F450232

General Info

Members Datasets Scaffolds Average Seq Length
469 245 395 268

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10266997|Ga0105249_102669972
Length 319
Sequence VKTSRPLRPDGYVSPPSRQNDPAGGGGRAGSRRTGARHARLTGLLSEAAGNTSRMTFDPRYAIVTASDSGIGKATAVALAEAGMDIGVTWHSDAEGAEATADEVRSHGRKAIIKQLDYTDLPSCAVSIDLLIKDLGGLDVFVNNAGTGHSQMLVDTSYDEWRKIIATNLDGTFVCMRQAAKHMVKTGNGGRLIAVTSVHEHQPRVGSGPYDAAKHGIGGLIKTFALELGQHNITANAVAPGEIATPMTGQEDEDPRNAERLGIPLGRPGDAREIAAVIAFLASPQAGYVTGASWVVDGGMLQMGPQAGSHLTSNDWRKA

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221566 Microbacterium sp. Root166 Isolate Unclassified
5 2643221572 Leifsonia sp. Root60 Isolate Unclassified
6 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
7 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
8 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
9 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
10 2773857759 Microbacterium sp. 1294 Isolate Unclassified
11 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
12 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
13 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
14 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
15 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
16 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
17 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
18 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
19 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
20 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
21 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
22 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
23 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
24 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
25 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
26 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
27 2867428634 Streptomyces sp. RP5T Isolate Unclassified
28 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
29 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
30 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
31 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
32 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
33 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
34 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
35 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
36 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
37 2919069694 Microbacterium sp. 1154 Isolate Unclassified
38 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
39 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
40 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
41 2920879853 Kocuria salina CV6 Isolate Unclassified
42 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
43 2928153084 Leifsonia sp. 563 Isolate Unclassified
44 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
45 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
46 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
47 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
48 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
49 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
50 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
51 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
52 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
53 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
54 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
55 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
56 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
57 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
58 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
59 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
60 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
61 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
62 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
63 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
64 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
65 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
66 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
67 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
68 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
69 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
70 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
71 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
72 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
73 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
74 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
75 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
78 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
79 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
80 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
81 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
84 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
148 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
149 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
154 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
155 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
159 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
160 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
161 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
165 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
227 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
239 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
240 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
243 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
244 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
245 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.58
Metatranscriptomes 0.64
Isolates 15.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 1.49
Rhizosphere 78.89
Stem 0
Stem Tuber 0
Unclassified 15.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10047189 3300001979 Bacteria 1259
2 JGI24739J22299_10078048 3300001989 Bacteria 1020
3 JGI24737J22298_10004072 3300001990 Bacteria 5113
4 JGI24735J21928_10000774 3300002067 Bacteria 11375
5 JGI25406J46586_10016057 3300003203 Bacteria 3134
6 JGI25407J50210_10013660 3300003373 Bacteria 2088
7 Ga0006562J51391_1131095 3300003578 Bacteria 8170
8 Ga0006562J51391_1131096 3300003578 Bacteria 6981
9 Ga0055539_1000014 3300003752 Bacteria 381086
10 Ga0055533_1000002 3300003756 Bacteria 1196393
11 Ga0055525_1000115 3300003759 Bacteria 121883
12 Ga0055541_1006477 3300003841 Bacteria 1981
13 Ga0070682_100043320 3300005337 Bacteria 2783
14 Ga0070713_100077506 3300005436 Bacteria 2826
15 Ga0070710_10218935 3300005437 Bacteria 1210
16 Ga0070710_10357817 3300005437 Bacteria 968
17 Ga0070664_100282622 3300005564 Bacteria 1497
18 Ga0068854_100195025 3300005578 Bacteria 1589
19 Ga0081455_10054104 3300005937 Bacteria 3424
20 Ga0081455_10069395 3300005937 Bacteria 2931
21 Ga0081538_10000771 3300005981 Bacteria 35031
22 Ga0081539_10000057 3300005985 Bacteria 256264
23 Ga0081539_10156486 3300005985 Bacteria 1091
24 Ga0070717_10284057 3300006028 Bacteria 1468
25 Ga0075364_10033829 3300006051 Bacteria 3294
26 Ga0075364_10091051 3300006051 Bacteria 2023
27 Ga0075428_100032453 3300006844 Bacteria 5767
28 Ga0075428_100266681 3300006844 Bacteria 1843
29 Ga0075434_100000025 3300006871 Bacteria 68254
30 Ga0075436_100000835 3300006914 Bacteria 20485
31 Ga0111539_10000213 3300009094 Bacteria 69372
32 Ga0111539_10159848 3300009094 Bacteria 2635
33 Ga0105243_10004239 3300009148 Bacteria 11361
34 Ga0105242_10008842 3300009176 Bacteria 7729
35 Ga0105249_10266997 3300009553 Bacteria 1703
36 Ga0157342_1000903 3300012507 Bacteria 2023
37 Ga0157370_10595083 3300013104 Bacteria 1013
38 Ga0157369_10482180 3300013105 Bacteria 1283
39 Ga0157369_10577486 3300013105 Bacteria 1161
40 Ga0157369_10584924 3300013105 Bacteria 1153
41 Ga0163162_10311956 3300013306 Bacteria 1705
42 Ga0157372_10296891 3300013307 Bacteria 1879
43 Ga0157376_10043531 3300014969 Bacteria 3685
44 Ga0213875_10000926 3300021388 Bacteria 21146
45 Ga0213875_10022529 3300021388 Bacteria 3012
46 Ga0209566_100056 3300025225 Bacteria 209595
47 Ga0209674_100001 3300025226 Bacteria 4013750
48 Ga0209563_100001 3300025230 Bacteria 4013775
49 Ga0209563_100383 3300025230 Bacteria 16023
50 Ga0209646_1000014 3300025246 Bacteria 550484
51 Ga0209677_100001 3300025253 Bacteria 4013787
52 Ga0209455_1000955 3300025272 Bacteria 14743
53 Ga0209051_1001502 3300025303 Bacteria 19482
54 Ga0207682_10089454 3300025893 Bacteria 1333
55 Ga0207692_10032942 3300025898 Bacteria 2495
56 Ga0207692_10071807 3300025898 Bacteria 1826
57 Ga0207662_10102819 3300025918 Bacteria 1772
58 Ga0207664_10051319 3300025929 Bacteria 3256
59 Ga0207686_10107818 3300025934 Bacteria 1873
60 Ga0207709_10004568 3300025935 Bacteria 7969
61 Ga0207668_10094008 3300025972 Bacteria 2210
62 Ga0207640_10038206 3300025981 Bacteria 3028
63 Ga0207702_10677077 3300026078 Bacteria 1016
64 Ga0207428_10000342 3300027907 Bacteria 60624
65 Ga0307408_100046984 3300031548 Bacteria 3089
66 Ga0307408_100051977 3300031548 Bacteria 2954
67 Ga0307408_100066530 3300031548 Bacteria 2647
68 Ga0307408_100070770 3300031548 Bacteria 2577
69 Ga0307408_100126737 3300031548 Bacteria 1986
70 Ga0307408_100129462 3300031548 Bacteria 1967
71 Ga0307408_100267570 3300031548 Bacteria 1417
72 Ga0307408_100576349 3300031548 Bacteria 996
73 Ga0307405_10011886 3300031731 Bacteria 4583
74 Ga0307405_10033083 3300031731 Bacteria 3063
75 Ga0307405_10059580 3300031731 Bacteria 2406
76 Ga0307405_10378989 3300031731 Bacteria 1100
77 Ga0307413_10003752 3300031824 Bacteria 6466
78 Ga0307413_10036530 3300031824 Bacteria 2829
79 Ga0307413_10212582 3300031824 Bacteria 1406
80 Ga0307413_10233258 3300031824 Bacteria 1353
81 Ga0307413_10340246 3300031824 Bacteria 1154
82 Ga0307413_10365384 3300031824 Bacteria 1119
83 Ga0307410_10000152 3300031852 Bacteria 24788
84 Ga0307410_10012680 3300031852 Bacteria 4884
85 Ga0307410_10023224 3300031852 Bacteria 3851
86 Ga0307410_10053896 3300031852 Bacteria 2723
87 Ga0307410_10079999 3300031852 Bacteria 2292
88 Ga0307410_10143094 3300031852 Bacteria 1771
89 Ga0307410_10513975 3300031852 Bacteria 987
90 Ga0307406_10000005 3300031901 Bacteria 155981
91 Ga0307406_10007718 3300031901 Bacteria 5976
92 Ga0307406_10008600 3300031901 Bacteria 5699
93 Ga0307406_10014800 3300031901 Bacteria 4496
94 Ga0307406_10052540 3300031901 Bacteria 2592
95 Ga0307406_10066727 3300031901 Bacteria 2343
96 Ga0307406_10123007 3300031901 Bacteria 1807
97 Ga0307406_10189340 3300031901 Bacteria 1505
98 Ga0307406_10488973 3300031901 Bacteria 995
99 Ga0307407_10009652 3300031903 Bacteria 4507
100 Ga0307407_10016515 3300031903 Bacteria 3677
101 Ga0307407_10029215 3300031903 Bacteria 2958
102 Ga0307407_10035916 3300031903 Bacteria 2726
103 Ga0307407_10123233 3300031903 Bacteria 1647
104 Ga0307407_10137533 3300031903 Bacteria 1572
105 Ga0307407_10475570 3300031903 Bacteria 911
106 Ga0307412_10004864 3300031911 Bacteria 7500
107 Ga0307412_10022135 3300031911 Bacteria 3892
108 Ga0307412_10029819 3300031911 Bacteria 3427
109 Ga0307412_10030851 3300031911 Bacteria 3380
110 Ga0307412_10057353 3300031911 Bacteria 2599
111 Ga0307412_10066377 3300031911 Bacteria 2445
112 Ga0307412_10130188 3300031911 Bacteria 1826
113 Ga0307412_10192625 3300031911 Bacteria 1542
114 Ga0307412_10225456 3300031911 Bacteria 1439
115 Ga0307412_10268543 3300031911 Bacteria 1334
116 Ga0307412_10356018 3300031911 Bacteria 1177
117 Ga0307412_10392942 3300031911 Bacteria 1126
118 Ga0307412_10610317 3300031911 Bacteria 925
119 Ga0307409_100000001 3300031995 Bacteria 93927
120 Ga0307409_100038279 3300031995 Bacteria 3546
121 Ga0307409_100146827 3300031995 Bacteria 2041
122 Ga0307409_100196252 3300031995 Bacteria 1802
123 Ga0307409_100296246 3300031995 Bacteria 1502
124 Ga0307409_100580932 3300031995 Bacteria 1104
125 Ga0307409_100656551 3300031995 Bacteria 1043
126 Ga0307409_100744376 3300031995 Bacteria 983
127 Ga0307409_100794856 3300031995 Bacteria 953
128 Ga0307416_100000115 3300032002 Bacteria 48098
129 Ga0307416_100015053 3300032002 Bacteria 5326
130 Ga0307416_100038363 3300032002 Bacteria 3696
131 Ga0307416_100142154 3300032002 Bacteria 2183
132 Ga0307416_100312701 3300032002 Bacteria 1568
133 Ga0307416_100605308 3300032002 Bacteria 1176
134 Ga0307416_100608258 3300032002 Bacteria 1173
135 Ga0307416_100857510 3300032002 Bacteria 1006
136 Ga0307414_10226947 3300032004 Bacteria 1537
137 Ga0307414_10283223 3300032004 Bacteria 1394
138 Ga0307414_10468440 3300032004 Bacteria 1109
139 Ga0307414_10583479 3300032004 Bacteria 1000
140 Ga0307411_10026317 3300032005 Bacteria 3502
141 Ga0307411_10043832 3300032005 Bacteria 2865
142 Ga0307411_10070994 3300032005 Bacteria 2358
143 Ga0307415_100021140 3300032126 Bacteria 3993
144 Ga0307415_100033934 3300032126 Bacteria 3317
145 Ga0307415_100059477 3300032126 Bacteria 2635
146 Ga0307415_100064043 3300032126 Bacteria 2557
147 Ga0307415_100318635 3300032126 Bacteria 1295
148 Ga0373936_0079694 3300035113 Bacteria 1361
149 Ga0373945_0000347 3300035116 Bacteria 13239
150 Ga0373946_0001241 3300035171 Bacteria 8824
151 Ga0373924_0049969 3300035410 Bacteria 1732
152 Ga0373947_0004744 3300035725 Bacteria 7973
153 Ga0373937_0247898 3300036401 Bacteria 1679
154 Ga0395900_0012691 3300037418 Bacteria 8612
155 Ga0395900_0018280 3300037418 Bacteria 7151
156 Ga0395900_0284564 3300037418 Bacteria 1644
157 Ga0395898_0002748 3300037466 Bacteria 20290
158 Ga0395898_0021707 3300037466 Bacteria 6507
159 Ga0395898_0062910 3300037466 Bacteria 3602
160 Ga0395898_0118045 3300037466 Bacteria 2541
161 Ga0395898_0129657 3300037466 Bacteria 2416
162 Ga0395898_0135212 3300037466 Bacteria 2360
163 Ga0395898_0176358 3300037466 Bacteria 2043
164 Ga0395905_0038861 3300037471 Bacteria 4464
165 Ga0395905_0326720 3300037471 Bacteria 1424
166 Ga0436364_0010465 3300037853 Bacteria 29518
167 Ga0436364_0632303 3300037853 Bacteria 5552
168 Ga0436364_0645062 3300037853 Bacteria 2389
169 Ga0395901_0026970 3300038443 Bacteria 5899
170 Ga0395901_0039649 3300038443 Bacteria 4875
171 Ga0395901_0057757 3300038443 Bacteria 4035
172 Ga0395901_0147537 3300038443 Bacteria 2472
173 Ga0395901_0300808 3300038443 Bacteria 1663
174 Ga0439436_0085134 3300041404 Bacteria 880
175 Ga0439438_006610 3300041405 Bacteria 4066
176 Ga0439438_030648 3300041405 Bacteria 1433
177 Ga0439447_042806 3300041407 Bacteria 1099
178 Ga0439466_0032366 3300041411 Bacteria 1783
179 Ga0451793_1696121 3300041452 Bacteria 1373
180 Ga0451797_1114751 3300041453 Bacteria 1394
181 Ga0451797_1322653 3300041453 Bacteria 1186
182 Ga0451853_2482725 3300041512 Bacteria 1613
183 Ga0451853_2922145 3300041512 Bacteria 1457
184 Ga0439433_0000747 3300041999 Bacteria 6401
185 Ga0439442_000548 3300042002 Bacteria 8290
186 Ga0439442_000579 3300042002 Bacteria 7915
187 Ga0439442_003228 3300042002 Bacteria 3224
188 Ga0439442_013965 3300042002 Bacteria 1652
189 Ga0439432_008644 3300042006 Bacteria 3573
190 Ga0439432_011937 3300042006 Bacteria 2985
191 Ga0439449_0004875 3300042007 Bacteria 5169
192 Ga0439449_0079713 3300042007 Bacteria 1207
193 Ga0439462_0017388 3300042015 Bacteria 1862
194 Ga0439463_006678 3300042016 Bacteria 2855
195 Ga0450920_000926 3300042122 Bacteria 4766
196 Ga0450907_001291 3300042146 Bacteria 5589
197 Ga0450907_002858 3300042146 Bacteria 3185
198 Ga0439458_0056294 3300042157 Bacteria 977
199 Ga0439434_0000349 3300042435 Bacteria 13188
200 Ga0439434_0031789 3300042435 Bacteria 1605
201 Ga0439460_0121594 3300042461 Bacteria 854
202 Ga0450918_002590 3300042531 Bacteria 3419
203 Ga0439440_0008708 3300042993 Bacteria 2088
204 Ga0439440_0024314 3300042993 Bacteria 1388
205 Ga0466972_0002329 3300044658 Bacteria 9352
206 Ga0466972_0005622 3300044658 Bacteria 6282
207 Ga0466972_0130045 3300044658 Bacteria 1186
208 Ga0466972_0189919 3300044658 Bacteria 963
209 Ga0466965_0013199 3300044683 Bacteria 3894
210 Ga0466965_0030150 3300044683 Bacteria 2641
211 Ga0466965_0074905 3300044683 Bacteria 1706
212 Ga0466965_0078168 3300044683 Bacteria 1671
213 Ga0466966_0006301 3300044684 Bacteria 7851
214 Ga0466966_0061767 3300044684 Bacteria 2363
215 Ga0466966_0145230 3300044684 Bacteria 1448
216 Ga0466961_0026738 3300044693 Bacteria 3710
217 Ga0466961_0043325 3300044693 Bacteria 2883
218 Ga0466961_0081124 3300044693 Bacteria 2053
219 Ga0466961_0176456 3300044693 Bacteria 1327
220 Ga0466961_0206257 3300044693 Bacteria 1214
221 Ga0466961_0375033 3300044693 Bacteria 864
222 Ga0466961_0384559 3300044693 Bacteria 852
223 Ga0466963_0009180 3300044694 Bacteria 5949
224 Ga0466963_0012297 3300044694 Bacteria 5235
225 Ga0466963_0019980 3300044694 Bacteria 4209
226 Ga0466963_0033537 3300044694 Bacteria 3334
227 Ga0466963_0150616 3300044694 Bacteria 1615
228 Ga0466963_0366366 3300044694 Bacteria 1015
229 Ga0466971_0002644 3300044719 Bacteria 7576
230 Ga0466971_0038859 3300044719 Bacteria 2136
231 Ga0466971_0100374 3300044719 Bacteria 1330
232 Ga0466971_0100735 3300044719 Bacteria 1327
233 Ga0466968_0016560 3300044735 Bacteria 2937
234 Ga0466968_0037960 3300044735 Bacteria 2023
235 Ga0466970_0003201 3300044765 Bacteria 7959
236 Ga0466970_0009722 3300044765 Bacteria 4866
237 Ga0466970_0019867 3300044765 Bacteria 3486
238 Ga0466970_0023271 3300044765 Bacteria 3235
239 Ga0466970_0029652 3300044765 Bacteria 2882
240 Ga0466970_0128952 3300044765 Bacteria 1388
241 Ga0466970_0139290 3300044765 Bacteria 1336
242 Ga0466957_0020735 3300044842 Bacteria 3869
243 Ga0466957_0054399 3300044842 Bacteria 2443
244 Ga0466957_0054632 3300044842 Bacteria 2438
245 Ga0466957_0100232 3300044842 Bacteria 1825
246 Ga0466960_0035280 3300044901 Bacteria 2336
247 Ga0466960_0056961 3300044901 Bacteria 1905
248 Ga0466959_0006710 3300045049 Bacteria 8008
249 Ga0466959_0053027 3300045049 Bacteria 2967
250 Ga0466959_0058590 3300045049 Bacteria 2805
251 Ga0466959_0065095 3300045049 Bacteria 2645
252 Ga0466959_0079890 3300045049 Bacteria 2358
253 Ga0466959_0164223 3300045049 Bacteria 1560
254 Ga0466958_0004498 3300045836 Bacteria 7364
255 Ga0466958_0004664 3300045836 Bacteria 7272
256 Ga0466958_0162470 3300045836 Bacteria 1411
257 Ga0466958_0278043 3300045836 Bacteria 1073
258 Ga0466958_0439669 3300045836 Bacteria 844
259 Ga0466967_0000185 3300045976 Bacteria 25763
260 Ga0466967_0000522 3300045976 Bacteria 18716
261 Ga0466967_0001065 3300045976 Bacteria 15137
262 Ga0466967_0023039 3300045976 Bacteria 5096
263 Ga0466967_0036500 3300045976 Bacteria 4196
264 Ga0466967_0038261 3300045976 Bacteria 4112
265 Ga0466967_0040234 3300045976 Bacteria 4024
266 Ga0466967_0144965 3300045976 Bacteria 2215
267 Ga0466967_0254381 3300045976 Bacteria 1679
268 Ga0466967_0351852 3300045976 Bacteria 1426
269 Ga0495641_0019687 3300046461 Bacteria 3445
270 Ga0495653_0020971 3300046463 Bacteria 5295
271 Ga0495582_0252283 3300046473 Bacteria 1012
272 Ga0495664_0000778 3300046477 Bacteria 16276
273 Ga0495618_0019316 3300046514 Bacteria 4191
274 Ga0495628_0295156 3300046516 Bacteria 1201
275 Ga0495643_0077282 3300046522 Bacteria 1740
276 Ga0495652_0040121 3300046529 Bacteria 4046
277 Ga0495645_0032895 3300046543 Bacteria 3783
278 Ga0495667_0021799 3300046559 Bacteria 4321
279 Ga0495668_0033768 3300046616 Bacteria 2873
280 Ga0495635_0060467 3300046663 Bacteria 2603
281 Ga0495588_0003800 3300046674 Bacteria 6613
282 Ga0495657_0030202 3300046675 Bacteria 3797
283 Ga0495599_0044506 3300046678 Bacteria 2784
284 Ga0495674_0005144 3300047319 Bacteria 12563
285 Ga0495676_0030731 3300047321 Bacteria 4552
286 Ga0495686_0247846 3300047472 Bacteria 1002
287 Ga0496105_0532415 3300048908 Bacteria 919
288 Ga0496109_0042227 3300048912 Bacteria 4130
289 Ga0496109_0320856 3300048912 Bacteria 1462
290 Ga0496110_0047063 3300048913 Bacteria 3775
291 Ga0496117_0000014 3300048920 Bacteria 584427
292 Ga0496117_0000276 3300048920 Bacteria 95844
293 Ga0496117_0003307 3300048920 Bacteria 18847
294 Ga0496117_0191559 3300048920 Bacteria 1164
295 Ga0496118_0214669 3300048921 Bacteria 1126
296 Ga0496119_0001243 3300048922 Bacteria 31699
297 Ga0496119_0006163 3300048922 Bacteria 11216
298 Ga0496119_0045334 3300048922 Bacteria 2757
299 Ga0496120_0001359 3300048923 Bacteria 30036
300 Ga0496120_0003745 3300048923 Bacteria 13474
301 Ga0496120_0011791 3300048923 Bacteria 5983
302 Ga0496121_0000380 3300048924 Bacteria 90959
303 Ga0496122_0004494 3300048925 Bacteria 17244
304 Ga0496122_0004671 3300048925 Bacteria 16822
305 Ga0496122_0010086 3300048925 Bacteria 9807
306 Ga0496123_0024985 3300048926 Bacteria 4519
307 Ga0496123_0025172 3300048926 Bacteria 4496
308 Ga0496123_0043346 3300048926 Bacteria 3092
309 Ga0496124_0015407 3300048927 Bacteria 7328
310 Ga0496124_0074727 3300048927 Bacteria 2801
311 Ga0496124_0081706 3300048927 Bacteria 2655
312 Ga0496125_0000061 3300048928 Bacteria 262739
313 Ga0496125_0069933 3300048928 Bacteria 2750
314 Ga0496125_0104784 3300048928 Bacteria 2070
315 Ga0496126_0007451 3300048929 Bacteria 11999
316 Ga0496126_0057243 3300048929 Bacteria 3521
317 Ga0501031_0002330 3300049568 Bacteria 12023
318 Ga0501032_0000232 3300049569 Bacteria 46458
319 Ga0501032_0002840 3300049569 Bacteria 13476
320 Ga0501032_0003999 3300049569 Bacteria 11180
321 Ga0501032_0381821 3300049569 Bacteria 906
322 Ga0501033_0005204 3300049570 Bacteria 10336
323 Ga0501033_0008633 3300049570 Bacteria 7886
324 Ga0501033_0078425 3300049570 Bacteria 2424
325 Ga0501033_0168944 3300049570 Bacteria 1571
326 Ga0501034_0000075 3300049571 Bacteria 175296
327 Ga0501034_0009603 3300049571 Bacteria 10122
328 Ga0501034_0028975 3300049571 Bacteria 5631
329 Ga0501034_0180586 3300049571 Bacteria 2075
330 Ga0501034_0196471 3300049571 Bacteria 1977
331 Ga0501036_0170653 3300049572 Bacteria 1833
332 Ga0501036_0174962 3300049572 Bacteria 1807
333 Ga0501036_0228437 3300049572 Bacteria 1562
334 Ga0501036_0240251 3300049572 Bacteria 1519
335 Ga0501036_0394996 3300049572 Bacteria 1154
336 Ga0501037_0000226 3300049573 Bacteria 49205
337 Ga0501037_0001709 3300049573 Bacteria 15941
338 Ga0501037_0003920 3300049573 Bacteria 10797
339 Ga0501037_0007156 3300049573 Bacteria 8156
340 Ga0501037_0044087 3300049573 Bacteria 3277
341 Ga0501037_0358407 3300049573 Bacteria 1005
342 Ga0501038_0044880 3300049574 Bacteria 3838
343 Ga0501038_0066196 3300049574 Bacteria 3077
344 Ga0501038_0070120 3300049574 Bacteria 2977
345 Ga0501038_0093314 3300049574 Bacteria 2518
346 Ga0501038_0204636 3300049574 Bacteria 1582
347 Ga0501038_0241759 3300049574 Bacteria 1433
348 Ga0501038_0291806 3300049574 Bacteria 1281
349 Ga0501039_0040666 3300049575 Bacteria 3588
350 Ga0501039_0063796 3300049575 Bacteria 2854
351 Ga0501039_0117851 3300049575 Bacteria 2079
352 Ga0501042_0007436 3300049578 Bacteria 7175
353 Ga0501043_0007593 3300049579 Bacteria 8598
354 Ga0501043_0163969 3300049579 Bacteria 1736
355 Ga0501043_0198198 3300049579 Bacteria 1559
356 Ga0501046_0000067 3300049580 Bacteria 114617
357 Ga0501046_0009307 3300049580 Bacteria 8504
358 Ga0501047_0000056 3300049581 Bacteria 143501
359 Ga0501047_0001704 3300049581 Bacteria 21372
360 Ga0501047_0008462 3300049581 Bacteria 9710
361 Ga0501047_0387034 3300049581 Bacteria 1232
362 Ga0501047_0448238 3300049581 Bacteria 1120
363 Ga0501067_0053094 3300049583 Bacteria 2246
364 Ga0501070_0015904 3300049586 Bacteria 6325
365 Ga0501070_0205875 3300049586 Bacteria 1615
366 Ga0501070_0256996 3300049586 Bacteria 1428
367 Ga0501073_0005991 3300049589 Bacteria 9072
368 Ga0501074_0008436 3300049590 Bacteria 7470
369 Ga0501216_004513 3300049660 Bacteria 2069
370 Ga0501253_008032 3300049683 Bacteria 1501
371 Ga0501083_0000109 3300049744 Bacteria 55679
372 Ga0501035_0003435 3300049822 Bacteria 15153
373 Ga0501035_0014510 3300049822 Bacteria 7272
374 Ga0501035_0054654 3300049822 Bacteria 3567
375 Ga0501035_0259128 3300049822 Bacteria 1475
376 Ga0501044_0004405 3300049823 Bacteria 15755
377 Ga0501044_0042853 3300049823 Bacteria 4705
378 Ga0501044_0050647 3300049823 Bacteria 4283
379 Ga0501044_0099525 3300049823 Bacteria 2926
380 Ga0501044_0132678 3300049823 Bacteria 2484
381 Ga0501044_0275342 3300049823 Bacteria 1618
382 Ga0501044_0323216 3300049823 Bacteria 1467
383 Ga0501212_004588 3300049851 Bacteria 1792
384 nmdc:mga00v17_70506_c1 3300050491 Bacteria 2165
385 nmdc:mga05p37_559385_c1 3300050507 Bacteria 1300
386 nmdc:mga09592_395075_c1 3300050508 Bacteria 1195
387 nmdc:mga08y16_454728_c1 3300050511 Bacteria 1305
388 nmdc:mga08y16_5145_c1 3300050511 Bacteria 13670
389 nmdc:mga08x19_4422_c1 3300050514 Bacteria 8333
390 nmdc:mga0a205_71_c1 3300050515 Bacteria 55470
391 Ga0500635_0000016 3300053080 Bacteria 124879
392 Ga0500573_0118117 3300053140 Bacteria 1479
393 Ga0587083_0017710 3300059505 Bacteria 1278
394 Ga0466962_0002126 3300061719 Bacteria 9356
395 Ga0466962_0075365 3300061719 Bacteria 1612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0081706 Ga0496124_0081706_166_975 255
2 3300049574 Ga0501038_0070120 Ga0501038_0070120_1633_2430 256
3 3300049579 Ga0501043_0198198 Ga0501043_0198198_686_1483 256
4 3300044694 Ga0466963_0009180 Ga0466963_0009180_4076_4873 257
5 3300044842 Ga0466957_0020735 Ga0466957_0020735_3038_3835 257
6 3300045049 Ga0466959_0053027 Ga0466959_0053027_1168_1965 257
7 3300045976 Ga0466967_0000522 Ga0466967_0000522_8532_9329 257
8 3300005437 Ga0070710_10357817 Ga0070710_103578171 258
9 3300042015 Ga0439462_0017388 Ga0439462_0017388_400_1209 258
10 3300031548 Ga0307408_100051977 Ga0307408_1000519771 259
11 3300031731 Ga0307405_10378989 Ga0307405_103789891 259
12 3300031911 Ga0307412_10192625 Ga0307412_101926251 259
13 3300046522 Ga0495643_0077282 Ga0495643_0077282_706_1515 259
14 3300046616 Ga0495668_0033768 Ga0495668_0033768_983_1792 259
15 3300046674 Ga0495588_0003800 Ga0495588_0003800_305_1114 259
16 3300031903 Ga0307407_10137533 Ga0307407_101375331 260
17 3300031995 Ga0307409_100744376 Ga0307409_1007443761 260
18 3300031548 Ga0307408_100126737 Ga0307408_1001267372 261
19 3300031548 Ga0307408_100129462 Ga0307408_1001294622 261
20 3300031731 Ga0307405_10033083 Ga0307405_100330833 261
21 3300031911 Ga0307412_10030851 Ga0307412_100308512 261
22 3300031911 Ga0307412_10066377 Ga0307412_100663772 261
23 3300032002 Ga0307416_100605308 Ga0307416_1006053082 261
24 3300032004 Ga0307414_10468440 Ga0307414_104684402 261
25 3300041405 Ga0439438_030648 Ga0439438_030648_268_1077 261
26 3300041999 Ga0439433_0000747 Ga0439433_0000747_1983_2792 261
27 3300042002 Ga0439442_000548 Ga0439442_000548_3822_4631 261
28 3300042006 Ga0439432_011937 Ga0439432_011937_1594_2403 261
29 3300042007 Ga0439449_0079713 Ga0439449_0079713_161_970 261
30 3300042122 Ga0450920_000926 Ga0450920_000926_2491_3300 261
31 3300042146 Ga0450907_001291 Ga0450907_001291_3716_4525 261
32 3300042435 Ga0439434_0000349 Ga0439434_0000349_4456_5265 261
33 3300042531 Ga0450918_002590 Ga0450918_002590_868_1677 261
34 3300049573 Ga0501037_0007156 Ga0501037_0007156_4495_5301 261
35 3300049581 Ga0501047_0000056 Ga0501047_0000056_4466_5272 261
36 3300049823 Ga0501044_0099525 Ga0501044_0099525_1990_2796 261
37 iso_pu_bacteria 2554235005 2554260090 261
38 iso_pu_bacteria 2643221566 2643847486 261
39 iso_pu_bacteria 2773857759 2774382117 261
40 iso_pu_bacteria 2857720070 2857721313 261
41 iso_pu_bacteria 2862993130 2862993504 261
42 iso_pu_bacteria 2919051321 2919051372 261
43 iso_pu_bacteria 2928090899 2928093054 261
44 iso_pu_bacteria 2939660829 2939662332 261
45 iso_pu_bacteria 2945956166 2945960658 261
46 iso_pu_bacteria 2964326757 2964328569 261
47 iso_pu_bacteria 2977251589 2977252285 261
48 iso_pu_bacteria 2984580707 2984583346 261
49 3300031995 Ga0307409_100580932 Ga0307409_1005809322 262
50 3300045976 Ga0466967_0038261 Ga0466967_0038261_988_1776 262
51 3300048912 Ga0496109_0320856 Ga0496109_0320856_292_1134 262
52 iso_pu_bacteria 2537561592 2537899324 262
53 iso_pu_bacteria 2757320536 2758225557 262
54 iso_pu_bacteria 8016254467 8016256059 262
55 iso_pu_bacteria 2643221572 2643875223 263
56 iso_pu_bacteria 2643221669 2644382279 263
57 iso_pu_bacteria 2773857758 2774379663 263
58 iso_pu_bacteria 2808606447 2809225869 263
59 iso_pu_bacteria 2852632344 2852635236 263
60 iso_pu_bacteria 2904509784 2904512455 263
61 iso_pu_bacteria 2908678064 2908679305 263
62 iso_pu_bacteria 2919069694 2919069952 263
63 iso_pu_bacteria 2945968032 2945970496 263
64 iso_pu_bacteria 2946080515 2946083883 263
65 iso_pu_bacteria 2974294766 2974295834 263
66 iso_pu_bacteria 2974324384 2974327902 263
67 iso_pu_bacteria 2977228692 2977229509 263
68 iso_pu_bacteria 2977236895 2977238443 263
69 iso_pu_bacteria 2977264416 2977264716 263
70 iso_pu_bacteria 2984542743 2984543777 263
71 iso_pu_bacteria 8008574985 8008575573 263
72 3300025893 Ga0207682_10089454 Ga0207682_100894542 264
73 3300049570 Ga0501033_0005204 Ga0501033_0005204_2736_3533 264
74 3300049572 Ga0501036_0170653 Ga0501036_0170653_490_1287 264
75 3300049581 Ga0501047_0387034 Ga0501047_0387034_420_1217 264
76 3300049823 Ga0501044_0132678 Ga0501044_0132678_683_1480 264
77 iso_pu_bacteria 2773857763 2774397758 264
78 iso_pu_bacteria 2857740372 2857743113 264
79 iso_pu_bacteria 2904497146 2904497325 264
80 iso_pu_bacteria 2904776348 2904780441 264
81 iso_pu_bacteria 2910809715 2910810566 264
82 iso_pu_bacteria 2912723979 2912728438 264
83 iso_pu_bacteria 2919034639 2919038420 264
84 iso_pu_bacteria 2919538618 2919540029 264
85 iso_pu_bacteria 2932426870 2932428884 264
86 iso_pu_bacteria 2933418574 2933421810 264
87 iso_pu_bacteria 2939674588 2939678163 264
88 iso_pu_bacteria 2946033335 2946034014 264
89 iso_pu_bacteria 2996221748 2996224254 264
90 iso_pu_bacteria 8045830549 8045833456 264
91 3300003203 JGI25406J46586_10016057 JGI25406J46586_100160574 265
92 3300003373 JGI25407J50210_10013660 JGI25407J50210_100136602 265
93 3300005436 Ga0070713_100077506 Ga0070713_1000775063 265
94 3300005437 Ga0070710_10218935 Ga0070710_102189351 265
95 3300005564 Ga0070664_100282622 Ga0070664_1002826222 265
96 3300005937 Ga0081455_10054104 Ga0081455_100541042 265
97 3300005937 Ga0081455_10069395 Ga0081455_100693952 265
98 3300005981 Ga0081538_10000771 Ga0081538_1000077120 265
99 3300005985 Ga0081539_10000057 Ga0081539_10000057162 265
100 3300005985 Ga0081539_10156486 Ga0081539_101564861 265
101 3300006028 Ga0070717_10284057 Ga0070717_102840572 265
102 3300006051 Ga0075364_10091051 Ga0075364_100910513 265
103 3300006844 Ga0075428_100032453 Ga0075428_1000324536 265
104 3300006844 Ga0075428_100266681 Ga0075428_1002666811 265
105 3300006871 Ga0075434_100000025 Ga0075434_1000000258 265
106 3300006914 Ga0075436_100000835 Ga0075436_10000083511 265
107 3300009094 Ga0111539_10000213 Ga0111539_1000021366 265
108 3300009094 Ga0111539_10159848 Ga0111539_101598482 265
109 3300012507 Ga0157342_1000903 Ga0157342_10009031 265
110 3300013104 Ga0157370_10595083 Ga0157370_105950831 265
111 3300014969 Ga0157376_10043531 Ga0157376_100435311 265
112 3300021388 Ga0213875_10000926 Ga0213875_1000092613 265
113 3300021388 Ga0213875_10022529 Ga0213875_100225292 265
114 3300025898 Ga0207692_10032942 Ga0207692_100329422 265
115 3300025929 Ga0207664_10051319 Ga0207664_100513194 265
116 3300025972 Ga0207668_10094008 Ga0207668_100940082 265
117 3300026078 Ga0207702_10677077 Ga0207702_106770771 265
118 3300027907 Ga0207428_10000342 Ga0207428_1000034254 265
119 3300031548 Ga0307408_100070770 Ga0307408_1000707702 265
120 3300031824 Ga0307413_10003752 Ga0307413_100037525 265
121 3300031852 Ga0307410_10000152 Ga0307410_1000015224 265
122 3300031852 Ga0307410_10012680 Ga0307410_100126801 265
123 3300031852 Ga0307410_10143094 Ga0307410_101430943 265
124 3300031901 Ga0307406_10000005 Ga0307406_1000000556 265
125 3300031901 Ga0307406_10007718 Ga0307406_100077186 265
126 3300031901 Ga0307406_10008600 Ga0307406_100086004 265
127 3300031901 Ga0307406_10123007 Ga0307406_101230071 265
128 3300031903 Ga0307407_10009652 Ga0307407_100096525 265
129 3300031903 Ga0307407_10123233 Ga0307407_101232332 265
130 3300031903 Ga0307407_10475570 Ga0307407_104755701 265
131 3300031911 Ga0307412_10022135 Ga0307412_100221352 265
132 3300031911 Ga0307412_10029819 Ga0307412_100298192 265
133 3300031911 Ga0307412_10130188 Ga0307412_101301881 265
134 3300031995 Ga0307409_100000001 Ga0307409_10000000150 265
135 3300031995 Ga0307409_100038279 Ga0307409_1000382792 265
136 3300031995 Ga0307409_100656551 Ga0307409_1006565512 265
137 3300031995 Ga0307409_100794856 Ga0307409_1007948561 265
138 3300032002 Ga0307416_100000115 Ga0307416_10000011543 265
139 3300032002 Ga0307416_100038363 Ga0307416_1000383634 265
140 3300032002 Ga0307416_100608258 Ga0307416_1006082581 265
141 3300032002 Ga0307416_100857510 Ga0307416_1008575101 265
142 3300032004 Ga0307414_10226947 Ga0307414_102269472 265
143 3300032004 Ga0307414_10583479 Ga0307414_105834792 265
144 3300032005 Ga0307411_10026317 Ga0307411_100263174 265
145 3300032126 Ga0307415_100033934 Ga0307415_1000339342 265
146 3300032126 Ga0307415_100059477 Ga0307415_1000594773 265
147 3300032126 Ga0307415_100064043 Ga0307415_1000640433 265
148 3300035113 Ga0373936_0079694 Ga0373936_0079694_244_1041 265
149 3300035116 Ga0373945_0000347 Ga0373945_0000347_10124_10921 265
150 3300035171 Ga0373946_0001241 Ga0373946_0001241_5480_6277 265
151 3300035410 Ga0373924_0049969 Ga0373924_0049969_50_847 265
152 3300035725 Ga0373947_0004744 Ga0373947_0004744_4282_5079 265
153 3300036401 Ga0373937_0247898 Ga0373937_0247898_204_1001 265
154 3300037418 Ga0395900_0012691 Ga0395900_0012691_3619_4416 265
155 3300037466 Ga0395898_0021707 Ga0395898_0021707_317_1114 265
156 3300037466 Ga0395898_0118045 Ga0395898_0118045_869_1666 265
157 3300037466 Ga0395898_0129657 Ga0395898_0129657_302_1099 265
158 3300037466 Ga0395898_0135212 Ga0395898_0135212_250_1047 265
159 3300037466 Ga0395898_0176358 Ga0395898_0176358_487_1284 265
160 3300037471 Ga0395905_0038861 Ga0395905_0038861_2055_2852 265
161 3300037853 Ga0436364_0010465 Ga0436364_0010465_11969_12766 265
162 3300037853 Ga0436364_0632303 Ga0436364_0632303_3503_4300 265
163 3300037853 Ga0436364_0645062 Ga0436364_0645062_1472_2269 265
164 3300038443 Ga0395901_0026970 Ga0395901_0026970_1819_2616 265
165 3300038443 Ga0395901_0039649 Ga0395901_0039649_419_1216 265
166 3300038443 Ga0395901_0300808 Ga0395901_0300808_307_1113 265
167 3300041404 Ga0439436_0085134 Ga0439436_0085134_39_836 265
168 3300041411 Ga0439466_0032366 Ga0439466_0032366_64_861 265
169 3300041453 Ga0451797_1114751 Ga0451797_1114751_38_931 265
170 3300042002 Ga0439442_013965 Ga0439442_013965_769_1566 265
171 3300042007 Ga0439449_0004875 Ga0439449_0004875_345_1142 265
172 3300042016 Ga0439463_006678 Ga0439463_006678_659_1456 265
173 3300042157 Ga0439458_0056294 Ga0439458_0056294_61_858 265
174 3300042461 Ga0439460_0121594 Ga0439460_0121594_32_829 265
175 3300042993 Ga0439440_0008708 Ga0439440_0008708_626_1423 265
176 3300042993 Ga0439440_0024314 Ga0439440_0024314_35_832 265
177 3300044658 Ga0466972_0005622 Ga0466972_0005622_942_1739 265
178 3300044658 Ga0466972_0130045 Ga0466972_0130045_260_1057 265
179 3300044658 Ga0466972_0189919 Ga0466972_0189919_105_902 265
180 3300044683 Ga0466965_0013199 Ga0466965_0013199_718_1515 265
181 3300044683 Ga0466965_0078168 Ga0466965_0078168_661_1458 265
182 3300044684 Ga0466966_0061767 Ga0466966_0061767_1526_2329 265
183 3300044693 Ga0466961_0081124 Ga0466961_0081124_317_1114 265
184 3300044693 Ga0466961_0176456 Ga0466961_0176456_392_1189 265
185 3300044693 Ga0466961_0375033 Ga0466961_0375033_41_838 265
186 3300044693 Ga0466961_0384559 Ga0466961_0384559_28_831 265
187 3300044694 Ga0466963_0019980 Ga0466963_0019980_1260_2057 265
188 3300044694 Ga0466963_0033537 Ga0466963_0033537_2299_3096 265
189 3300044694 Ga0466963_0150616 Ga0466963_0150616_642_1439 265
190 3300044694 Ga0466963_0366366 Ga0466963_0366366_11_808 265
191 3300044719 Ga0466971_0002644 Ga0466971_0002644_6643_7440 265
192 3300044735 Ga0466968_0016560 Ga0466968_0016560_1517_2314 265
193 3300044765 Ga0466970_0019867 Ga0466970_0019867_2634_3431 265
194 3300044765 Ga0466970_0023271 Ga0466970_0023271_1069_1875 265
195 3300044842 Ga0466957_0054632 Ga0466957_0054632_1322_2119 265
196 3300044842 Ga0466957_0100232 Ga0466957_0100232_654_1451 265
197 3300044901 Ga0466960_0035280 Ga0466960_0035280_950_1747 265
198 3300044901 Ga0466960_0056961 Ga0466960_0056961_10_807 265
199 3300045049 Ga0466959_0079890 Ga0466959_0079890_1192_1989 265
200 3300045836 Ga0466958_0004498 Ga0466958_0004498_1321_2118 265
201 3300045836 Ga0466958_0004664 Ga0466958_0004664_1312_2109 265
202 3300045976 Ga0466967_0000185 Ga0466967_0000185_18859_19656 265
203 3300045976 Ga0466967_0036500 Ga0466967_0036500_1055_1852 265
204 3300045976 Ga0466967_0040234 Ga0466967_0040234_1663_2460 265
205 3300045976 Ga0466967_0351852 Ga0466967_0351852_147_944 265
206 3300046461 Ga0495641_0019687 Ga0495641_0019687_864_1661 265
207 3300046463 Ga0495653_0020971 Ga0495653_0020971_4271_5068 265
208 3300046473 Ga0495582_0252283 Ga0495582_0252283_144_941 265
209 3300046477 Ga0495664_0000778 Ga0495664_0000778_8931_9728 265
210 3300046514 Ga0495618_0019316 Ga0495618_0019316_2695_3492 265
211 3300046516 Ga0495628_0295156 Ga0495628_0295156_157_954 265
212 3300046529 Ga0495652_0040121 Ga0495652_0040121_2388_3185 265
213 3300046543 Ga0495645_0032895 Ga0495645_0032895_2093_2890 265
214 3300046559 Ga0495667_0021799 Ga0495667_0021799_309_1106 265
215 3300046663 Ga0495635_0060467 Ga0495635_0060467_904_1701 265
216 3300046675 Ga0495657_0030202 Ga0495657_0030202_2745_3542 265
217 3300046678 Ga0495599_0044506 Ga0495599_0044506_1805_2602 265
218 3300047319 Ga0495674_0005144 Ga0495674_0005144_3713_4510 265
219 3300047321 Ga0495676_0030731 Ga0495676_0030731_2756_3553 265
220 3300048920 Ga0496117_0191559 Ga0496117_0191559_132_932 265
221 3300048921 Ga0496118_0214669 Ga0496118_0214669_292_1092 265
222 3300049568 Ga0501031_0002330 Ga0501031_0002330_363_1160 265
223 3300049569 Ga0501032_0000232 Ga0501032_0000232_4625_5422 265
224 3300049570 Ga0501033_0078425 Ga0501033_0078425_575_1372 265
225 3300049572 Ga0501036_0240251 Ga0501036_0240251_204_1001 265
226 3300049573 Ga0501037_0000226 Ga0501037_0000226_43687_44484 265
227 3300049575 Ga0501039_0063796 Ga0501039_0063796_327_1124 265
228 3300049578 Ga0501042_0007436 Ga0501042_0007436_3158_3955 265
229 3300049580 Ga0501046_0000067 Ga0501046_0000067_90473_91270 265
230 3300049581 Ga0501047_0001704 Ga0501047_0001704_19557_20354 265
231 3300049581 Ga0501047_0448238 Ga0501047_0448238_36_833 265
232 3300049583 Ga0501067_0053094 Ga0501067_0053094_700_1497 265
233 3300049586 Ga0501070_0015904 Ga0501070_0015904_4789_5586 265
234 3300049589 Ga0501073_0005991 Ga0501073_0005991_64_861 265
235 3300049590 Ga0501074_0008436 Ga0501074_0008436_156_953 265
236 3300049660 Ga0501216_004513 Ga0501216_004513_740_1537 265
237 3300049683 Ga0501253_008032 Ga0501253_008032_383_1180 265
238 3300049744 Ga0501083_0000109 Ga0501083_0000109_26564_27361 265
239 3300049822 Ga0501035_0003435 Ga0501035_0003435_3380_4177 265
240 3300049823 Ga0501044_0050647 Ga0501044_0050647_2185_2982 265
241 3300049851 Ga0501212_004588 Ga0501212_004588_151_948 265
242 3300050491 nmdc:mga00v17_70506_c1 nmdc:mga00v17_70506_c1_1071_1877 265
243 3300050507 nmdc:mga05p37_559385_c1 nmdc:mga05p37_559385_c1_30_827 265
244 3300050508 nmdc:mga09592_395075_c1 nmdc:mga09592_395075_c1_194_991 265
245 3300050511 nmdc:mga08y16_454728_c1 nmdc:mga08y16_454728_c1_293_1090 265
246 3300050511 nmdc:mga08y16_5145_c1 nmdc:mga08y16_5145_c1_9589_10386 265
247 3300050514 nmdc:mga08x19_4422_c1 nmdc:mga08x19_4422_c1_3805_4602 265
248 3300050515 nmdc:mga0a205_71_c1 nmdc:mga0a205_71_c1_7196_7993 265
249 3300059505 Ga0587083_0017710 Ga0587083_0017710_158_955 265
250 3300061719 Ga0466962_0002126 Ga0466962_0002126_1763_2560 265
251 iso_pu_bacteria 2690315906 2691512208 265
252 iso_pu_bacteria 2775506735 2775656926 265
253 iso_pu_bacteria 2808606360 2808850565 265
254 iso_pu_bacteria 2808606366 2808876871 265
255 iso_pu_bacteria 2808606370 2808893732 265
256 iso_pu_bacteria 2808606371 2808898370 265
257 iso_pu_bacteria 2811994871 2812318899 265
258 iso_pu_bacteria 2811994872 2812324915 265
259 iso_pu_bacteria 2919391150 2919394242 265
260 iso_pu_bacteria 2920879853 2920883194 265
261 iso_pu_bacteria 2945916053 2945916661 265
262 iso_pu_bacteria 2945920336 2945923273 265
263 iso_pu_bacteria 2945941187 2945941829 265
264 iso_pu_bacteria 2946037020 2946041010 265
265 iso_pu_bacteria 2946059875 2946060433 265
266 iso_pu_bacteria 2953998280 2954002245 265
267 iso_pu_bacteria 2974302888 2974304637 265
268 iso_pu_bacteria 3006493962 3006495766 265
269 3300031548 Ga0307408_100066530 Ga0307408_1000665301 266
270 3300031901 Ga0307406_10014800 Ga0307406_100148003 266
271 3300031995 Ga0307409_100296246 Ga0307409_1002962462 266
272 3300032002 Ga0307416_100015053 Ga0307416_1000150533 266
273 3300048908 Ga0496105_0532415 Ga0496105_0532415_87_893 266
274 3300048920 Ga0496117_0000014 Ga0496117_0000014_448884_449690 266
275 3300048922 Ga0496119_0001243 Ga0496119_0001243_19412_20218 266
276 3300048922 Ga0496119_0006163 Ga0496119_0006163_6101_6907 266
277 3300048923 Ga0496120_0001359 Ga0496120_0001359_9735_10541 266
278 3300048923 Ga0496120_0003745 Ga0496120_0003745_5864_6670 266
279 3300048923 Ga0496120_0011791 Ga0496120_0011791_510_1310 266
280 3300048924 Ga0496121_0000380 Ga0496121_0000380_7034_7837 266
281 3300048925 Ga0496122_0004671 Ga0496122_0004671_9017_9823 266
282 3300048926 Ga0496123_0024985 Ga0496123_0024985_2757_3563 266
283 3300048927 Ga0496124_0015407 Ga0496124_0015407_4400_5206 266
284 3300048928 Ga0496125_0069933 Ga0496125_0069933_773_1579 266
285 3300048929 Ga0496126_0007451 Ga0496126_0007451_5097_5903 266
286 3300049571 Ga0501034_0180586 Ga0501034_0180586_927_1727 266
287 3300049571 Ga0501034_0196471 Ga0501034_0196471_569_1369 266
288 3300049573 Ga0501037_0003920 Ga0501037_0003920_5837_6637 266
289 3300049581 Ga0501047_0008462 Ga0501047_0008462_4352_5152 266
290 3300049822 Ga0501035_0054654 Ga0501035_0054654_1041_1841 266
291 3300049823 Ga0501044_0004405 Ga0501044_0004405_6388_7188 266
292 3300049823 Ga0501044_0042853 Ga0501044_0042853_11_811 266
293 3300006051 Ga0075364_10033829 Ga0075364_100338292 267
294 3300031901 Ga0307406_10052540 Ga0307406_100525402 267
295 3300031901 Ga0307406_10066727 Ga0307406_100667272 267
296 3300031911 Ga0307412_10356018 Ga0307412_103560181 267
297 3300031995 Ga0307409_100146827 Ga0307409_1001468272 267
298 3300032004 Ga0307414_10283223 Ga0307414_102832232 267
299 3300037418 Ga0395900_0284564 Ga0395900_0284564_27_830 267
300 3300037466 Ga0395898_0002748 Ga0395898_0002748_15941_16744 267
301 3300037471 Ga0395905_0326720 Ga0395905_0326720_571_1374 267
302 3300038443 Ga0395901_0147537 Ga0395901_0147537_478_1281 267
303 3300041452 Ga0451793_1696121 Ga0451793_1696121_97_900 267
304 3300041453 Ga0451797_1322653 Ga0451797_1322653_276_1079 267
305 3300041512 Ga0451853_2922145 Ga0451853_2922145_141_944 267
306 3300044694 Ga0466963_0012297 Ga0466963_0012297_538_1341 267
307 3300044719 Ga0466971_0100735 Ga0466971_0100735_177_980 267
308 3300045836 Ga0466958_0278043 Ga0466958_0278043_121_924 267
309 3300045976 Ga0466967_0254381 Ga0466967_0254381_352_1155 267
310 3300048922 Ga0496119_0045334 Ga0496119_0045334_809_1618 267
311 3300048925 Ga0496122_0010086 Ga0496122_0010086_1756_2565 267
312 3300048926 Ga0496123_0025172 Ga0496123_0025172_2417_3226 267
313 3300048927 Ga0496124_0074727 Ga0496124_0074727_228_1043 267
314 3300048928 Ga0496125_0104784 Ga0496125_0104784_350_1159 267
315 3300049570 Ga0501033_0008633 Ga0501033_0008633_4677_5480 267
316 3300049822 Ga0501035_0014510 Ga0501035_0014510_4133_4936 267
317 3300061719 Ga0466962_0075365 Ga0466962_0075365_140_943 267
318 iso_pu_bacteria 2939657138 2939657879 267
319 3300013105 Ga0157369_10577486 Ga0157369_105774862 268
320 3300025303 Ga0209051_1001502 Ga0209051_10015025 268
321 3300044683 Ga0466965_0074905 Ga0466965_0074905_880_1686 268
322 3300044693 Ga0466961_0206257 Ga0466961_0206257_316_1122 268
323 3300044719 Ga0466971_0100374 Ga0466971_0100374_510_1316 268
324 3300044735 Ga0466968_0037960 Ga0466968_0037960_393_1199 268
325 3300045049 Ga0466959_0164223 Ga0466959_0164223_559_1365 268
326 3300045836 Ga0466958_0439669 Ga0466958_0439669_21_827 268
327 3300048925 Ga0496122_0004494 Ga0496122_0004494_10225_11046 268
328 3300048926 Ga0496123_0043346 Ga0496123_0043346_462_1283 268
329 3300049569 Ga0501032_0002840 Ga0501032_0002840_10766_11572 268
330 3300049569 Ga0501032_0381821 Ga0501032_0381821_40_846 268
331 3300049571 Ga0501034_0000075 Ga0501034_0000075_152525_153331 268
332 3300049571 Ga0501034_0009603 Ga0501034_0009603_83_889 268
333 3300049573 Ga0501037_0044087 Ga0501037_0044087_1878_2684 268
334 3300049574 Ga0501038_0044880 Ga0501038_0044880_2392_3198 268
335 3300049574 Ga0501038_0241759 Ga0501038_0241759_390_1196 268
336 3300049579 Ga0501043_0007593 Ga0501043_0007593_5850_6656 268
337 3300049586 Ga0501070_0205875 Ga0501070_0205875_374_1180 268
338 3300049823 Ga0501044_0323216 Ga0501044_0323216_471_1277 268
339 3300053080 Ga0500635_0000016 Ga0500635_0000016_9576_10382 268
340 iso_pu_bacteria 2844841374 2844844213 268
341 iso_pu_bacteria 2844852863 2844856326 268
342 iso_pu_bacteria 2919055335 2919056165 268
343 iso_pu_bacteria 2919523602 2919526180 268
344 iso_pu_bacteria 2928153084 2928154307 268
345 3300031548 Ga0307408_100046984 Ga0307408_1000469844 269
346 3300031548 Ga0307408_100267570 Ga0307408_1002675701 269
347 3300031548 Ga0307408_100576349 Ga0307408_1005763492 269
348 3300031731 Ga0307405_10011886 Ga0307405_100118862 269
349 3300031731 Ga0307405_10059580 Ga0307405_100595801 269
350 3300031824 Ga0307413_10036530 Ga0307413_100365303 269
351 3300031824 Ga0307413_10212582 Ga0307413_102125822 269
352 3300031824 Ga0307413_10233258 Ga0307413_102332581 269
353 3300031824 Ga0307413_10340246 Ga0307413_103402462 269
354 3300031824 Ga0307413_10365384 Ga0307413_103653841 269
355 3300031852 Ga0307410_10023224 Ga0307410_100232242 269
356 3300031852 Ga0307410_10053896 Ga0307410_100538963 269
357 3300031852 Ga0307410_10079999 Ga0307410_100799992 269
358 3300031852 Ga0307410_10513975 Ga0307410_105139751 269
359 3300031901 Ga0307406_10189340 Ga0307406_101893402 269
360 3300031903 Ga0307407_10016515 Ga0307407_100165151 269
361 3300031903 Ga0307407_10029215 Ga0307407_100292152 269
362 3300031903 Ga0307407_10035916 Ga0307407_100359164 269
363 3300031911 Ga0307412_10004864 Ga0307412_100048642 269
364 3300031911 Ga0307412_10225456 Ga0307412_102254562 269
365 3300031911 Ga0307412_10268543 Ga0307412_102685432 269
366 3300031911 Ga0307412_10392942 Ga0307412_103929421 269
367 3300031911 Ga0307412_10610317 Ga0307412_106103171 269
368 3300031995 Ga0307409_100196252 Ga0307409_1001962523 269
369 3300032002 Ga0307416_100142154 Ga0307416_1001421542 269
370 3300032002 Ga0307416_100312701 Ga0307416_1003127012 269
371 3300032005 Ga0307411_10043832 Ga0307411_100438322 269
372 3300032005 Ga0307411_10070994 Ga0307411_100709944 269
373 3300032126 Ga0307415_100318635 Ga0307415_1003186351 269
374 3300041405 Ga0439438_006610 Ga0439438_006610_976_1785 269
375 3300041407 Ga0439447_042806 Ga0439447_042806_61_870 269
376 3300042002 Ga0439442_000579 Ga0439442_000579_4740_5549 269
377 3300042002 Ga0439442_003228 Ga0439442_003228_427_1236 269
378 3300042006 Ga0439432_008644 Ga0439432_008644_2338_3147 269
379 3300042146 Ga0450907_002858 Ga0450907_002858_2019_2828 269
380 3300042435 Ga0439434_0031789 Ga0439434_0031789_735_1544 269
381 3300044658 Ga0466972_0002329 Ga0466972_0002329_3368_4177 269
382 3300044684 Ga0466966_0006301 Ga0466966_0006301_5325_6134 269
383 3300044693 Ga0466961_0043325 Ga0466961_0043325_881_1690 269
384 3300045049 Ga0466959_0058590 Ga0466959_0058590_1108_1917 269
385 3300045976 Ga0466967_0023039 Ga0466967_0023039_3884_4693 269
386 3300048929 Ga0496126_0057243 Ga0496126_0057243_1469_2281 269
387 3300049569 Ga0501032_0003999 Ga0501032_0003999_7762_8571 269
388 3300049570 Ga0501033_0168944 Ga0501033_0168944_478_1290 269
389 3300049571 Ga0501034_0028975 Ga0501034_0028975_4026_4838 269
390 3300049572 Ga0501036_0174962 Ga0501036_0174962_83_895 269
391 3300049572 Ga0501036_0228437 Ga0501036_0228437_701_1510 269
392 3300049573 Ga0501037_0001709 Ga0501037_0001709_4825_5634 269
393 3300049574 Ga0501038_0066196 Ga0501038_0066196_1769_2578 269
394 3300049574 Ga0501038_0093314 Ga0501038_0093314_294_1103 269
395 3300049574 Ga0501038_0204636 Ga0501038_0204636_636_1445 269
396 3300049574 Ga0501038_0291806 Ga0501038_0291806_294_1103 269
397 3300049575 Ga0501039_0040666 Ga0501039_0040666_224_1033 269
398 3300049575 Ga0501039_0117851 Ga0501039_0117851_379_1188 269
399 3300049586 Ga0501070_0256996 Ga0501070_0256996_432_1244 269
400 3300049823 Ga0501044_0275342 Ga0501044_0275342_312_1121 269
401 iso_pu_bacteria 2643221546 2643752232 269
402 iso_pu_bacteria 2857729791 2857731473 269
403 iso_pu_bacteria 8004182704 8004184479 269
404 3300025898 Ga0207692_10071807 Ga0207692_100718072 270
405 3300031911 Ga0307412_10057353 Ga0307412_100573533 270
406 3300053140 Ga0500573_0118117 Ga0500573_0118117_336_1151 271
407 3300013105 Ga0157369_10482180 Ga0157369_104821801 272
408 3300013105 Ga0157369_10584924 Ga0157369_105849242 272
409 3300025246 Ga0209646_1000014 Ga0209646_1000014135 272
410 3300032126 Ga0307415_100021140 Ga0307415_1000211402 272
411 3300037418 Ga0395900_0018280 Ga0395900_0018280_3066_3887 272
412 3300037466 Ga0395898_0062910 Ga0395898_0062910_2314_3135 272
413 3300038443 Ga0395901_0057757 Ga0395901_0057757_124_945 272
414 3300041512 Ga0451853_2482725 Ga0451853_2482725_253_1071 272
415 3300044683 Ga0466965_0030150 Ga0466965_0030150_1434_2258 272
416 3300044684 Ga0466966_0145230 Ga0466966_0145230_193_1011 272
417 3300044693 Ga0466961_0026738 Ga0466961_0026738_2016_2834 272
418 3300044719 Ga0466971_0038859 Ga0466971_0038859_193_1011 272
419 3300044765 Ga0466970_0029652 Ga0466970_0029652_1029_1892 272
420 3300044765 Ga0466970_0128952 Ga0466970_0128952_236_1060 272
421 3300044765 Ga0466970_0139290 Ga0466970_0139290_325_1146 272
422 3300044842 Ga0466957_0054399 Ga0466957_0054399_536_1354 272
423 3300045049 Ga0466959_0065095 Ga0466959_0065095_1381_2199 272
424 3300045836 Ga0466958_0162470 Ga0466958_0162470_394_1212 272
425 3300045976 Ga0466967_0144965 Ga0466967_0144965_1025_1843 272
426 3300047472 Ga0495686_0247846 Ga0495686_0247846_101_919 272
427 3300048912 Ga0496109_0042227 Ga0496109_0042227_2400_3263 272
428 3300048913 Ga0496110_0047063 Ga0496110_0047063_2352_3215 272
429 3300048920 Ga0496117_0000276 Ga0496117_0000276_29524_30357 272
430 3300048920 Ga0496117_0003307 Ga0496117_0003307_14044_14862 272
431 3300048928 Ga0496125_0000061 Ga0496125_0000061_122177_122995 272
432 3300049572 Ga0501036_0394996 Ga0501036_0394996_42_863 272
433 3300049573 Ga0501037_0358407 Ga0501037_0358407_38_859 272
434 3300049579 Ga0501043_0163969 Ga0501043_0163969_344_1165 272
435 3300049580 Ga0501046_0009307 Ga0501046_0009307_7435_8256 272
436 3300049822 Ga0501035_0259128 Ga0501035_0259128_119_940 272
437 iso_pu_bacteria 2867428634 2867429199 274
438 3300005337 Ga0070682_100043320 Ga0070682_1000433202 276
439 3300005578 Ga0068854_100195025 Ga0068854_1001950252 276
440 3300009176 Ga0105242_10008842 Ga0105242_100088426 276
441 3300013306 Ga0163162_10311956 Ga0163162_103119562 276
442 3300013307 Ga0157372_10296891 Ga0157372_102968912 276
443 3300025918 Ga0207662_10102819 Ga0207662_101028192 276
444 3300025934 Ga0207686_10107818 Ga0207686_101078181 276
445 3300025935 Ga0207709_10004568 Ga0207709_100045688 276
446 3300025981 Ga0207640_10038206 Ga0207640_100382062 276
447 3300031901 Ga0307406_10488973 Ga0307406_104889731 276
448 3300001979 JGI24740J21852_10047189 JGI24740J21852_100471891 279
449 3300001989 JGI24739J22299_10078048 JGI24739J22299_100780482 279
450 3300001990 JGI24737J22298_10004072 JGI24737J22298_100040723 279
451 3300002067 JGI24735J21928_10000774 JGI24735J21928_100007747 279
452 3300003578 Ga0006562J51391_1131095 Ga0006562J51391_11310959 279
453 3300003578 Ga0006562J51391_1131096 Ga0006562J51391_11310961 279
454 3300003752 Ga0055539_1000014 Ga0055539_1000014129 279
455 3300003756 Ga0055533_1000002 Ga0055533_1000002916 279
456 3300003759 Ga0055525_1000115 Ga0055525_100011518 279
457 3300003841 Ga0055541_1006477 Ga0055541_10064772 279
458 3300009148 Ga0105243_10004239 Ga0105243_100042394 279
459 3300009553 Ga0105249_10266997 Ga0105249_102669972 279
460 3300025225 Ga0209566_100056 Ga0209566_10005696 279
461 3300025226 Ga0209674_100001 Ga0209674_1000012650 279
462 3300025230 Ga0209563_100001 Ga0209563_1000012650 279
463 3300025230 Ga0209563_100383 Ga0209563_1003839 279
464 3300025253 Ga0209677_100001 Ga0209677_1000012650 279
465 3300025272 Ga0209455_1000955 Ga0209455_100095511 279
466 3300044765 Ga0466970_0003201 Ga0466970_0003201_2811_3650 279
467 3300044765 Ga0466970_0009722 Ga0466970_0009722_3525_4364 279
468 3300045049 Ga0466959_0006710 Ga0466959_0006710_6539_7378 279
469 3300045976 Ga0466967_0001065 Ga0466967_0001065_3657_4520 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

60

256

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

65

301

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oz7-assembly2.cif.gz_H putative oxidoreductase from escherichia coli str. k-12 0.969 20 266
6won-assembly1.cif.gz_A crystal structure of acetoin dehydrogenase yohf from salmonella typhimurium 0.964 20 266
6won-assembly1.cif.gz_E crystal structure of acetoin dehydrogenase yohf from salmonella typhimurium 0.9608 20 266
6oz7-assembly1.cif.gz_D putative oxidoreductase from escherichia coli str. k-12 0.9601 20 266
6oz7-assembly1.cif.gz_B-2 putative oxidoreductase from escherichia coli str. k-12 0.9583 20 266
ID Description Score Start End Superfamily
af_P33368_2_253_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9539 20 266 3.40.50.720
4nimA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9515 20 257 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.938 20 261 3.40.50.720
2ztuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9373 24 260 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9338 16 260 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7D7HUH2-F1-model_v4 deleted 0.9541 20 266
AF-A0A739C7E4-F1-model_v4 SDR family oxidoreductase 0.9468 19 266 GO:0016491
AF-A0A7C4DJX8-F1-model_v4 SDR family oxidoreductase 0.9448 22 207
AF-A0A0B0HVB3-F1-model_v4 deleted 0.944 20 201
AF-A0A1H7BDR6-F1-model_v4 Short chain dehydrogenase 0.9414 88 207 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.32 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map