metagRoot

F450238

General Info

Members	Datasets	Scaffolds	Average Seq Length
469	260	464	248

Family's Representative Sequence

Representative Sequence	3300013296\|Ga0157374_10444112\|Ga0157374_104441122
Length	294
Sequence	MTISPVGGGYGLLRCVVKDAVPVVPVEAGGARACDMLETGKKRSESVNKLDLEGRSAVVTGGAAGIGLAVAQRLAHSGATVTLWDRDARALAEAAQHITGNPHVETVDVSRHEDVHRAVASTLQKASRIDILVCSAGISGPNTSTWDYPVEAWRQVIDVNLTGVFLCNKHVVPHMRQNDYGRIVNIASIAGKEGNPNAVAYSASKAGVISITKSLGKELAKTGIRVNCVTPAAVRTAIFEQMTQQHIDFMLSKIPMARFGQVEEVAAMVAWLCTEECSFSTGAVFDLSGGRAVY

Samples

	Sample ID	Description	Type	Environment
1	2513237166	Paraburkholderia azotifigens UYPR1.413	Isolate	Nodule
2	2881927736	Candidimonas sp. SYP-B2681	Isolate	Rhizosphere
3	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
4	2904755435	Paenibacillus aceris KACC 19194	Isolate	Rhizosphere
5	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
6	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
9	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
10	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
11	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
12	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
13	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
14	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
15	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
16	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
17	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
18	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
19	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
20	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
21	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
22	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
23	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
24	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
25	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
26	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
27	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
28	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
29	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
30	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
31	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
32	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
33	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
34	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
35	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
36	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
37	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
38	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
39	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
40	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
41	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
42	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
43	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
44	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
45	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
46	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
47	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
48	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
49	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
50	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
51	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
52	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
53	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
54	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
55	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
56	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
57	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
58	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
59	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
61	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
62	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
63	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
64	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
65	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
66	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
68	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
69	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
71	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
73	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
74	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
75	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
76	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
77	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
78	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
79	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
80	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
81	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
82	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
83	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
84	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
85	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
86	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
87	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
88	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
89	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
90	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
91	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
92	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
93	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
94	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
95	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
96	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
97	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
143	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
147	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
148	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
149	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
150	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
151	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
152	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
153	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
154	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
155	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
156	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
157	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
158	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
159	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
160	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
161	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
162	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
163	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
164	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
165	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
166	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
167	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
168	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
169	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
170	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
171	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
172	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
173	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
174	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
175	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
176	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
177	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
178	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
179	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
180	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
181	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
182	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
183	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
184	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
185	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
186	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
187	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
188	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
189	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
190	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
191	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
192	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
193	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
194	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
195	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
196	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
197	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
198	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
199	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
200	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
201	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
202	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
203	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
204	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
205	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
206	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
207	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
208	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
209	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
210	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
211	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
212	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
213	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
214	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
220	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
221	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
224	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
226	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
227	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
228	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
229	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
230	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
231	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
233	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
234	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
235	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
236	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
237	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
238	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
239	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
240	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
241	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
242	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
243	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
244	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
245	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
246	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
247	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
248	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
249	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
250	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
251	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
252	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
253	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
254	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
255	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
256	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
257	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
258	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
259	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
260	8055301274	Paraburkholderia kirstenboschensis LMG 28727	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	98.93
Metatranscriptomes	0
Isolates	1.07

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	10.45
Nodule	0.43
Rhizoplane	1.28
Rhizosphere	84.65
Stem	0
Stem Tuber	0
Unclassified	3.2

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0055530_10005509	3300003791	Bacteria	5989
2	Ga0070658_10021249	3300005327	Bacteria	5201
3	Ga0070658_10023699	3300005327	Bacteria	4922
4	Ga0070658_10209938	3300005327	Bacteria	1645
5	Ga0070690_100058231	3300005330	Bacteria	2480
6	Ga0070690_100377413	3300005330	Bacteria	1036
7	Ga0070690_100419246	3300005330	Bacteria	987
8	Ga0068869_100002779	3300005334	Bacteria	10602
9	Ga0070680_100009565	3300005336	Bacteria	7446
10	Ga0068868_100018512	3300005338	Bacteria	5209
11	Ga0070660_100206299	3300005339	Bacteria	1595
12	Ga0070689_100000897	3300005340	Bacteria	18581
13	Ga0070689_100025263	3300005340	Bacteria	4462
14	Ga0070689_100038913	3300005340	Bacteria	3639
15	Ga0070689_100283137	3300005340	Bacteria	1376
16	Ga0070691_10012239	3300005341	Bacteria	3927
17	Ga0070691_10025247	3300005341	Bacteria	2766
18	Ga0070687_100042273	3300005343	Bacteria	2308
19	Ga0070687_100155986	3300005343	Bacteria	1345
20	Ga0070687_100334403	3300005343	Bacteria	972
21	Ga0070661_100586925	3300005344	Bacteria	900
22	Ga0070692_10002893	3300005345	Bacteria	6812
23	Ga0070669_100221216	3300005353	Bacteria	1497
24	Ga0070674_100189955	3300005356	Bacteria	1579
25	Ga0070688_100034058	3300005365	Bacteria	3082
26	Ga0070688_100078803	3300005365	Bacteria	2126
27	Ga0070701_10001357	3300005438	Bacteria	9021
28	Ga0070700_100004510	3300005441	Bacteria	7279
29	Ga0070694_100019019	3300005444	Bacteria	4365
30	Ga0070694_100281243	3300005444	Bacteria	1269
31	Ga0070678_100022566	3300005456	Bacteria	4174
32	Ga0070681_10016790	3300005458	Bacteria	7309
33	Ga0070681_10031717	3300005458	Bacteria	5305
34	Ga0068867_100002210	3300005459	Bacteria	13654
35	Ga0068867_100027906	3300005459	Bacteria	4061
36	Ga0070685_10026219	3300005466	Bacteria	3211
37	Ga0070707_100218696	3300005468	Bacteria	1856
38	Ga0070679_100001997	3300005530	Bacteria	18319
39	Ga0070679_100214174	3300005530	Bacteria	1889
40	Ga0070679_100454163	3300005530	Bacteria	1226
41	Ga0070684_100274639	3300005535	Bacteria	1543
42	Ga0070684_100723817	3300005535	Bacteria	928
43	Ga0068853_100002422	3300005539	Bacteria	13940
44	Ga0068853_100126429	3300005539	Bacteria	2284
45	Ga0068853_100192673	3300005539	Bacteria	1853
46	Ga0070672_100156206	3300005543	Bacteria	1889
47	Ga0070686_100000270	3300005544	Bacteria	35461
48	Ga0070686_100078548	3300005544	Bacteria	2179
49	Ga0070696_100022191	3300005546	Bacteria	4312
50	Ga0070693_100007768	3300005547	Bacteria	5258
51	Ga0070693_100008882	3300005547	Bacteria	4983
52	Ga0070693_100011467	3300005547	Bacteria	4464
53	Ga0070665_100090335	3300005548	Bacteria	3068
54	Ga0070665_100607277	3300005548	Bacteria	1107
55	Ga0070665_100793963	3300005548	Bacteria	960
56	Ga0070704_100021844	3300005549	Bacteria	4155
57	Ga0070704_100547985	3300005549	Bacteria	1010
58	Ga0068855_100015704	3300005563	Bacteria	9108
59	Ga0068855_100016593	3300005563	Bacteria	8856
60	Ga0068855_100026410	3300005563	Bacteria	6946
61	Ga0068855_100040465	3300005563	Bacteria	5532
62	Ga0068855_100085728	3300005563	Bacteria	3644
63	Ga0068855_100185677	3300005563	Bacteria	2348
64	Ga0068855_100600939	3300005563	Bacteria	1186
65	Ga0068855_100772304	3300005563	Bacteria	1023
66	Ga0070664_100087975	3300005564	Bacteria	2686
67	Ga0070664_100144174	3300005564	Bacteria	2099
68	Ga0068857_100012149	3300005577	Bacteria	7490
69	Ga0068857_100019687	3300005577	Bacteria	5928
70	Ga0068857_100086437	3300005577	Bacteria	2804
71	Ga0070702_100002030	3300005615	Bacteria	8550
72	Ga0068852_100008752	3300005616	Bacteria	7485
73	Ga0068852_100009196	3300005616	Bacteria	7321
74	Ga0068852_100070006	3300005616	Bacteria	3076
75	Ga0068852_100640308	3300005616	Bacteria	1070
76	Ga0068859_100101877	3300005617	Bacteria	2929
77	Ga0068861_100001749	3300005719	Bacteria	13957
78	Ga0068851_10001328	3300005834	Bacteria	10778
79	Ga0068858_100041941	3300005842	Bacteria	4242
80	Ga0068858_100052164	3300005842	Bacteria	3784
81	Ga0068858_100083046	3300005842	Bacteria	2979
82	Ga0068860_100021954	3300005843	Bacteria	6176
83	Ga0068862_100006423	3300005844	Bacteria	9773
84	Ga0068862_100318426	3300005844	Bacteria	1435
85	Ga0081455_10005742	3300005937	Bacteria	13528
86	Ga0081455_10086759	3300005937	Bacteria	2549
87	Ga0081540_1034436	3300005983	Bacteria	2731
88	Ga0070717_10064344	3300006028	Bacteria	3046
89	Ga0075365_10056389	3300006038	Bacteria	2611
90	Ga0075365_10056487	3300006038	Bacteria	2609
91	Ga0075365_10153975	3300006038	Bacteria	1600
92	Ga0075368_10002292	3300006042	Bacteria	6215
93	Ga0075363_100002082	3300006048	Bacteria	8008
94	Ga0075364_10174698	3300006051	Bacteria	1453
95	Ga0075362_10024208	3300006177	Bacteria	2574
96	Ga0075367_10003655	3300006178	Bacteria	7379
97	Ga0075367_10006845	3300006178	Bacteria	5797
98	Ga0075369_10000317	3300006186	Bacteria	14378
99	Ga0075369_10013632	3300006186	Bacteria	3232
100	Ga0075369_10014097	3300006186	Bacteria	3187
101	Ga0075366_10010316	3300006195	Bacteria	5243
102	Ga0075366_10037284	3300006195	Bacteria	2869
103	Ga0075366_10075867	3300006195	Bacteria	2006
104	Ga0075366_10119897	3300006195	Bacteria	1585
105	Ga0075366_10176073	3300006195	Bacteria	1299
106	Ga0097621_100003978	3300006237	Bacteria	10238
107	Ga0097621_100048005	3300006237	Bacteria	3462
108	Ga0097621_100059836	3300006237	Bacteria	3120
109	Ga0097621_100435072	3300006237	Bacteria	1179
110	Ga0075370_10006969	3300006353	Bacteria	5730
111	Ga0075370_10031189	3300006353	Bacteria	2975
112	Ga0068871_100005621	3300006358	Bacteria	8792
113	Ga0068871_100030294	3300006358	Bacteria	4259
114	Ga0068871_100085992	3300006358	Bacteria	2612
115	Ga0068871_100157930	3300006358	Bacteria	1938
116	Ga0068871_100269679	3300006358	Bacteria	1487
117	Ga0068871_100360664	3300006358	Bacteria	1287
118	Ga0075428_100020633	3300006844	Bacteria	7296
119	Ga0075434_100169140	3300006871	Bacteria	2206
120	Ga0068865_100012821	3300006881	Bacteria	5284
121	Ga0068865_100427150	3300006881	Bacteria	1091
122	Ga0075436_100016268	3300006914	Bacteria	5091
123	Ga0097620_100101873	3300006931	Bacteria	2929
124	Ga0075435_100341646	3300007076	Bacteria	1283
125	Ga0105240_10008305	3300009093	Bacteria	14858
126	Ga0105240_10029214	3300009093	Bacteria	7189
127	Ga0105240_10091639	3300009093	Bacteria	3713
128	Ga0105240_10208544	3300009093	Bacteria	2285
129	Ga0111539_10000665	3300009094	Bacteria	44363
130	Ga0111539_10015176	3300009094	Bacteria	9596
131	Ga0105245_10001133	3300009098	Bacteria	24100
132	Ga0105245_10144819	3300009098	Bacteria	2241
133	Ga0105245_10179420	3300009098	Bacteria	2022
134	Ga0105245_10223192	3300009098	Bacteria	1819
135	Ga0105245_10810218	3300009098	Bacteria	975
136	Ga0114129_10399473	3300009147	Bacteria	1811
137	Ga0105243_10020955	3300009148	Bacteria	4960
138	Ga0105243_10021212	3300009148	Bacteria	4930
139	Ga0105243_10484926	3300009148	Bacteria	1168
140	Ga0105241_10047540	3300009174	Bacteria	3263
141	Ga0105241_10239474	3300009174	Bacteria	1533
142	Ga0105242_10007032	3300009176	Bacteria	8689
143	Ga0105242_10014999	3300009176	Bacteria	6007
144	Ga0105242_10271150	3300009176	Bacteria	1537
145	Ga0105248_10122627	3300009177	Bacteria	2932
146	Ga0105248_10364509	3300009177	Bacteria	1627
147	Ga0105248_10376833	3300009177	Bacteria	1597
148	Ga0105237_10088438	3300009545	Bacteria	3087
149	Ga0105238_10009603	3300009551	Bacteria	9680
150	Ga0105238_10074678	3300009551	Bacteria	3383
151	Ga0105238_10208092	3300009551	Bacteria	1932
152	Ga0105238_10235935	3300009551	Bacteria	1806
153	Ga0105238_10485530	3300009551	Bacteria	1235
154	Ga0105238_10650974	3300009551	Bacteria	1064
155	Ga0105249_10047287	3300009553	Bacteria	3920
156	Ga0105249_10127137	3300009553	Bacteria	2428
157	Ga0105249_11168802	3300009553	Bacteria	840
158	Ga0105239_10155985	3300010375	Bacteria	2549
159	Ga0157373_10062796	3300013100	Bacteria	2631
160	Ga0157371_10105159	3300013102	Bacteria	2003
161	Ga0157370_10010515	3300013104	Bacteria	9745
162	Ga0157370_10132123	3300013104	Bacteria	2328
163	Ga0157369_10006355	3300013105	Bacteria	13713
164	Ga0157369_10261950	3300013105	Bacteria	1803
165	Ga0157369_10653864	3300013105	Bacteria	1084
166	Ga0157374_10143796	3300013296	Bacteria	2316
167	Ga0157374_10444112	3300013296	Bacteria	1298
168	Ga0157378_10331952	3300013297	Bacteria	1480
169	Ga0157378_10546437	3300013297	Bacteria	1163
170	Ga0157378_10625423	3300013297	Bacteria	1090
171	Ga0157378_10936282	3300013297	Bacteria	898
172	Ga0163162_10239079	3300013306	Bacteria	1947
173	Ga0163162_10315758	3300013306	Bacteria	1695
174	Ga0163162_10416512	3300013306	Bacteria	1476
175	Ga0163162_10485843	3300013306	Bacteria	1366
176	Ga0157372_10003819	3300013307	Bacteria	16187
177	Ga0157372_10149975	3300013307	Bacteria	2690
178	Ga0157372_10590816	3300013307	Bacteria	1294
179	Ga0157372_11150639	3300013307	Bacteria	897
180	Ga0157375_10042743	3300013308	Bacteria	4389
181	Ga0163163_10043530	3300014325	Bacteria	4402
182	Ga0157380_10000503	3300014326	Bacteria	23911
183	Ga0157376_10084253	3300014969	Bacteria	2737
184	Ga0157376_10238721	3300014969	Bacteria	1692
185	Ga0183362_10002	3300015683	Bacteria	1432711
186	Ga0213872_10074341	3300021361	Bacteria	1530
187	Ga0213876_10013905	3300021384	Bacteria	4266
188	Ga0213876_10071523	3300021384	Bacteria	1832
189	Ga0213875_10092614	3300021388	Bacteria	1409
190	Ga0209673_1005279	3300025273	Bacteria	6562
191	Ga0209050_1000307	3300025298	Bacteria	100345
192	Ga0209051_1000025	3300025303	Bacteria	415397
193	Ga0209257_1000039	3300025304	Bacteria	591694
194	Ga0207656_10000358	3300025321	Bacteria	15318
195	Ga0207682_10009465	3300025893	Bacteria	3844
196	Ga0207642_10114420	3300025899	Bacteria	1380
197	Ga0207642_10155489	3300025899	Bacteria	1222
198	Ga0207647_10130562	3300025904	Bacteria	1477
199	Ga0207685_10005438	3300025905	Bacteria	3363
200	Ga0207705_10012043	3300025909	Bacteria	6249
201	Ga0207705_10053735	3300025909	Bacteria	2902
202	Ga0207705_10104997	3300025909	Bacteria	2082
203	Ga0207705_10109502	3300025909	Bacteria	2040
204	Ga0207707_10001852	3300025912	Bacteria	19339
205	Ga0207707_10022710	3300025912	Bacteria	5486
206	Ga0207707_10074588	3300025912	Bacteria	2959
207	Ga0207707_10455847	3300025912	Bacteria	1094
208	Ga0207707_10529749	3300025912	Bacteria	1003
209	Ga0207695_10006194	3300025913	Bacteria	15592
210	Ga0207695_10064218	3300025913	Bacteria	3781
211	Ga0207695_10214394	3300025913	Bacteria	1835
212	Ga0207693_10036829	3300025915	Bacteria	3858
213	Ga0207660_10138267	3300025917	Bacteria	1860
214	Ga0207660_10175773	3300025917	Bacteria	1660
215	Ga0207662_10023682	3300025918	Bacteria	3529
216	Ga0207662_10129693	3300025918	Bacteria	1589
217	Ga0207649_10050734	3300025920	Bacteria	2567
218	Ga0207649_10106943	3300025920	Bacteria	1862
219	Ga0207652_10104927	3300025921	Bacteria	2500
220	Ga0207652_10173749	3300025921	Bacteria	1934
221	Ga0207652_10591148	3300025921	Bacteria	996
222	Ga0207681_10110845	3300025923	Bacteria	1996
223	Ga0207694_10087797	3300025924	Bacteria	2451
224	Ga0207694_10227076	3300025924	Bacteria	1524
225	Ga0207694_10288199	3300025924	Bacteria	1350
226	Ga0207694_10372018	3300025924	Bacteria	1185
227	Ga0207694_10481868	3300025924	Bacteria	1038
228	Ga0207659_10086320	3300025926	Bacteria	2333
229	Ga0207687_10007502	3300025927	Bacteria	7173
230	Ga0207687_10060931	3300025927	Bacteria	2663
231	Ga0207687_10118586	3300025927	Bacteria	1976
232	Ga0207687_10226587	3300025927	Bacteria	1474
233	Ga0207690_10135655	3300025932	Bacteria	1807
234	Ga0207686_10000457	3300025934	Bacteria	27169
235	Ga0207686_10021947	3300025934	Bacteria	3671
236	Ga0207686_10123084	3300025934	Bacteria	1768
237	Ga0207709_10009703	3300025935	Bacteria	5304
238	Ga0207709_10017427	3300025935	Bacteria	4009
239	Ga0207670_10047903	3300025936	Bacteria	2849
240	Ga0207670_10331343	3300025936	Bacteria	1200
241	Ga0207669_10097801	3300025937	Bacteria	1931
242	Ga0207704_10000502	3300025938	Bacteria	17428
243	Ga0207704_10300515	3300025938	Bacteria	1229
244	Ga0207665_10212093	3300025939	Bacteria	1415
245	Ga0207691_10015412	3300025940	Bacteria	7272
246	Ga0207691_10173921	3300025940	Bacteria	1884
247	Ga0207711_10134086	3300025941	Bacteria	2223
248	Ga0207711_10197833	3300025941	Bacteria	1833
249	Ga0207689_10000326	3300025942	Bacteria	44274
250	Ga0207689_10095590	3300025942	Bacteria	2440
251	Ga0207679_10257783	3300025945	Bacteria	1486
252	Ga0207679_10281409	3300025945	Bacteria	1427
253	Ga0207667_10008008	3300025949	Bacteria	12605
254	Ga0207667_10011991	3300025949	Bacteria	10033
255	Ga0207667_10116296	3300025949	Bacteria	2756
256	Ga0207667_10151005	3300025949	Bacteria	2391
257	Ga0207667_10606660	3300025949	Bacteria	1103
258	Ga0207651_10404403	3300025960	Bacteria	1162
259	Ga0207651_10637042	3300025960	Bacteria	935
260	Ga0207712_10028968	3300025961	Bacteria	3710
261	Ga0207677_10025708	3300026023	Bacteria	3678
262	Ga0207677_10445030	3300026023	Bacteria	1109
263	Ga0207703_10011865	3300026035	Bacteria	6784
264	Ga0207703_10032251	3300026035	Bacteria	4145
265	Ga0207703_10065690	3300026035	Bacteria	2982
266	Ga0207703_10124138	3300026035	Bacteria	2220
267	Ga0207639_10020743	3300026041	Bacteria	4709
268	Ga0207639_10138726	3300026041	Bacteria	2023
269	Ga0207639_10215210	3300026041	Bacteria	1656
270	Ga0207639_10564085	3300026041	Bacteria	1047
271	Ga0207708_10001097	3300026075	Bacteria	20270
272	Ga0207708_10127147	3300026075	Bacteria	1990
273	Ga0207702_10068715	3300026078	Bacteria	3044
274	Ga0207648_10000213	3300026089	Bacteria	62371
275	Ga0207648_10008783	3300026089	Bacteria	9733
276	Ga0207648_10213215	3300026089	Bacteria	1715
277	Ga0207648_10996872	3300026089	Bacteria	784
278	Ga0207674_10009845	3300026116	Bacteria	10882
279	Ga0207674_10103351	3300026116	Bacteria	2829
280	Ga0207674_10108605	3300026116	Bacteria	2751
281	Ga0207674_10144281	3300026116	Bacteria	2340
282	Ga0207675_100000234	3300026118	Bacteria	52634
283	Ga0207675_100335917	3300026118	Bacteria	1478
284	Ga0207683_10044187	3300026121	Bacteria	3894
285	Ga0207698_10008141	3300026142	Bacteria	6608
286	Ga0207698_10022780	3300026142	Bacteria	4362
287	Ga0207698_10026891	3300026142	Bacteria	4076
288	Ga0207698_10233249	3300026142	Bacteria	1672
289	Ga0209974_10048612	3300027876	Bacteria	1422
290	Ga0207428_10049002	3300027907	Bacteria	3387
291	Ga0207428_10188099	3300027907	Bacteria	1557
292	Ga0268266_10120517	3300028379	Bacteria	2334
293	Ga0268266_10658111	3300028379	Bacteria	1008
294	Ga0268265_10050407	3300028380	Bacteria	3136
295	Ga0268265_10875018	3300028380	Bacteria	881
296	Ga0268264_10060341	3300028381	Bacteria	3179
297	Ga0268264_10814461	3300028381	Bacteria	933
298	Ga0268264_11131110	3300028381	Bacteria	792
299	Ga0265334_10035606	3300028573	Bacteria	1969
300	Ga0265318_10024443	3300028577	Bacteria	2396
301	Ga0265338_10018617	3300028800	Bacteria	7421
302	Ga0307511_10002862	3300030521	Bacteria	17902
303	Ga0265320_10024691	3300031240	Bacteria	3174
304	Ga0265340_10034289	3300031247	Bacteria	2525
305	Ga0265327_10066434	3300031251	Bacteria	1820
306	Ga0265327_10193581	3300031251	Bacteria	924
307	Ga0307509_10507765	3300031507	Bacteria	889
308	Ga0307408_100003262	3300031548	Bacteria	11158
309	Ga0307408_100146050	3300031548	Bacteria	1862
310	Ga0307408_100504803	3300031548	Bacteria	1059
311	Ga0307405_10003117	3300031731	Bacteria	7534
312	Ga0307405_10182580	3300031731	Bacteria	1508
313	Ga0307413_10081271	3300031824	Bacteria	2077
314	Ga0307413_10231969	3300031824	Bacteria	1356
315	Ga0307410_10000436	3300031852	Bacteria	16694
316	Ga0307410_10139198	3300031852	Bacteria	1793
317	Ga0307406_10003708	3300031901	Bacteria	8316
318	Ga0307407_10014431	3300031903	Bacteria	3869
319	Ga0307412_10002627	3300031911	Bacteria	9978
320	Ga0307409_100009099	3300031995	Bacteria	6080
321	Ga0307416_100001720	3300032002	Bacteria	12111
322	Ga0307416_100031608	3300032002	Bacteria	3988
323	Ga0307416_100156837	3300032002	Bacteria	2097
324	Ga0307416_100833044	3300032002	Bacteria	1020
325	Ga0307411_10002874	3300032005	Bacteria	7788
326	Ga0307411_10202338	3300032005	Bacteria	1526
327	Ga0307415_100000829	3300032126	Bacteria	14151
328	Ga0373956_0155696	3300035119	Bacteria	1076
329	Ga0373957_0087992	3300035120	Bacteria	1232
330	Ga0373955_0023103	3300035172	Bacteria	3164
331	Ga0373931_0169927	3300035691	Bacteria	1284
332	Ga0373931_0260880	3300035691	Bacteria	1057
333	Ga0373927_0013575	3300035695	Bacteria	5410
334	Ga0373937_0017384	3300036401	Bacteria	6406
335	Ga0373937_0033099	3300036401	Bacteria	4692
336	Ga0373937_0551503	3300036401	Bacteria	1095
337	Ga0373937_0918542	3300036401	Bacteria	824
338	Ga0373925_0039325	3300037068	Bacteria	3500
339	Ga0395900_0002661	3300037418	Bacteria	19525
340	Ga0395900_0037630	3300037418	Bacteria	4988
341	Ga0395900_0127341	3300037418	Bacteria	2611
342	Ga0395905_0000033	3300037471	Bacteria	279363
343	Ga0395905_0000185	3300037471	Bacteria	99394
344	Ga0395905_0001055	3300037471	Bacteria	34828
345	Ga0395905_0086158	3300037471	Bacteria	2944
346	Ga0395905_0175083	3300037471	Bacteria	2015
347	Ga0436364_0751916	3300037853	Bacteria	5493
348	Ga0436364_0843472	3300037853	Bacteria	1152
349	Ga0436364_0886429	3300037853	Bacteria	3370
350	Ga0436364_0889551	3300037853	Bacteria	2507
351	Ga0436364_1475406	3300037853	Bacteria	2608
352	Ga0395901_0005144	3300038443	Bacteria	13205
353	Ga0395901_0093547	3300038443	Bacteria	3148
354	Ga0436361_1028012	3300039447	Bacteria	6349
355	Ga0436363_0088912	3300039450	Bacteria	1893
356	Ga0436363_0944955	3300039450	Bacteria	1299
357	Ga0451851_0539116	3300041507	Bacteria	857
358	Ga0439462_0048421	3300042015	Bacteria	1140
359	Ga0439435_0006509	3300042436	Bacteria	2628
360	Ga0451577_0106297	3300042876	Bacteria	2509
361	Ga0466969_0037812	3300044656	Bacteria	2432
362	Ga0466965_0252326	3300044683	Bacteria	947
363	Ga0466966_0011448	3300044684	Bacteria	5884
364	Ga0466961_0009286	3300044693	Bacteria	6261
365	Ga0466963_0096301	3300044694	Bacteria	2021
366	Ga0453684_0351665	3300044712	Bacteria	1661
367	Ga0466968_0039429	3300044735	Bacteria	1989
368	Ga0466970_0022302	3300044765	Bacteria	3305
369	Ga0466957_0040203	3300044842	Bacteria	2824
370	Ga0466959_0004590	3300045049	Bacteria	9270
371	Ga0451576_0181633	3300045051	Bacteria	2197
372	Ga0466958_0099447	3300045836	Bacteria	1807
373	Ga0466958_0219823	3300045836	Bacteria	1212
374	Ga0466967_0105504	3300045976	Bacteria	2581
375	Ga0495592_0199156	3300046454	Bacteria	1352
376	Ga0495603_0003204	3300046455	Bacteria	9745
377	Ga0495651_0116705	3300046462	Bacteria	1966
378	Ga0495651_0273579	3300046462	Bacteria	1144
379	Ga0495608_0443264	3300046511	Bacteria	791
380	Ga0495628_0087532	3300046516	Bacteria	2415
381	Ga0495652_0113089	3300046529	Bacteria	2180
382	Ga0495587_0214537	3300046536	Bacteria	1086
383	Ga0495621_0011563	3300046539	Bacteria	2735
384	Ga0495621_0075064	3300046539	Bacteria	1252
385	Ga0495645_0005153	3300046543	Bacteria	8952
386	Ga0495657_0011902	3300046675	Bacteria	6483
387	Ga0495623_0007552	3300046679	Bacteria	7056
388	Ga0495684_0106908	3300047471	Bacteria	2114
389	Ga0495684_0228193	3300047471	Bacteria	1363
390	Ga0495602_0132235	3300048088	Bacteria	1988
391	Ga0496104_0036947	3300048907	Bacteria	4567
392	Ga0496105_0614299	3300048908	Bacteria	842
393	Ga0496108_0051465	3300048911	Bacteria	3451
394	Ga0496108_0107679	3300048911	Bacteria	2380
395	Ga0496109_0151667	3300048912	Bacteria	2170
396	Ga0496110_0211569	3300048913	Bacteria	1763
397	Ga0496118_0154711	3300048921	Bacteria	1429
398	Ga0501033_0186233	3300049570	Bacteria	1487
399	Ga0501034_0000839	3300049571	Bacteria	45535
400	Ga0501034_0053618	3300049571	Bacteria	4060
401	Ga0501034_0306821	3300049571	Bacteria	1523
402	Ga0501039_0092230	3300049575	Bacteria	2361
403	Ga0501046_0063185	3300049580	Bacteria	2892
404	Ga0501047_0010991	3300049581	Bacteria	8566
405	Ga0501068_0155533	3300049584	Bacteria	1439
406	Ga0501069_0011736	3300049585	Bacteria	4645
407	Ga0501070_0005410	3300049586	Bacteria	10895
408	Ga0501071_0172299	3300049587	Bacteria	1620
409	Ga0501072_0100332	3300049588	Bacteria	2301
410	Ga0501073_0001548	3300049589	Bacteria	17041
411	Ga0501073_0012078	3300049589	Bacteria	6305
412	Ga0501074_0001537	3300049590	Bacteria	15604
413	Ga0501074_0179542	3300049590	Bacteria	1510
414	Ga0501075_0005395	3300049591	Bacteria	8745
415	Ga0501076_0007847	3300049592	Bacteria	7778
416	Ga0501079_0001387	3300049741	Bacteria	17071
417	Ga0501079_0096572	3300049741	Bacteria	2291
418	Ga0501080_0004041	3300049742	Bacteria	12993
419	Ga0501080_0007140	3300049742	Bacteria	10079
420	Ga0501080_0036414	3300049742	Bacteria	4593
421	Ga0501081_0072766	3300049743	Bacteria	2397
422	Ga0501083_0010528	3300049744	Bacteria	6508
423	Ga0501083_0217094	3300049744	Bacteria	1246
424	Ga0501044_0180039	3300049823	Bacteria	2081
425	Ga0501045_0035071	3300049824	Bacteria	3643
426	Ga0501045_0035405	3300049824	Bacteria	3625
427	nmdc:mga03683_18261_c1	3300050489	Bacteria	2664
428	nmdc:mga03n38_3788_c1	3300050490	Bacteria	4909
429	nmdc:mga00v17_54690_c1	3300050491	Bacteria	2436
430	nmdc:mga0yw44_143080_c1	3300050492	Bacteria	1555
431	nmdc:mga0yw44_163777_c1	3300050492	Bacteria	1457
432	nmdc:mga0yw44_185505_c1	3300050492	Bacteria	1371
433	nmdc:mga0k408_55518_c1	3300050493	Bacteria	2297
434	nmdc:mga0k408_67492_c1	3300050493	Bacteria	2084
435	nmdc:mga0k408_93402_c1	3300050493	Bacteria	1769
436	nmdc:mga06z11_16638_c1	3300050494	Bacteria	3317
437	nmdc:mga06z11_39312_c1	3300050494	Bacteria	2354
438	nmdc:mga04h51_16878_c1	3300050495	Bacteria	2126
439	nmdc:mga04h51_172770_c1	3300050495	Bacteria	837
440	nmdc:mga07m45_200754_c1	3300050496	Bacteria	1160
441	nmdc:mga08y16_144067_c1	3300050511	Bacteria	2477
442	nmdc:mga08y16_23793_c1	3300050511	Bacteria	6468
443	nmdc:mga0rr50_250391_c1	3300050513	Bacteria	1471
444	nmdc:mga08x19_18547_c1	3300050514	Bacteria	4264
445	nmdc:mga08x19_82036_c1	3300050514	Bacteria	2118
446	nmdc:mga0a205_163871_c1	3300050515	Bacteria	2119
447	nmdc:mga0sz30_266_c1	3300050516	Bacteria	20024
448	nmdc:mga0sz30_45165_c1	3300050516	Bacteria	1858
449	Ga0495601_0009477	3300053077	Bacteria	5763
450	Ga0495601_0020065	3300053077	Bacteria	4079
451	Ga0495595_0116208	3300053084	Bacteria	1300
452	Ga0495619_0071570	3300053085	Bacteria	2321
453	Ga0500643_000179	3300053087	Bacteria	62167
454	Ga0500646_0000341	3300053090	Bacteria	14055
455	Ga0500647_0089955	3300053091	Bacteria	1470
456	Ga0500583_0014363	3300053092	Bacteria	3098
457	Ga0500594_0039426	3300053118	Bacteria	1285
458	Ga0500655_007728	3300053133	Bacteria	1936
459	Ga0500568_0009449	3300053139	Bacteria	4629
460	Ga0500568_0081048	3300053139	Bacteria	1232
461	Ga0500604_0000721	3300053151	Bacteria	9045
462	Ga0501084_0115895	3300054114	Bacteria	2252
463	Ga0501084_0307134	3300054114	Bacteria	1340
464	Ga0501082_0095350	3300060353	Bacteria	2571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300053091	Ga0500647_0089955	Ga0500647_0089955_24_644	206
2	3300049588	Ga0501072_0100332	Ga0501072_0100332_211_963	211
3	3300049592	Ga0501076_0007847	Ga0501076_0007847_6796_7548	211
4	3300049743	Ga0501081_0072766	Ga0501081_0072766_232_984	211
5	3300054114	Ga0501084_0115895	Ga0501084_0115895_355_1107	211
6	3300049587	Ga0501071_0172299	Ga0501071_0172299_147_899	212
7	3300049591	Ga0501075_0005395	Ga0501075_0005395_5703_6455	212
8	3300005844	Ga0068862_100318426	Ga0068862_1003184262	218
9	3300026023	Ga0207677_10445030	Ga0207677_104450301	221
10	3300046511	Ga0495608_0443264	Ga0495608_0443264_74_745	223
11	3300048912	Ga0496109_0151667	Ga0496109_0151667_13_684	223
12	3300021388	Ga0213875_10092614	Ga0213875_100926141	224
13	3300037853	Ga0436364_0751916	Ga0436364_0751916_3853_4602	224
14	3300025920	Ga0207649_10106943	Ga0207649_101069432	226
15	3300031901	Ga0307406_10003708	Ga0307406_100037086	228
16	3300050513	nmdc:mga0rr50_250391_c1	nmdc:mga0rr50_250391_c1_19_729	236
17	3300005548	Ga0070665_100607277	Ga0070665_1006072772	237
18	3300025934	Ga0207686_10123084	Ga0207686_101230842	237
19	3300026089	Ga0207648_10008783	Ga0207648_100087836	237
20	3300028379	Ga0268266_10658111	Ga0268266_106581111	237
21	3300005340	Ga0070689_100025263	Ga0070689_1000252632	238
22	3300005365	Ga0070688_100034058	Ga0070688_1000340583	238
23	3300005543	Ga0070672_100156206	Ga0070672_1001562062	238
24	3300005577	Ga0068857_100019687	Ga0068857_1000196875	238
25	3300005617	Ga0068859_100101877	Ga0068859_1001018772	238
26	3300006931	Ga0097620_100101873	Ga0097620_1001018733	238
27	3300025923	Ga0207681_10110845	Ga0207681_101108453	238
28	3300025926	Ga0207659_10086320	Ga0207659_100863202	238
29	3300025940	Ga0207691_10015412	Ga0207691_100154123	238
30	3300025942	Ga0207689_10095590	Ga0207689_100955902	238
31	3300025960	Ga0207651_10404403	Ga0207651_104044032	238
32	3300026116	Ga0207674_10009845	Ga0207674_100098457	238
33	3300042436	Ga0439435_0006509	Ga0439435_0006509_1103_1834	238
34	3300049571	Ga0501034_0306821	Ga0501034_0306821_49_771	238
35	3300041507	Ga0451851_0539116	Ga0451851_0539116_79_840	240
36	3300013306	Ga0163162_10315758	Ga0163162_103157582	241
37	3300025940	Ga0207691_10173921	Ga0207691_101739212	241
38	3300028381	Ga0268264_10814461	Ga0268264_108144611	241
39	3300026041	Ga0207639_10564085	Ga0207639_105640852	242
40	iso_pu_bacteria	2513237166	2514053575	242
41	iso_pu_bacteria	2900634093	2900643029	242
42	iso_pu_bacteria	2904755435	2904761191	242
43	iso_pu_bacteria	8055301274	8055308633	242
44	3300005327	Ga0070658_10209938	Ga0070658_102099382	244
45	3300005336	Ga0070680_100009565	Ga0070680_1000095653	244
46	3300005339	Ga0070660_100206299	Ga0070660_1002062992	244
47	3300005341	Ga0070691_10012239	Ga0070691_100122393	244
48	3300005458	Ga0070681_10031717	Ga0070681_100317173	244
49	3300005530	Ga0070679_100001997	Ga0070679_1000019976	244
50	3300005530	Ga0070679_100454163	Ga0070679_1004541631	244
51	3300005535	Ga0070684_100274639	Ga0070684_1002746392	244
52	3300005539	Ga0068853_100126429	Ga0068853_1001264292	244
53	3300005548	Ga0070665_100793963	Ga0070665_1007939632	244
54	3300005563	Ga0068855_100016593	Ga0068855_1000165937	244
55	3300005563	Ga0068855_100185677	Ga0068855_1001856772	244
56	3300005563	Ga0068855_100600939	Ga0068855_1006009392	244
57	3300005564	Ga0070664_100144174	Ga0070664_1001441742	244
58	3300005937	Ga0081455_10005742	Ga0081455_1000574211	244
59	3300005937	Ga0081455_10086759	Ga0081455_100867591	244
60	3300006038	Ga0075365_10153975	Ga0075365_101539752	244
61	3300006186	Ga0075369_10000317	Ga0075369_1000031713	244
62	3300006353	Ga0075370_10031189	Ga0075370_100311892	244
63	3300009093	Ga0105240_10029214	Ga0105240_100292147	244
64	3300013104	Ga0157370_10132123	Ga0157370_101321232	244
65	3300013105	Ga0157369_10261950	Ga0157369_102619502	244
66	3300021361	Ga0213872_10074341	Ga0213872_100743411	244
67	3300021384	Ga0213876_10013905	Ga0213876_100139056	244
68	3300025904	Ga0207647_10130562	Ga0207647_101305622	244
69	3300025909	Ga0207705_10053735	Ga0207705_100537353	244
70	3300025912	Ga0207707_10074588	Ga0207707_100745883	244
71	3300025913	Ga0207695_10064218	Ga0207695_100642185	244
72	3300025917	Ga0207660_10138267	Ga0207660_101382672	244
73	3300025920	Ga0207649_10050734	Ga0207649_100507341	244
74	3300025921	Ga0207652_10104927	Ga0207652_101049273	244
75	3300025921	Ga0207652_10591148	Ga0207652_105911481	244
76	3300025927	Ga0207687_10226587	Ga0207687_102265872	244
77	3300025939	Ga0207665_10212093	Ga0207665_102120932	244
78	3300025949	Ga0207667_10008008	Ga0207667_1000800810	244
79	3300025949	Ga0207667_10606660	Ga0207667_106066602	244
80	3300026041	Ga0207639_10215210	Ga0207639_102152102	244
81	3300026078	Ga0207702_10068715	Ga0207702_100687152	244
82	3300026116	Ga0207674_10144281	Ga0207674_101442813	244
83	3300026142	Ga0207698_10233249	Ga0207698_102332492	244
84	3300028380	Ga0268265_10875018	Ga0268265_108750181	244
85	3300028573	Ga0265334_10035606	Ga0265334_100356062	244
86	3300031247	Ga0265340_10034289	Ga0265340_100342892	244
87	3300036401	Ga0373937_0551503	Ga0373937_0551503_158_901	244
88	3300037418	Ga0395900_0002661	Ga0395900_0002661_17815_18558	244
89	3300038443	Ga0395901_0005144	Ga0395901_0005144_3112_3855	244
90	3300044694	Ga0466963_0096301	Ga0466963_0096301_840_1583	244
91	3300044842	Ga0466957_0040203	Ga0466957_0040203_662_1405	244
92	3300045976	Ga0466967_0105504	Ga0466967_0105504_1282_2025	244
93	3300050492	nmdc:mga0yw44_143080_c1	nmdc:mga0yw44_143080_c1_300_1043	244
94	3300050495	nmdc:mga04h51_172770_c1	nmdc:mga04h51_172770_c1_77_820	244
95	3300050496	nmdc:mga07m45_200754_c1	nmdc:mga07m45_200754_c1_328_1071	244
96	3300050516	nmdc:mga0sz30_266_c1	nmdc:mga0sz30_266_c1_1642_2385	244
97	3300005353	Ga0070669_100221216	Ga0070669_1002212162	245
98	3300006178	Ga0075367_10003655	Ga0075367_100036555	245
99	3300009147	Ga0114129_10399473	Ga0114129_103994732	245
100	3300015683	Ga0183362_10002	Ga0183362_10002996	245
101	3300037471	Ga0395905_0000033	Ga0395905_0000033_184432_185244	245
102	3300037471	Ga0395905_0000185	Ga0395905_0000185_86010_86747	245
103	3300037471	Ga0395905_0001055	Ga0395905_0001055_24430_25242	245
104	3300050492	nmdc:mga0yw44_185505_c1	nmdc:mga0yw44_185505_c1_95_841	245
105	3300050493	nmdc:mga0k408_67492_c1	nmdc:mga0k408_67492_c1_373_1119	245
106	3300050494	nmdc:mga06z11_16638_c1	nmdc:mga06z11_16638_c1_78_824	245
107	3300005983	Ga0081540_1034436	Ga0081540_10344361	246
108	3300006195	Ga0075366_10119897	Ga0075366_101198972	246
109	3300037471	Ga0395905_0175083	Ga0395905_0175083_742_1485	246
110	3300046455	Ga0495603_0003204	Ga0495603_0003204_8985_9728	246
111	3300048921	Ga0496118_0154711	Ga0496118_0154711_358_1101	246
112	3300050514	nmdc:mga08x19_82036_c1	nmdc:mga08x19_82036_c1_732_1481	246
113	3300053087	Ga0500643_000179	Ga0500643_000179_30742_31497	246
114	3300053139	Ga0500568_0009449	Ga0500568_0009449_1939_2688	246
115	3300006844	Ga0075428_100020633	Ga0075428_1000206336	247
116	3300009094	Ga0111539_10000665	Ga0111539_1000066513	247
117	3300009098	Ga0105245_10144819	Ga0105245_101448193	247
118	3300009551	Ga0105238_10235935	Ga0105238_102359352	247
119	3300013100	Ga0157373_10062796	Ga0157373_100627962	247
120	3300013102	Ga0157371_10105159	Ga0157371_101051592	247
121	3300013307	Ga0157372_10149975	Ga0157372_101499752	247
122	3300014325	Ga0163163_10043530	Ga0163163_100435302	247
123	3300027907	Ga0207428_10049002	Ga0207428_100490023	247
124	3300031548	Ga0307408_100003262	Ga0307408_1000032623	247
125	3300031548	Ga0307408_100146050	Ga0307408_1001460501	247
126	3300031731	Ga0307405_10003117	Ga0307405_100031178	247
127	3300031824	Ga0307413_10081271	Ga0307413_100812712	247
128	3300031824	Ga0307413_10231969	Ga0307413_102319692	247
129	3300031852	Ga0307410_10000436	Ga0307410_100004366	247
130	3300031852	Ga0307410_10139198	Ga0307410_101391982	247
131	3300031903	Ga0307407_10014431	Ga0307407_100144312	247
132	3300031911	Ga0307412_10002627	Ga0307412_1000262710	247
133	3300031995	Ga0307409_100009099	Ga0307409_1000090998	247
134	3300032002	Ga0307416_100001720	Ga0307416_1000017207	247
135	3300032002	Ga0307416_100031608	Ga0307416_1000316083	247
136	3300032002	Ga0307416_100156837	Ga0307416_1001568372	247
137	3300032005	Ga0307411_10002874	Ga0307411_100028744	247
138	3300032005	Ga0307411_10202338	Ga0307411_102023382	247
139	3300032126	Ga0307415_100000829	Ga0307415_1000008299	247
140	3300035695	Ga0373927_0013575	Ga0373927_0013575_2564_3307	247
141	3300037853	Ga0436364_0843472	Ga0436364_0843472_329_1072	247
142	3300037853	Ga0436364_1475406	Ga0436364_1475406_1838_2584	247
143	3300039447	Ga0436361_1028012	Ga0436361_1028012_1570_2313	247
144	3300039450	Ga0436363_0944955	Ga0436363_0944955_91_834	247
145	3300042015	Ga0439462_0048421	Ga0439462_0048421_235_1041	247
146	3300042876	Ga0451577_0106297	Ga0451577_0106297_269_1012	247
147	3300044712	Ga0453684_0351665	Ga0453684_0351665_315_1058	247
148	3300049570	Ga0501033_0186233	Ga0501033_0186233_642_1397	247
149	3300049575	Ga0501039_0092230	Ga0501039_0092230_359_1102	247
150	3300049824	Ga0501045_0035405	Ga0501045_0035405_2754_3497	247
151	3300050511	nmdc:mga08y16_144067_c1	nmdc:mga08y16_144067_c1_963_1706	247
152	iso_pu_bacteria	2881927736	2881928162	247
153	3300005327	Ga0070658_10021249	Ga0070658_100212493	248
154	3300005327	Ga0070658_10023699	Ga0070658_100236992	248
155	3300005330	Ga0070690_100377413	Ga0070690_1003774132	248
156	3300005330	Ga0070690_100419246	Ga0070690_1004192461	248
157	3300005340	Ga0070689_100038913	Ga0070689_1000389131	248
158	3300005340	Ga0070689_100283137	Ga0070689_1002831372	248
159	3300005343	Ga0070687_100334403	Ga0070687_1003344031	248
160	3300005344	Ga0070661_100586925	Ga0070661_1005869251	248
161	3300005356	Ga0070674_100189955	Ga0070674_1001899552	248
162	3300005458	Ga0070681_10016790	Ga0070681_100167903	248
163	3300005459	Ga0068867_100027906	Ga0068867_1000279061	248
164	3300005468	Ga0070707_100218696	Ga0070707_1002186963	248
165	3300005539	Ga0068853_100192673	Ga0068853_1001926732	248
166	3300005547	Ga0070693_100008882	Ga0070693_1000088822	248
167	3300005547	Ga0070693_100011467	Ga0070693_1000114674	248
168	3300005548	Ga0070665_100090335	Ga0070665_1000903352	248
169	3300005563	Ga0068855_100015704	Ga0068855_1000157042	248
170	3300005563	Ga0068855_100040465	Ga0068855_1000404653	248
171	3300005563	Ga0068855_100085728	Ga0068855_1000857283	248
172	3300005616	Ga0068852_100008752	Ga0068852_1000087522	248
173	3300005616	Ga0068852_100009196	Ga0068852_1000091963	248
174	3300005616	Ga0068852_100070006	Ga0068852_1000700063	248
175	3300005616	Ga0068852_100640308	Ga0068852_1006403081	248
176	3300005834	Ga0068851_10001328	Ga0068851_100013282	248
177	3300005842	Ga0068858_100041941	Ga0068858_1000419412	248
178	3300005842	Ga0068858_100052164	Ga0068858_1000521644	248
179	3300006028	Ga0070717_10064344	Ga0070717_100643441	248
180	3300006051	Ga0075364_10174698	Ga0075364_101746982	248
181	3300006186	Ga0075369_10013632	Ga0075369_100136322	248
182	3300006195	Ga0075366_10037284	Ga0075366_100372843	248
183	3300006195	Ga0075366_10075867	Ga0075366_100758672	248
184	3300006195	Ga0075366_10176073	Ga0075366_101760732	248
185	3300006237	Ga0097621_100048005	Ga0097621_1000480051	248
186	3300006237	Ga0097621_100059836	Ga0097621_1000598362	248
187	3300006237	Ga0097621_100435072	Ga0097621_1004350722	248
188	3300006358	Ga0068871_100030294	Ga0068871_1000302945	248
189	3300006358	Ga0068871_100085992	Ga0068871_1000859922	248
190	3300006358	Ga0068871_100157930	Ga0068871_1001579303	248
191	3300006358	Ga0068871_100269679	Ga0068871_1002696792	248
192	3300006871	Ga0075434_100169140	Ga0075434_1001691401	248
193	3300006881	Ga0068865_100427150	Ga0068865_1004271502	248
194	3300006914	Ga0075436_100016268	Ga0075436_1000162683	248
195	3300007076	Ga0075435_100341646	Ga0075435_1003416462	248
196	3300009093	Ga0105240_10008305	Ga0105240_100083054	248
197	3300009093	Ga0105240_10091639	Ga0105240_100916392	248
198	3300009093	Ga0105240_10208544	Ga0105240_102085442	248
199	3300009098	Ga0105245_10179420	Ga0105245_101794202	248
200	3300009098	Ga0105245_10810218	Ga0105245_108102181	248
201	3300009148	Ga0105243_10020955	Ga0105243_100209553	248
202	3300009148	Ga0105243_10484926	Ga0105243_104849261	248
203	3300009174	Ga0105241_10239474	Ga0105241_102394741	248
204	3300009176	Ga0105242_10007032	Ga0105242_100070324	248
205	3300009176	Ga0105242_10271150	Ga0105242_102711502	248
206	3300009177	Ga0105248_10364509	Ga0105248_103645092	248
207	3300009177	Ga0105248_10376833	Ga0105248_103768332	248
208	3300009551	Ga0105238_10009603	Ga0105238_1000960311	248
209	3300009551	Ga0105238_10074678	Ga0105238_100746781	248
210	3300009551	Ga0105238_10485530	Ga0105238_104855302	248
211	3300009551	Ga0105238_10650974	Ga0105238_106509741	248
212	3300009553	Ga0105249_11168802	Ga0105249_111688022	248
213	3300013104	Ga0157370_10010515	Ga0157370_100105154	248
214	3300013105	Ga0157369_10006355	Ga0157369_100063557	248
215	3300013105	Ga0157369_10653864	Ga0157369_106538641	248
216	3300013296	Ga0157374_10143796	Ga0157374_101437963	248
217	3300013296	Ga0157374_10444112	Ga0157374_104441122	248
218	3300013297	Ga0157378_10331952	Ga0157378_103319522	248
219	3300013297	Ga0157378_10625423	Ga0157378_106254232	248
220	3300013297	Ga0157378_10936282	Ga0157378_109362821	248
221	3300013306	Ga0163162_10416512	Ga0163162_104165122	248
222	3300013306	Ga0163162_10485843	Ga0163162_104858432	248
223	3300013307	Ga0157372_10003819	Ga0157372_100038195	248
224	3300013307	Ga0157372_10590816	Ga0157372_105908162	248
225	3300013307	Ga0157372_11150639	Ga0157372_111506391	248
226	3300014969	Ga0157376_10084253	Ga0157376_100842533	248
227	3300014969	Ga0157376_10238721	Ga0157376_102387211	248
228	3300021384	Ga0213876_10071523	Ga0213876_100715233	248
229	3300025273	Ga0209673_1005279	Ga0209673_10052794	248
230	3300025303	Ga0209051_1000025	Ga0209051_100002585	248
231	3300025304	Ga0209257_1000039	Ga0209257_1000039523	248
232	3300025321	Ga0207656_10000358	Ga0207656_1000035818	248
233	3300025893	Ga0207682_10009465	Ga0207682_100094652	248
234	3300025899	Ga0207642_10114420	Ga0207642_101144202	248
235	3300025905	Ga0207685_10005438	Ga0207685_100054382	248
236	3300025909	Ga0207705_10012043	Ga0207705_100120433	248
237	3300025909	Ga0207705_10104997	Ga0207705_101049973	248
238	3300025909	Ga0207705_10109502	Ga0207705_101095022	248
239	3300025912	Ga0207707_10022710	Ga0207707_100227104	248
240	3300025912	Ga0207707_10455847	Ga0207707_104558471	248
241	3300025912	Ga0207707_10529749	Ga0207707_105297491	248
242	3300025913	Ga0207695_10006194	Ga0207695_100061943	248
243	3300025913	Ga0207695_10214394	Ga0207695_102143942	248
244	3300025917	Ga0207660_10175773	Ga0207660_101757731	248
245	3300025924	Ga0207694_10087797	Ga0207694_100877971	248
246	3300025924	Ga0207694_10288199	Ga0207694_102881992	248
247	3300025924	Ga0207694_10372018	Ga0207694_103720181	248
248	3300025924	Ga0207694_10481868	Ga0207694_104818682	248
249	3300025927	Ga0207687_10118586	Ga0207687_101185861	248
250	3300025932	Ga0207690_10135655	Ga0207690_101356551	248
251	3300025934	Ga0207686_10021947	Ga0207686_100219473	248
252	3300025935	Ga0207709_10017427	Ga0207709_100174273	248
253	3300025936	Ga0207670_10331343	Ga0207670_103313432	248
254	3300025937	Ga0207669_10097801	Ga0207669_100978012	248
255	3300025938	Ga0207704_10300515	Ga0207704_103005152	248
256	3300025941	Ga0207711_10134086	Ga0207711_101340862	248
257	3300025941	Ga0207711_10197833	Ga0207711_101978332	248
258	3300025945	Ga0207679_10281409	Ga0207679_102814092	248
259	3300025949	Ga0207667_10011991	Ga0207667_1001199111	248
260	3300025949	Ga0207667_10151005	Ga0207667_101510052	248
261	3300025960	Ga0207651_10637042	Ga0207651_106370421	248
262	3300026023	Ga0207677_10025708	Ga0207677_100257082	248
263	3300026035	Ga0207703_10011865	Ga0207703_100118654	248
264	3300026035	Ga0207703_10032251	Ga0207703_100322516	248
265	3300026035	Ga0207703_10124138	Ga0207703_101241382	248
266	3300026041	Ga0207639_10138726	Ga0207639_101387262	248
267	3300026075	Ga0207708_10127147	Ga0207708_101271471	248
268	3300026089	Ga0207648_10213215	Ga0207648_102132152	248
269	3300026089	Ga0207648_10996872	Ga0207648_109968721	248
270	3300026142	Ga0207698_10008141	Ga0207698_100081414	248
271	3300026142	Ga0207698_10022780	Ga0207698_100227805	248
272	3300026142	Ga0207698_10026891	Ga0207698_100268912	248
273	3300027876	Ga0209974_10048612	Ga0209974_100486122	248
274	3300028379	Ga0268266_10120517	Ga0268266_101205173	248
275	3300028381	Ga0268264_11131110	Ga0268264_111311101	248
276	3300031507	Ga0307509_10507765	Ga0307509_105077651	248
277	3300031548	Ga0307408_100504803	Ga0307408_1005048031	248
278	3300031731	Ga0307405_10182580	Ga0307405_101825802	248
279	3300032002	Ga0307416_100833044	Ga0307416_1008330441	248
280	3300035119	Ga0373956_0155696	Ga0373956_0155696_299_1045	248
281	3300035120	Ga0373957_0087992	Ga0373957_0087992_403_1149	248
282	3300035172	Ga0373955_0023103	Ga0373955_0023103_961_1707	248
283	3300035691	Ga0373931_0169927	Ga0373931_0169927_318_1064	248
284	3300035691	Ga0373931_0260880	Ga0373931_0260880_227_973	248
285	3300036401	Ga0373937_0017384	Ga0373937_0017384_5485_6231	248
286	3300036401	Ga0373937_0033099	Ga0373937_0033099_2311_3057	248
287	3300037068	Ga0373925_0039325	Ga0373925_0039325_1204_1950	248
288	3300037418	Ga0395900_0037630	Ga0395900_0037630_627_1373	248
289	3300037418	Ga0395900_0127341	Ga0395900_0127341_978_1724	248
290	3300037471	Ga0395905_0086158	Ga0395905_0086158_384_1130	248
291	3300037853	Ga0436364_0889551	Ga0436364_0889551_1412_2194	248
292	3300038443	Ga0395901_0093547	Ga0395901_0093547_799_1545	248
293	3300044656	Ga0466969_0037812	Ga0466969_0037812_1475_2221	248
294	3300044683	Ga0466965_0252326	Ga0466965_0252326_31_777	248
295	3300044684	Ga0466966_0011448	Ga0466966_0011448_5103_5849	248
296	3300044693	Ga0466961_0009286	Ga0466961_0009286_1800_2546	248
297	3300044735	Ga0466968_0039429	Ga0466968_0039429_68_814	248
298	3300044765	Ga0466970_0022302	Ga0466970_0022302_2328_3074	248
299	3300045049	Ga0466959_0004590	Ga0466959_0004590_2684_3430	248
300	3300045051	Ga0451576_0181633	Ga0451576_0181633_667_1413	248
301	3300045836	Ga0466958_0099447	Ga0466958_0099447_532_1407	248
302	3300045836	Ga0466958_0219823	Ga0466958_0219823_253_999	248
303	3300046454	Ga0495592_0199156	Ga0495592_0199156_460_1206	248
304	3300046462	Ga0495651_0116705	Ga0495651_0116705_298_1044	248
305	3300046462	Ga0495651_0273579	Ga0495651_0273579_18_776	248
306	3300046516	Ga0495628_0087532	Ga0495628_0087532_685_1431	248
307	3300046529	Ga0495652_0113089	Ga0495652_0113089_959_1705	248
308	3300046536	Ga0495587_0214537	Ga0495587_0214537_14_772	248
309	3300046539	Ga0495621_0011563	Ga0495621_0011563_1596_2342	248
310	3300046539	Ga0495621_0075064	Ga0495621_0075064_155_901	248
311	3300046543	Ga0495645_0005153	Ga0495645_0005153_6239_6985	248
312	3300046675	Ga0495657_0011902	Ga0495657_0011902_5223_5969	248
313	3300046679	Ga0495623_0007552	Ga0495623_0007552_3386_4132	248
314	3300047471	Ga0495684_0106908	Ga0495684_0106908_454_1200	248
315	3300047471	Ga0495684_0228193	Ga0495684_0228193_244_1002	248
316	3300048088	Ga0495602_0132235	Ga0495602_0132235_276_1022	248
317	3300048907	Ga0496104_0036947	Ga0496104_0036947_583_1482	248
318	3300048908	Ga0496105_0614299	Ga0496105_0614299_41_787	248
319	3300048911	Ga0496108_0051465	Ga0496108_0051465_2361_3260	248
320	3300048913	Ga0496110_0211569	Ga0496110_0211569_656_1555	248
321	3300049571	Ga0501034_0053618	Ga0501034_0053618_2939_3685	248
322	3300049580	Ga0501046_0063185	Ga0501046_0063185_1565_2311	248
323	3300049581	Ga0501047_0010991	Ga0501047_0010991_2631_3377	248
324	3300049585	Ga0501069_0011736	Ga0501069_0011736_789_1535	248
325	3300049586	Ga0501070_0005410	Ga0501070_0005410_9480_10226	248
326	3300049589	Ga0501073_0001548	Ga0501073_0001548_9074_9820	248
327	3300049590	Ga0501074_0001537	Ga0501074_0001537_4682_5428	248
328	3300049741	Ga0501079_0001387	Ga0501079_0001387_5066_5812	248
329	3300049741	Ga0501079_0096572	Ga0501079_0096572_1441_2190	248
330	3300049742	Ga0501080_0007140	Ga0501080_0007140_2288_3034	248
331	3300049742	Ga0501080_0036414	Ga0501080_0036414_2863_3609	248
332	3300049744	Ga0501083_0010528	Ga0501083_0010528_1200_1946	248
333	3300049823	Ga0501044_0180039	Ga0501044_0180039_181_927	248
334	3300049824	Ga0501045_0035071	Ga0501045_0035071_471_1220	248
335	3300050493	nmdc:mga0k408_93402_c1	nmdc:mga0k408_93402_c1_17_763	248
336	3300050514	nmdc:mga08x19_18547_c1	nmdc:mga08x19_18547_c1_1551_2297	248
337	3300050515	nmdc:mga0a205_163871_c1	nmdc:mga0a205_163871_c1_391_1137	248
338	3300053077	Ga0495601_0009477	Ga0495601_0009477_3453_4199	248
339	3300053077	Ga0495601_0020065	Ga0495601_0020065_2843_3601	248
340	3300053084	Ga0495595_0116208	Ga0495595_0116208_315_1073	248
341	3300053085	Ga0495619_0071570	Ga0495619_0071570_1118_1876	248
342	3300054114	Ga0501084_0307134	Ga0501084_0307134_581_1327	248
343	3300060353	Ga0501082_0095350	Ga0501082_0095350_393_1139	248
344	3300037853	Ga0436364_0886429	Ga0436364_0886429_1580_2353	249
345	3300003791	Ga0055530_10005509	Ga0055530_100055093	250
346	3300005330	Ga0070690_100058231	Ga0070690_1000582311	250
347	3300005334	Ga0068869_100002779	Ga0068869_1000027797	250
348	3300005338	Ga0068868_100018512	Ga0068868_1000185123	250
349	3300005340	Ga0070689_100000897	Ga0070689_1000008977	250
350	3300005341	Ga0070691_10025247	Ga0070691_100252471	250
351	3300005343	Ga0070687_100042273	Ga0070687_1000422733	250
352	3300005343	Ga0070687_100155986	Ga0070687_1001559863	250
353	3300005345	Ga0070692_10002893	Ga0070692_100028934	250
354	3300005365	Ga0070688_100078803	Ga0070688_1000788032	250
355	3300005438	Ga0070701_10001357	Ga0070701_100013577	250
356	3300005441	Ga0070700_100004510	Ga0070700_1000045103	250
357	3300005444	Ga0070694_100019019	Ga0070694_1000190192	250
358	3300005444	Ga0070694_100281243	Ga0070694_1002812432	250
359	3300005456	Ga0070678_100022566	Ga0070678_1000225661	250
360	3300005459	Ga0068867_100002210	Ga0068867_1000022104	250
361	3300005466	Ga0070685_10026219	Ga0070685_100262192	250
362	3300005530	Ga0070679_100214174	Ga0070679_1002141742	250
363	3300005535	Ga0070684_100723817	Ga0070684_1007238171	250
364	3300005539	Ga0068853_100002422	Ga0068853_1000024223	250
365	3300005544	Ga0070686_100000270	Ga0070686_1000002705	250
366	3300005544	Ga0070686_100078548	Ga0070686_1000785482	250
367	3300005546	Ga0070696_100022191	Ga0070696_1000221912	250
368	3300005547	Ga0070693_100007768	Ga0070693_1000077683	250
369	3300005549	Ga0070704_100021844	Ga0070704_1000218443	250
370	3300005549	Ga0070704_100547985	Ga0070704_1005479851	250
371	3300005563	Ga0068855_100026410	Ga0068855_1000264107	250
372	3300005563	Ga0068855_100772304	Ga0068855_1007723042	250
373	3300005564	Ga0070664_100087975	Ga0070664_1000879753	250
374	3300005577	Ga0068857_100012149	Ga0068857_1000121496	250
375	3300005577	Ga0068857_100086437	Ga0068857_1000864371	250
376	3300005615	Ga0070702_100002030	Ga0070702_1000020305	250
377	3300005719	Ga0068861_100001749	Ga0068861_1000017499	250
378	3300005842	Ga0068858_100083046	Ga0068858_1000830463	250
379	3300005843	Ga0068860_100021954	Ga0068860_1000219545	250
380	3300005844	Ga0068862_100006423	Ga0068862_1000064233	250
381	3300006038	Ga0075365_10056389	Ga0075365_100563892	250
382	3300006038	Ga0075365_10056487	Ga0075365_100564873	250
383	3300006042	Ga0075368_10002292	Ga0075368_100022925	250
384	3300006048	Ga0075363_100002082	Ga0075363_1000020825	250
385	3300006177	Ga0075362_10024208	Ga0075362_100242082	250
386	3300006178	Ga0075367_10006845	Ga0075367_100068452	250
387	3300006186	Ga0075369_10014097	Ga0075369_100140973	250
388	3300006195	Ga0075366_10010316	Ga0075366_100103166	250
389	3300006237	Ga0097621_100003978	Ga0097621_1000039788	250
390	3300006353	Ga0075370_10006969	Ga0075370_100069693	250
391	3300006358	Ga0068871_100005621	Ga0068871_1000056213	250
392	3300006358	Ga0068871_100360664	Ga0068871_1003606641	250
393	3300006881	Ga0068865_100012821	Ga0068865_1000128215	250
394	3300009094	Ga0111539_10015176	Ga0111539_100151766	250
395	3300009098	Ga0105245_10001133	Ga0105245_100011331	250
396	3300009098	Ga0105245_10223192	Ga0105245_102231922	250
397	3300009148	Ga0105243_10021212	Ga0105243_100212121	250
398	3300009174	Ga0105241_10047540	Ga0105241_100475402	250
399	3300009176	Ga0105242_10014999	Ga0105242_100149991	250
400	3300009177	Ga0105248_10122627	Ga0105248_101226272	250
401	3300009545	Ga0105237_10088438	Ga0105237_100884383	250
402	3300009551	Ga0105238_10208092	Ga0105238_102080921	250
403	3300009553	Ga0105249_10047287	Ga0105249_100472874	250
404	3300009553	Ga0105249_10127137	Ga0105249_101271371	250
405	3300010375	Ga0105239_10155985	Ga0105239_101559853	250
406	3300013297	Ga0157378_10546437	Ga0157378_105464372	250
407	3300013306	Ga0163162_10239079	Ga0163162_102390792	250
408	3300013308	Ga0157375_10042743	Ga0157375_100427433	250
409	3300014326	Ga0157380_10000503	Ga0157380_1000050314	250
410	3300025298	Ga0209050_1000307	Ga0209050_100030728	250
411	3300025899	Ga0207642_10155489	Ga0207642_101554892	250
412	3300025912	Ga0207707_10001852	Ga0207707_1000185210	250
413	3300025915	Ga0207693_10036829	Ga0207693_100368292	250
414	3300025918	Ga0207662_10023682	Ga0207662_100236823	250
415	3300025918	Ga0207662_10129693	Ga0207662_101296933	250
416	3300025921	Ga0207652_10173749	Ga0207652_101737492	250
417	3300025924	Ga0207694_10227076	Ga0207694_102270762	250
418	3300025927	Ga0207687_10007502	Ga0207687_100075023	250
419	3300025927	Ga0207687_10060931	Ga0207687_100609311	250
420	3300025934	Ga0207686_10000457	Ga0207686_1000045719	250
421	3300025935	Ga0207709_10009703	Ga0207709_100097033	250
422	3300025936	Ga0207670_10047903	Ga0207670_100479033	250
423	3300025938	Ga0207704_10000502	Ga0207704_1000050211	250
424	3300025942	Ga0207689_10000326	Ga0207689_1000032644	250
425	3300025945	Ga0207679_10257783	Ga0207679_102577832	250
426	3300025949	Ga0207667_10116296	Ga0207667_101162962	250
427	3300025961	Ga0207712_10028968	Ga0207712_100289684	250
428	3300026035	Ga0207703_10065690	Ga0207703_100656903	250
429	3300026041	Ga0207639_10020743	Ga0207639_100207433	250
430	3300026075	Ga0207708_10001097	Ga0207708_100010976	250
431	3300026089	Ga0207648_10000213	Ga0207648_1000021344	250
432	3300026116	Ga0207674_10103351	Ga0207674_101033511	250
433	3300026116	Ga0207674_10108605	Ga0207674_101086053	250
434	3300026118	Ga0207675_100000234	Ga0207675_10000023442	250
435	3300026118	Ga0207675_100335917	Ga0207675_1003359173	250
436	3300026121	Ga0207683_10044187	Ga0207683_100441874	250
437	3300027907	Ga0207428_10188099	Ga0207428_101880992	250
438	3300028380	Ga0268265_10050407	Ga0268265_100504073	250
439	3300028381	Ga0268264_10060341	Ga0268264_100603413	250
440	3300028577	Ga0265318_10024443	Ga0265318_100244432	250
441	3300028800	Ga0265338_10018617	Ga0265338_100186174	250
442	3300030521	Ga0307511_10002862	Ga0307511_100028627	250
443	3300031240	Ga0265320_10024691	Ga0265320_100246912	250
444	3300031251	Ga0265327_10066434	Ga0265327_100664342	250
445	3300031251	Ga0265327_10193581	Ga0265327_101935811	250
446	3300036401	Ga0373937_0918542	Ga0373937_0918542_46_798	250
447	3300039450	Ga0436363_0088912	Ga0436363_0088912_970_1749	250
448	3300048911	Ga0496108_0107679	Ga0496108_0107679_670_1422	250
449	3300049571	Ga0501034_0000839	Ga0501034_0000839_39849_40601	250
450	3300049584	Ga0501068_0155533	Ga0501068_0155533_234_986	250
451	3300049589	Ga0501073_0012078	Ga0501073_0012078_3724_4476	250
452	3300049590	Ga0501074_0179542	Ga0501074_0179542_36_788	250
453	3300049742	Ga0501080_0004041	Ga0501080_0004041_133_885	250
454	3300049744	Ga0501083_0217094	Ga0501083_0217094_435_1187	250
455	3300050489	nmdc:mga03683_18261_c1	nmdc:mga03683_18261_c1_1280_2038	250
456	3300050490	nmdc:mga03n38_3788_c1	nmdc:mga03n38_3788_c1_3332_4090	250
457	3300050491	nmdc:mga00v17_54690_c1	nmdc:mga00v17_54690_c1_1071_1829	250
458	3300050492	nmdc:mga0yw44_163777_c1	nmdc:mga0yw44_163777_c1_381_1193	250
459	3300050493	nmdc:mga0k408_55518_c1	nmdc:mga0k408_55518_c1_796_1554	250
460	3300050494	nmdc:mga06z11_39312_c1	nmdc:mga06z11_39312_c1_853_1611	250
461	3300050495	nmdc:mga04h51_16878_c1	nmdc:mga04h51_16878_c1_625_1383	250
462	3300050511	nmdc:mga08y16_23793_c1	nmdc:mga08y16_23793_c1_3202_3954	250
463	3300050516	nmdc:mga0sz30_45165_c1	nmdc:mga0sz30_45165_c1_691_1449	250
464	3300053090	Ga0500646_0000341	Ga0500646_0000341_176_943	250
465	3300053092	Ga0500583_0014363	Ga0500583_0014363_823_1590	250
466	3300053118	Ga0500594_0039426	Ga0500594_0039426_73_831	250
467	3300053133	Ga0500655_007728	Ga0500655_007728_427_1194	250
468	3300053139	Ga0500568_0081048	Ga0500568_0081048_83_850	250
469	3300053151	Ga0500604_0000721	Ga0500604_0000721_7692_8459	250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

55

247

0.96 PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

61

292

0.94 PF08659

KR

KR domain

56

234

0.83 PF01370

Epimerase

NAD dependent epimerase/dehydratase family

57

254

0.73 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6d9y-assembly1.cif.gz_A	crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied nad	0.9773	1	250
1q7b-assembly1.cif.gz_D	the structure of betaketoacyl-[acp] reductase from e. coli in complex with nadp+	0.9742	5	250
1q7c-assembly1.cif.gz_A	the structure of betaketoacyl-[acp] reductase y151f mutant in complex with nadph fragment	0.9735	5	250
6d9y-assembly1.cif.gz_A	crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied nad	0.9735	1	250
5h5x-assembly3.cif.gz_J	crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor	0.9734	8	247

ID	Description	Score	Start	End	Superfamily
af_Q0JDU3_1_168_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9741	83	249	3.40.50.720
4urfA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.973	6	247	3.40.50.720
5h5xG00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9719	7	247	3.40.50.720
1ulsC00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9717	6	247	3.40.50.720
6ixmB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9716	6	248	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A529KSY7-F1-model_v4	SDR family oxidoreductase	0.994	58	250	GO:0016491
AF-A0A522H321-F1-model_v4	SDR family oxidoreductase	0.9915	2	250	GO:0016616 GO:0030497
AF-A0A4Q3IM80-F1-model_v4	SDR family oxidoreductase	0.9893	1	250	GO:0016616
AF-A0A531KXH2-F1-model_v4	SDR family oxidoreductase	0.9888	59	250	GO:0016491
AF-A0A317H4X7-F1-model_v4	3-oxoacyl-ACP reductase	0.9884	67	250	GO:0016616 GO:0030497

Feature Viewer

pLDDT	pTM	Quality
94.6	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F450238

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00106

adh_short

short chain dehydrogenase

55

247

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

61

292

0.94

PF08659

KR

KR domain

56

234

0.83

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

57

254

0.73

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map