300005564 Ga0070664_100000003 Ga0070664_100000003280 479
410 3300005577 Ga0068857_100006996 Ga0068857_1000069966 479
411 3300005578 Ga0068854_100000100 Ga0068854_10000010040 479
412 3300005614 Ga0068856_100000011 Ga0068856_10000001146 479
413 3300009093 Ga0105240_10139074 Ga0105240_101390742 479
414 3300013100 Ga0157373_10010706 Ga0157373_100107064 479
415 3300013102 Ga0157371_10000083 Ga0157371_1000008345 479
416 3300013104 Ga0157370_10000302 Ga0157370_1000030244 479
417 3300013105 Ga0157369_10003136 Ga0157369_1000313618 479
418 3300013307 Ga0157372_10000577 Ga0157372_1000057735 479
419 3300015261 Ga0182006_1000657 Ga0182006_10006572 479
420 3300020069 Ga0197907_11217678 Ga0197907_112176782 479
421 3300020077 Ga0206351_10055363 Ga0206351_100553637 479
422 3300020080 Ga0206350_10943148 Ga0206350_109431482 479
423 3300020610 Ga0154015_1096764 Ga0154015_109676417 479
424 3300025224 Ga0209784_100195 Ga0209784_10019529 479
425 3300025225 Ga0209566_100002 Ga0209566_1000021028 479
426 3300025225 Ga0209566_100477 Ga0209566_1004775 479
427 3300025225 Ga0209566_101307 Ga0209566_1013073 479
428 3300025226 Ga0209674_100010 Ga0209674_100010110 479
429 3300025226 Ga0209674_100050 Ga0209674_10005045 479
430 3300025226 Ga0209674_100205 Ga0209674_10020556 479
431 3300025228 Ga0209672_100123 Ga0209672_10012337 479
432 3300025228 Ga0209672_100313 Ga0209672_1003138 479
433 3300025229 Ga0209147_100015 Ga0209147_100015500 479
434 3300025230 Ga0209563_100004 Ga0209563_100004439 479
435 3300025230 Ga0209563_100026 Ga0209563_100026310 479
436 3300025242 Ga0209258_100021 Ga0209258_100021500 479
437 3300025246 Ga0209646_1000075 Ga0209646_1000075163 479
438 3300025250 Ga0209026_1004195 Ga0209026_10041952 479
439 3300025250 Ga0209026_1008945 Ga0209026_10089452 479
440 3300025253 Ga0209677_100013 Ga0209677_10001362 479
441 3300025253 Ga0209677_103654 Ga0209677_1036542 479
442 3300025254 Ga0209148_1000043 Ga0209148_100004333 479
443 3300025254 Ga0209148_1003927 Ga0209148_10039273 479
444 3300025256 Ga0209759_1003087 Ga0209759_10030873 479
445 3300025256 Ga0209759_1008279 Ga0209759_10082792 479
446 3300025263 Ga0209565_1000045 Ga0209565_1000045181 479
447 3300025272 Ga0209455_1000028 Ga0209455_1000028500 479
448 3300025273 Ga0209673_1007510 Ga0209673_10075101 479
449 3300025291 Ga0209675_1000173 Ga0209675_100017335 479
450 3300025291 Ga0209675_1000636 Ga0209675_100063617 479
451 3300025291 Ga0209675_1012687 Ga0209675_10126872 479
452 3300025292 Ga0209676_1000064 Ga0209676_1000064119 479
453 3300025294 Ga0209025_1001692 Ga0209025_100169222 479
454 3300025294 Ga0209025_1004115 Ga0209025_10041153 479
455 3300025295 Ga0209564_1000107 Ga0209564_1000107163 479
456 3300025295 Ga0209564_1000371 Ga0209564_100037125 479
457 3300025295 Ga0209564_1000741 Ga0209564_10007416 479
458 3300025299 Ga0209256_1000105 Ga0209256_1000105150 479
459 3300025299 Ga0209256_1000340 Ga0209256_100034054 479
460 3300025920 Ga0207649_10002331 Ga0207649_100023312 479
461 3300025932 Ga0207690_10001166 Ga0207690_1000116614 479
462 3300025945 Ga0207679_10000083 Ga0207679_1000008318 479
463 3300025981 Ga0207640_10000111 Ga0207640_1000011127 479
464 3300026067 Ga0207678_10000030 Ga0207678_1000003083 479
465 3300026078 Ga0207702_10000054 Ga0207702_10000054117 479
466 3300026116 Ga0207674_10004613 Ga0207674_100046135 479
467 3300037418 Ga0395900_0002002 Ga0395900_0002002_16660_18099 479
468 3300037471 Ga0395905_0108108 Ga0395905_0108108_41_1480 479
469 3300059640 Ga0587067_001033 Ga0587067_001033_233_1684 479

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00224

PK

Pyruvate kinase, barrel domain

28

351

0.98

PF02887

PK_C

Pyruvate kinase, alpha/beta domain

383

497

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k0k-assembly1.cif.gz_B crystal structure of escherichia coli pyruvate kinase ii 0.9605 2 476
3eoe-assembly1.cif.gz_C crystal structure of pyruvate kinase from toxoplasma gondii, 55.m00007 0.9577 3 476
3eoe-assembly1.cif.gz_A crystal structure of pyruvate kinase from toxoplasma gondii, 55.m00007 0.9569 3 476
3eoe-assembly1.cif.gz_B crystal structure of pyruvate kinase from toxoplasma gondii, 55.m00007 0.9559 3 476
7z4r-assembly1.cif.gz_A plasmodium falciparum pyruvate kinase mutant - c343a 0.9548 3 476
ID Description Score Start End Superfamily
af_A0A0R0KTV1_6_81_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9953 259 332 3.20.20.60
af_A4IAQ0_28_95_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9835 3 67 3.20.20.60
4ks0B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.981 3 338 3.20.20.60
5wrpA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9777 3 338 3.20.20.60
af_Q93Z53_101_425_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9744 5 334 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A349LNB5-F1-model_v4 Pyruvate kinase (EC 2.7.1.40) 0.9937 59 212 GO:0000287
GO:0004743
GO:0005524
GO:0016301
GO:0030955
AF-A0A481XTN8-F1-model_v4 Pyruvate kinase (EC 2.7.1.40) 0.9937 243 343 GO:0000287
GO:0004743
GO:0005524
GO:0016301
GO:0030955
AF-A0A519IFQ0-F1-model_v4 deleted 0.9916 1 217
AF-A0A258QRV6-F1-model_v4 Pyruvate kinase (EC 2.7.1.40) 0.991 1 373 GO:0000287
GO:0004743
GO:0005524
GO:0016301
GO:0030955
AF-A0A7S2YIU0-F1-model_v4 Pyruvate kinase (EC 2.7.1.40) 0.9905 220 325 GO:0000287
GO:0004743
GO:0005524
GO:0016301
GO:0030955

Feature Viewer

pLDDT pTM Quality
93.32 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map