metagRoot

F449995

General Info

Members	Datasets	Scaffolds	Average Seq Length
468	275	467	208

Family's Representative Sequence

Representative Sequence	3300005549\|Ga0070704_100026645\|Ga0070704_1000266453
Length	235
Sequence	MDRDRRRTGWCRDRVLGQEVNVSRLRFKISMSLDGFVAGPSQSVDNPLGIGGMRLHEWVLPLAAWRKSMGEEGGEVNASNAVVEESVANIGATVMGRNMFGGHPGPWKSSKPWNGWWGDNPPFHHPVFVLTHHAREPLQLEGGTTFTFVTDGIEAALDRARRAANGRDVSLAGGAHAAREYLGAGLVDEMEINLVPVLLDSGERLFEGIGDDLHGLALVRTVAAPTVTHLKFARR

Samples

	Sample ID	Description	Type	Environment
1	2919443155	Agromyces sp. 3263	Isolate	Rhizosphere
2	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
3	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
4	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
5	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
6	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
7	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
8	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
9	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
10	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
11	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
12	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
13	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
14	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
15	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
16	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
17	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
18	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
19	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
20	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
21	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
22	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
23	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
24	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
25	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
26	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
27	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
28	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
29	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
30	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
31	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
32	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
33	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
34	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
35	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
36	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
37	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
38	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
39	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
40	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
41	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
42	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
43	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
44	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
45	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
46	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
47	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
48	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
49	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
50	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
51	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
52	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
53	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
54	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
55	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
56	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
57	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
58	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
59	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
60	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
61	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
62	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
63	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
65	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
67	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
68	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
69	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
70	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
71	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
72	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
73	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
74	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
75	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
76	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
77	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
78	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
79	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
80	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
81	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
82	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
83	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
84	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
85	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
86	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
87	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
127	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
129	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
130	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
131	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
132	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
133	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
134	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
135	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
136	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
137	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
138	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
139	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
140	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
141	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
142	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
143	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
144	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
145	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
146	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
147	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
148	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
149	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
150	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
151	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
152	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
153	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
154	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
155	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
156	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
157	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
158	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
159	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
160	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
161	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
162	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
163	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
164	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
165	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
166	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
167	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
168	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
169	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
170	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
171	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
172	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
173	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
174	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
175	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
176	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
177	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
178	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
179	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
180	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
181	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
182	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
183	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
184	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
185	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
186	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
187	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
188	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
189	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
190	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
191	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
192	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
193	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
194	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
195	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
196	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
197	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
198	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
199	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
200	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
201	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
202	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
203	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
204	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
205	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
206	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
207	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
208	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
209	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
210	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
211	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
212	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
213	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
214	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
215	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
216	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
217	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
218	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
219	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
220	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
221	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
222	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
223	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
224	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
225	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
226	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
227	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
228	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
229	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
230	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
231	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
232	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
233	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
234	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
235	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
236	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
237	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
238	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
239	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
244	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
245	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
246	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
248	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
250	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
251	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
252	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
253	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
254	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
255	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
256	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
257	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
258	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
259	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
260	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
261	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
262	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
263	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
264	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
265	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
266	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
267	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
268	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
269	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
270	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
271	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
272	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
273	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
274	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
275	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.79
Metatranscriptomes	0
Isolates	0.21

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	7.69
Rhizosphere	90.81
Stem	0
Stem Tuber	0
Unclassified	1.5

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10167258	3300003203	Unclassified	641
2	Ga0065704_10100335	3300005289	Bacteria	2247
3	Ga0065707_10081998	3300005295	Bacteria	25573
4	Ga0070676_10150250	3300005328	Bacteria	1490
5	Ga0068869_100048061	3300005334	Bacteria	3083
6	Ga0068869_100462392	3300005334	Bacteria	1053
7	Ga0070680_100020043	3300005336	Bacteria	5302
8	Ga0070680_100041844	3300005336	Bacteria	3715
9	Ga0070682_100246308	3300005337	Bacteria	1286
10	Ga0068868_100000325	3300005338	Bacteria	32103
11	Ga0068868_100181913	3300005338	Bacteria	1744
12	Ga0068868_100352029	3300005338	Bacteria	1261
13	Ga0070689_100036026	3300005340	Bacteria	3783
14	Ga0070689_101008437	3300005340	Unclassified	741
15	Ga0070669_100007595	3300005353	Bacteria	7753
16	Ga0070669_100043145	3300005353	Bacteria	3284
17	Ga0070675_100182164	3300005354	Bacteria	1816
18	Ga0070674_100000006	3300005356	Bacteria	150063
19	Ga0070674_100049847	3300005356	Bacteria	2881
20	Ga0070674_100110750	3300005356	Bacteria	2015
21	Ga0070673_100016753	3300005364	Bacteria	5192
22	Ga0070659_100156044	3300005366	Bacteria	1864
23	Ga0070714_100006631	3300005435	Bacteria	8958
24	Ga0070705_100314094	3300005440	Bacteria	1128
25	Ga0070700_100000652	3300005441	Bacteria	17149
26	Ga0070700_100039685	3300005441	Bacteria	2877
27	Ga0070708_100602164	3300005445	Bacteria	1036
28	Ga0070708_100641469	3300005445	Bacteria	1001
29	Ga0070662_100000005	3300005457	Bacteria	183056
30	Ga0070662_100073598	3300005457	Bacteria	2525
31	Ga0070662_100890681	3300005457	Bacteria	759
32	Ga0070681_10060080	3300005458	Bacteria	3780
33	Ga0070681_10394591	3300005458	Bacteria	1295
34	Ga0068867_100000876	3300005459	Bacteria	20334
35	Ga0068867_100009897	3300005459	Bacteria	6717
36	Ga0068867_100444933	3300005459	Bacteria	1103
37	Ga0070706_100142598	3300005467	Bacteria	2236
38	Ga0070706_100154194	3300005467	Bacteria	2144
39	Ga0070707_100021057	3300005468	Bacteria	6158
40	Ga0070698_100025343	3300005471	Bacteria	6182
41	Ga0070698_100061392	3300005471	Bacteria	3793
42	Ga0070699_100010746	3300005518	Bacteria	7922
43	Ga0070699_100012160	3300005518	Bacteria	7427
44	Ga0070699_100134713	3300005518	Bacteria	2179
45	Ga0070679_100059844	3300005530	Bacteria	3796
46	Ga0070697_100007736	3300005536	Bacteria	8368
47	Ga0070697_100228544	3300005536	Bacteria	1587
48	Ga0070672_100162904	3300005543	Bacteria	1852
49	Ga0070686_100132260	3300005544	Bacteria	1727
50	Ga0070686_100296232	3300005544	Bacteria	1198
51	Ga0070695_100075625	3300005545	Bacteria	2216
52	Ga0070695_100160164	3300005545	Bacteria	1579
53	Ga0070695_100619242	3300005545	Bacteria	851
54	Ga0070696_100169877	3300005546	Bacteria	1611
55	Ga0070696_100350009	3300005546	Bacteria	1144
56	Ga0070693_100001020	3300005547	Bacteria	12478
57	Ga0070693_100776870	3300005547	Bacteria	708
58	Ga0070665_100119332	3300005548	Bacteria	2640
59	Ga0070665_100690587	3300005548	Bacteria	1034
60	Ga0070704_100026645	3300005549	Bacteria	3824
61	Ga0070704_100103828	3300005549	Bacteria	2148
62	Ga0070704_100779960	3300005549	Bacteria	853
63	Ga0068854_100200521	3300005578	Unclassified	1568
64	Ga0070702_100167301	3300005615	Bacteria	1427
65	Ga0070702_100285488	3300005615	Bacteria	1135
66	Ga0068864_100000023	3300005618	Bacteria	257064
67	Ga0068864_100053566	3300005618	Bacteria	3481
68	Ga0068864_100668651	3300005618	Unclassified	1012
69	Ga0068866_10003174	3300005718	Bacteria	6767
70	Ga0068861_100010290	3300005719	Bacteria	6491
71	Ga0068861_101408428	3300005719	Unclassified	681
72	Ga0068851_10233800	3300005834	Bacteria	1037
73	Ga0068863_100273485	3300005841	Bacteria	1635
74	Ga0068858_100848683	3300005842	Unclassified	892
75	Ga0068860_100460110	3300005843	Bacteria	1266
76	Ga0068862_100001923	3300005844	Bacteria	18860
77	Ga0068862_100491740	3300005844	Bacteria	1163
78	Ga0081455_10059298	3300005937	Bacteria	3232
79	Ga0081538_10032140	3300005981	Bacteria	3524
80	Ga0081538_10034373	3300005981	Bacteria	3353
81	Ga0081540_1000006	3300005983	Bacteria	208724
82	Ga0081540_1129260	3300005983	Bacteria	1034
83	Ga0081539_10014382	3300005985	Bacteria	5858
84	Ga0075432_10048683	3300006058	Bacteria	1492
85	Ga0070715_10011923	3300006163	Bacteria	3145
86	Ga0070715_10333612	3300006163	Bacteria	823
87	Ga0070716_100192941	3300006173	Bacteria	1347
88	Ga0070712_100009755	3300006175	Bacteria	6052
89	Ga0075428_100101872	3300006844	Bacteria	3130
90	Ga0075431_100308037	3300006847	Bacteria	1599
91	Ga0075431_100315733	3300006847	Bacteria	1576
92	Ga0075433_10000520	3300006852	Bacteria	25128
93	Ga0075433_10078190	3300006852	Bacteria	2915
94	Ga0075434_100005471	3300006871	Bacteria	11568
95	Ga0075434_100241644	3300006871	Bacteria	1826
96	Ga0075429_100103734	3300006880	Bacteria	2483
97	Ga0075429_100550820	3300006880	Bacteria	1011
98	Ga0068865_100043184	3300006881	Bacteria	3078
99	Ga0075435_100001601	3300007076	Bacteria	14622
100	Ga0105251_10153429	3300009011	Unclassified	1040
101	Ga0105240_10268522	3300009093	Unclassified	1965
102	Ga0111539_10026129	3300009094	Bacteria	7146
103	Ga0111539_10220748	3300009094	Bacteria	2208
104	Ga0111539_10287835	3300009094	Bacteria	1912
105	Ga0111539_10320686	3300009094	Bacteria	1803
106	Ga0111539_10761974	3300009094	Bacteria	1126
107	Ga0111539_11519897	3300009094	Bacteria	776
108	Ga0105245_10006357	3300009098	Bacteria	10396
109	Ga0105245_10130908	3300009098	Bacteria	2353
110	Ga0105245_10501543	3300009098	Unclassified	1230
111	Ga0105245_10950135	3300009098	Bacteria	902
112	Ga0114129_10033177	3300009147	Bacteria	7296
113	Ga0114129_10317715	3300009147	Bacteria	2071
114	Ga0114129_10658073	3300009147	Bacteria	1351
115	Ga0114129_11253582	3300009147	Bacteria	921
116	Ga0105243_10003195	3300009148	Bacteria	13424
117	Ga0105243_10178760	3300009148	Bacteria	1844
118	Ga0105243_10243842	3300009148	Bacteria	1601
119	Ga0105243_10267006	3300009148	Bacteria	1535
120	Ga0105242_10085329	3300009176	Bacteria	2648
121	Ga0105242_10224667	3300009176	Bacteria	1680
122	Ga0105242_10623011	3300009176	Bacteria	1045
123	Ga0105248_10045036	3300009177	Bacteria	4947
124	Ga0105248_10086279	3300009177	Bacteria	3532
125	Ga0105237_10729413	3300009545	Bacteria	997
126	Ga0105238_10497175	3300009551	Bacteria	1220
127	Ga0105249_10003043	3300009553	Bacteria	14468
128	Ga0105239_10260759	3300010375	Bacteria	1948
129	Ga0105246_10668795	3300011119	Unclassified	906
130	Ga0157371_10529074	3300013102	Bacteria	872
131	Ga0157370_10487104	3300013104	Unclassified	1133
132	Ga0157378_10141845	3300013297	Bacteria	2232
133	Ga0157378_10429689	3300013297	Bacteria	1307
134	Ga0163162_10173336	3300013306	Bacteria	2282
135	Ga0163162_10381109	3300013306	Bacteria	1543
136	Ga0157372_10731999	3300013307	Unclassified	1150
137	Ga0157375_10009461	3300013308	Bacteria	8556
138	Ga0157375_10101149	3300013308	Bacteria	2965
139	Ga0163163_10136999	3300014325	Bacteria	2489
140	Ga0157380_10007802	3300014326	Bacteria	7615
141	Ga0157377_10077533	3300014745	Bacteria	1935
142	Ga0157377_10397510	3300014745	Bacteria	938
143	Ga0157379_10022354	3300014968	Bacteria	5602
144	Ga0157376_10023327	3300014969	Bacteria	4841
145	Ga0163161_10130890	3300017792	Bacteria	1892
146	Ga0213876_10039714	3300021384	Bacteria	2486
147	Ga0207656_10082931	3300025321	Bacteria	1444
148	Ga0207642_10035696	3300025899	Bacteria	2127
149	Ga0207642_10134361	3300025899	Bacteria	1295
150	Ga0207688_10263879	3300025901	Bacteria	1046
151	Ga0207645_10024134	3300025907	Bacteria	3945
152	Ga0207643_10026777	3300025908	Bacteria	3194
153	Ga0207643_10031162	3300025908	Bacteria	2971
154	Ga0207684_10002038	3300025910	Bacteria	20809
155	Ga0207684_10033061	3300025910	Bacteria	4399
156	Ga0207707_10041065	3300025912	Bacteria	4039
157	Ga0207695_10079040	3300025913	Bacteria	3335
158	Ga0207693_10003232	3300025915	Bacteria	13984
159	Ga0207660_10116625	3300025917	Unclassified	2017
160	Ga0207660_10203202	3300025917	Bacteria	1548
161	Ga0207652_10193922	3300025921	Unclassified	1827
162	Ga0207646_10000810	3300025922	Bacteria	40719
163	Ga0207681_10002855	3300025923	Bacteria	10915
164	Ga0207694_10072571	3300025924	Bacteria	2691
165	Ga0207659_10376457	3300025926	Bacteria	1183
166	Ga0207687_10026386	3300025927	Bacteria	3890
167	Ga0207687_10151053	3300025927	Bacteria	1772
168	Ga0207687_10243054	3300025927	Bacteria	1428
169	Ga0207664_10021212	3300025929	Bacteria	4825
170	Ga0207690_10549017	3300025932	Bacteria	939
171	Ga0207706_10000006	3300025933	Bacteria	216994
172	Ga0207686_10024014	3300025934	Bacteria	3526
173	Ga0207686_10028296	3300025934	Bacteria	3293
174	Ga0207709_10032478	3300025935	Bacteria	3056
175	Ga0207709_10057767	3300025935	Bacteria	2408
176	Ga0207709_10149771	3300025935	Bacteria	1614
177	Ga0207709_10165173	3300025935	Bacteria	1548
178	Ga0207669_10000010	3300025937	Bacteria	150070
179	Ga0207669_10040806	3300025937	Bacteria	2696
180	Ga0207704_10015036	3300025938	Bacteria	3931
181	Ga0207704_10033933	3300025938	Bacteria	2907
182	Ga0207665_10249972	3300025939	Bacteria	1310
183	Ga0207691_10095028	3300025940	Bacteria	2666
184	Ga0207691_10323915	3300025940	Bacteria	1321
185	Ga0207711_10050425	3300025941	Bacteria	3563
186	Ga0207689_10142051	3300025942	Bacteria	1978
187	Ga0207689_10147684	3300025942	Bacteria	1937
188	Ga0207651_10082788	3300025960	Bacteria	2318
189	Ga0207712_10047557	3300025961	Bacteria	2979
190	Ga0207712_10732822	3300025961	Unclassified	865
191	Ga0207640_10005392	3300025981	Bacteria	6972
192	Ga0207677_10000813	3300026023	Bacteria	17842
193	Ga0207677_10068643	3300026023	Bacteria	2489
194	Ga0207677_10166995	3300026023	Bacteria	1716
195	Ga0207703_10111024	3300026035	Bacteria	2340
196	Ga0207678_10144474	3300026067	Bacteria	2031
197	Ga0207708_10006233	3300026075	Bacteria	8835
198	Ga0207708_10021101	3300026075	Bacteria	4913
199	Ga0207708_10574631	3300026075	Bacteria	953
200	Ga0207648_10007378	3300026089	Bacteria	10826
201	Ga0207648_10023098	3300026089	Bacteria	5578
202	Ga0207676_10000025	3300026095	Bacteria	261714
203	Ga0207676_10378263	3300026095	Bacteria	1317
204	Ga0207674_10292815	3300026116	Bacteria	1576
205	Ga0207675_100016021	3300026118	Bacteria	6998
206	Ga0207675_100484459	3300026118	Bacteria	1230
207	Ga0207683_10050951	3300026121	Bacteria	3627
208	Ga0207683_10141129	3300026121	Bacteria	2171
209	Ga0207683_10255129	3300026121	Bacteria	1601
210	Ga0207428_10151840	3300027907	Bacteria	1763
211	Ga0207428_10213922	3300027907	Bacteria	1447
212	Ga0207428_10361614	3300027907	Bacteria	1067
213	Ga0207428_10551809	3300027907	Bacteria	833
214	Ga0268265_10000922	3300028380	Bacteria	27196
215	Ga0268265_10572921	3300028380	Bacteria	1075
216	Ga0265318_10028052	3300028577	Bacteria	2206
217	Ga0265327_10126819	3300031251	Bacteria	1204
218	Ga0307408_100348875	3300031548	Bacteria	1255
219	Ga0307405_10019284	3300031731	Bacteria	3784
220	Ga0307413_10070880	3300031824	Bacteria	2193
221	Ga0307413_10546631	3300031824	Bacteria	939
222	Ga0307410_10054248	3300031852	Bacteria	2716
223	Ga0307406_10171225	3300031901	Bacteria	1572
224	Ga0307406_10532239	3300031901	Bacteria	958
225	Ga0307407_10043075	3300031903	Bacteria	2535
226	Ga0307409_100055714	3300031995	Bacteria	3054
227	Ga0307416_100011634	3300032002	Bacteria	5883
228	Ga0307416_100180124	3300032002	Bacteria	1979
229	Ga0307416_100621119	3300032002	Bacteria	1163
230	Ga0307411_10042492	3300032005	Bacteria	2900
231	Ga0307411_10166147	3300032005	Bacteria	1659
232	Ga0307415_100035830	3300032126	Bacteria	3244
233	Ga0373926_0000052	3300035083	Bacteria	20075
234	Ga0373934_0004110	3300035086	Bacteria	5365
235	Ga0373944_0000143	3300035089	Bacteria	13950
236	Ga0373936_0000345	3300035113	Bacteria	15690
237	Ga0373945_0027625	3300035116	Bacteria	1983
238	Ga0373953_0050282	3300035117	Bacteria	1683
239	Ga0373956_0000012	3300035119	Bacteria	57485
240	Ga0373957_0025878	3300035120	Bacteria	2118
241	Ga0373943_0004370	3300035170	Bacteria	6407
242	Ga0373946_0001367	3300035171	Bacteria	8450
243	Ga0373924_0099628	3300035410	Bacteria	1249
244	Ga0373931_0005440	3300035691	Bacteria	5889
245	Ga0373935_0084256	3300035692	Bacteria	2070
246	Ga0373935_0163861	3300035692	Bacteria	1517
247	Ga0373927_0003274	3300035695	Bacteria	11648
248	Ga0373933_0000864	3300035724	Bacteria	18577
249	Ga0373937_0000290	3300036401	Bacteria	47834
250	Ga0373937_0028140	3300036401	Bacteria	5086
251	Ga0395900_0097168	3300037418	Bacteria	3026
252	Ga0395898_0047270	3300037466	Bacteria	4224
253	Ga0395898_0278023	3300037466	Bacteria	1597
254	Ga0395898_0708634	3300037466	Bacteria	948
255	Ga0395905_0426328	3300037471	Bacteria	1223
256	Ga0395901_0432385	3300038443	Bacteria	1348
257	Ga0436365_1560757	3300039437	Bacteria	4041
258	Ga0451835_0411128	3300041492	Bacteria	791
259	Ga0451837_1629395	3300041494	Bacteria	994
260	Ga0439462_0028954	3300042015	Bacteria	1465
261	Ga0451577_0290493	3300042876	Bacteria	1481
262	Ga0466965_0290004	3300044683	Bacteria	886
263	Ga0466961_0042049	3300044693	Bacteria	2930
264	Ga0466963_0018410	3300044694	Bacteria	4367
265	Ga0453684_0520244	3300044712	Bacteria	1315
266	Ga0466971_0008634	3300044719	Bacteria	4445
267	Ga0466970_0066300	3300044765	Bacteria	1938
268	Ga0466957_0101645	3300044842	Bacteria	1813
269	Ga0466959_0110246	3300045049	Bacteria	1965
270	Ga0466959_0476648	3300045049	Bacteria	845
271	Ga0451576_0001308	3300045051	Bacteria	43120
272	Ga0451576_0063683	3300045051	Bacteria	3843
273	Ga0451576_0149975	3300045051	Bacteria	2432
274	Ga0466967_0034809	3300045976	Bacteria	4280
275	Ga0466967_1163747	3300045976	Bacteria	768
276	Ga0495592_0014278	3300046454	Bacteria	6031
277	Ga0495603_0033664	3300046455	Bacteria	3083
278	Ga0495629_0001186	3300046459	Bacteria	20554
279	Ga0495638_0041236	3300046460	Bacteria	2922
280	Ga0495641_0010189	3300046461	Bacteria	5484
281	Ga0495651_0000027	3300046462	Bacteria	107496
282	Ga0495651_0305533	3300046462	Bacteria	1065
283	Ga0495653_0088870	3300046463	Bacteria	2265
284	Ga0495650_0000063	3300046471	Bacteria	277841
285	Ga0495580_0067881	3300046472	Bacteria	2494
286	Ga0495580_0094020	3300046472	Bacteria	2086
287	Ga0495582_0002607	3300046473	Bacteria	10033
288	Ga0495639_0002310	3300046475	Bacteria	8359
289	Ga0495639_0183227	3300046475	Bacteria	1020
290	Ga0495662_0020619	3300046476	Bacteria	3189
291	Ga0495662_0022950	3300046476	Bacteria	3012
292	Ga0495662_0047799	3300046476	Bacteria	2065
293	Ga0495594_0000032	3300046499	Bacteria	63783
294	Ga0495608_0000884	3300046511	Bacteria	20971
295	Ga0495618_0030123	3300046514	Bacteria	3388
296	Ga0495618_0178521	3300046514	Bacteria	1350
297	Ga0495628_0031159	3300046516	Bacteria	4314
298	Ga0495628_0053571	3300046516	Bacteria	3183
299	Ga0495630_0006500	3300046517	Bacteria	8322
300	Ga0495630_0012039	3300046517	Bacteria	6274
301	Ga0495666_0000435	3300046526	Bacteria	18541
302	Ga0495666_0008003	3300046526	Bacteria	5294
303	Ga0495652_0098083	3300046529	Bacteria	2383
304	Ga0495665_0001041	3300046531	Bacteria	14709
305	Ga0495640_0005016	3300046533	Bacteria	10518
306	Ga0495640_0012029	3300046533	Bacteria	6631
307	Ga0495640_0046013	3300046533	Bacteria	3026
308	Ga0495640_0090510	3300046533	Bacteria	2019
309	Ga0495586_0000884	3300046535	Bacteria	17155
310	Ga0495586_0014381	3300046535	Bacteria	4204
311	Ga0495586_0059507	3300046535	Bacteria	2076
312	Ga0495645_0159101	3300046543	Bacteria	1563
313	Ga0495622_0003642	3300046557	Bacteria	7230
314	Ga0495667_0003283	3300046559	Bacteria	10840
315	Ga0495667_0014531	3300046559	Bacteria	5318
316	Ga0495656_0183028	3300046615	Bacteria	1031
317	Ga0495634_0000212	3300046642	Bacteria	53864
318	Ga0495634_0003189	3300046642	Bacteria	13272
319	Ga0495634_0200132	3300046642	Bacteria	1241
320	Ga0495635_0001657	3300046663	Bacteria	15003
321	Ga0495635_0169468	3300046663	Bacteria	1485
322	Ga0495588_0010493	3300046674	Bacteria	4308
323	Ga0495657_0124961	3300046675	Bacteria	1617
324	Ga0495599_0089907	3300046678	Bacteria	1916
325	Ga0495647_0001417	3300046681	Bacteria	7404
326	Ga0495658_0000696	3300046683	Bacteria	18195
327	Ga0495658_0001013	3300046683	Bacteria	14837
328	Ga0495658_0003908	3300046683	Bacteria	7364
329	Ga0495658_0571197	3300046683	Bacteria	724
330	Ga0495613_0005153	3300046689	Bacteria	9811
331	Ga0495613_0034168	3300046689	Bacteria	3777
332	Ga0495613_0150720	3300046689	Bacteria	1658
333	Ga0495624_0046616	3300046690	Bacteria	2755
334	Ga0495600_0040585	3300046809	Bacteria	3032
335	Ga0495581_0012590	3300047315	Bacteria	4901
336	Ga0495604_0046056	3300047317	Bacteria	3401
337	Ga0495674_0000020	3300047319	Bacteria	178465
338	Ga0495674_0002693	3300047319	Bacteria	17293
339	Ga0495674_0140566	3300047319	Bacteria	2030
340	Ga0495680_0000050	3300047322	Bacteria	95945
341	Ga0495680_0001972	3300047322	Bacteria	21556
342	Ga0495684_0478280	3300047471	Bacteria	860
343	Ga0495593_0083695	3300047673	Bacteria	1648
344	Ga0495614_0002902	3300048089	Bacteria	7635
345	Ga0496100_0000049	3300048903	Bacteria	75590
346	Ga0496100_0101411	3300048903	Bacteria	1984
347	Ga0496100_0356605	3300048903	Bacteria	1105
348	Ga0496101_0000010	3300048904	Bacteria	281990
349	Ga0496101_0040300	3300048904	Bacteria	3326
350	Ga0496101_0146939	3300048904	Bacteria	1801
351	Ga0496101_0158232	3300048904	Bacteria	1736
352	Ga0496102_0008946	3300048905	Bacteria	8594
353	Ga0496102_0082381	3300048905	Bacteria	2967
354	Ga0496102_0097371	3300048905	Bacteria	2728
355	Ga0496103_0040674	3300048906	Bacteria	2856
356	Ga0496104_0394275	3300048907	Bacteria	1296
357	Ga0496105_0016492	3300048908	Bacteria	5899
358	Ga0496106_0000018	3300048909	Bacteria	175028
359	Ga0496106_0012648	3300048909	Bacteria	6234
360	Ga0496106_0017303	3300048909	Bacteria	5336
361	Ga0496107_0000032	3300048910	Bacteria	99848
362	Ga0496107_0047753	3300048910	Bacteria	3083
363	Ga0496108_0022471	3300048911	Bacteria	5185
364	Ga0496109_0079322	3300048912	Bacteria	3024
365	Ga0496109_0331437	3300048912	Bacteria	1437
366	Ga0496109_1069884	3300048912	Bacteria	744
367	Ga0496110_0048518	3300048913	Bacteria	3722
368	Ga0496110_0049752	3300048913	Bacteria	3678
369	Ga0496111_0004245	3300048914	Bacteria	9029
370	Ga0496111_0021772	3300048914	Bacteria	4479
371	Ga0496112_0083196	3300048915	Bacteria	3165
372	Ga0496112_0766566	3300048915	Bacteria	890
373	Ga0496113_0117745	3300048916	Bacteria	2074
374	Ga0496113_0247806	3300048916	Bacteria	1422
375	Ga0496113_0482001	3300048916	Bacteria	996
376	Ga0496114_0002528	3300048917	Bacteria	13971
377	Ga0496114_0068844	3300048917	Bacteria	2971
378	Ga0496114_0736062	3300048917	Bacteria	863
379	Ga0496115_0072501	3300048918	Bacteria	2794
380	Ga0496115_0786199	3300048918	Bacteria	742
381	Ga0496118_0069576	3300048921	Bacteria	2548
382	Ga0496119_0000367	3300048922	Bacteria	63280
383	Ga0496121_0062609	3300048924	Bacteria	3046
384	Ga0501031_0007069	3300049568	Bacteria	7322
385	Ga0501031_0250219	3300049568	Bacteria	1152
386	Ga0501036_0024270	3300049572	Bacteria	5111
387	Ga0501038_0004049	3300049574	Bacteria	13624
388	Ga0501039_0023460	3300049575	Bacteria	4736
389	Ga0501039_0203722	3300049575	Bacteria	1556
390	Ga0501040_0001346	3300049576	Bacteria	15550
391	Ga0501040_0148908	3300049576	Bacteria	1650
392	Ga0501040_0370571	3300049576	Unclassified	1027
393	Ga0501041_0003789	3300049577	Bacteria	8707
394	Ga0501041_0021177	3300049577	Bacteria	3895
395	Ga0501042_0002916	3300049578	Bacteria	10618
396	Ga0501042_0066849	3300049578	Bacteria	2570
397	Ga0501042_0152511	3300049578	Bacteria	1666
398	Ga0501043_0028794	3300049579	Bacteria	4361
399	Ga0501046_0000720	3300049580	Bacteria	31979
400	Ga0501046_0005463	3300049580	Bacteria	11365
401	Ga0501046_0173777	3300049580	Bacteria	1615
402	Ga0501048_0004385	3300049582	Bacteria	10745
403	Ga0501048_0023272	3300049582	Bacteria	4530
404	Ga0501048_0376318	3300049582	Unclassified	1014
405	Ga0501048_0448193	3300049582	Bacteria	924
406	Ga0501067_0100626	3300049583	Bacteria	1606
407	Ga0501068_0016279	3300049584	Bacteria	4285
408	Ga0501068_0303108	3300049584	Bacteria	1023
409	Ga0501070_0513463	3300049586	Bacteria	962
410	Ga0501071_0030243	3300049587	Bacteria	3829
411	Ga0501071_0054497	3300049587	Bacteria	2885
412	Ga0501072_0007025	3300049588	Bacteria	8548
413	Ga0501072_0019895	3300049588	Bacteria	5195
414	Ga0501072_0028749	3300049588	Bacteria	4340
415	Ga0501073_0167980	3300049589	Bacteria	1519
416	Ga0501074_0068519	3300049590	Bacteria	2551
417	Ga0501074_0312199	3300049590	Bacteria	1117
418	Ga0501075_0003926	3300049591	Bacteria	10014
419	Ga0501075_0026835	3300049591	Bacteria	4242
420	Ga0501075_0091667	3300049591	Bacteria	2306
421	Ga0501075_0380843	3300049591	Bacteria	1075
422	Ga0501076_0013371	3300049592	Bacteria	6155
423	Ga0501076_0034176	3300049592	Bacteria	3972
424	Ga0501077_0204541	3300049593	Bacteria	1254
425	Ga0501077_0383601	3300049593	Bacteria	898
426	Ga0501079_0007673	3300049741	Bacteria	8167
427	Ga0501079_0034446	3300049741	Bacteria	3896
428	Ga0501080_0019781	3300049742	Bacteria	6234
429	Ga0501081_0002051	3300049743	Bacteria	12564
430	Ga0501081_0018235	3300049743	Bacteria	4660
431	Ga0501083_0063726	3300049744	Bacteria	2458
432	Ga0501035_0016621	3300049822	Bacteria	6784
433	Ga0501035_0044260	3300049822	Bacteria	4009
434	Ga0501045_0067281	3300049824	Bacteria	2631
435	Ga0501045_0177678	3300049824	Bacteria	1586
436	nmdc:mga05p37_1847_c1	3300050507	Bacteria	24673
437	nmdc:mga05p37_264011_c1	3300050507	Bacteria	2059
438	nmdc:mga05p37_377936_c1	3300050507	Bacteria	1661
439	nmdc:mga05p37_437176_c1	3300050507	Bacteria	1518
440	nmdc:mga05p37_889563_c1	3300050507	Bacteria	962
441	nmdc:mga0qj67_255595_c1	3300050509	Unclassified	1421
442	nmdc:mga06r32_231331_c1	3300050510	Bacteria	1836
443	nmdc:mga06r32_550449_c1	3300050510	Bacteria	1128
444	nmdc:mga08y16_207769_c1	3300050511	Bacteria	2028
445	nmdc:mga08y16_307875_c1	3300050511	Bacteria	1632
446	nmdc:mga08y16_438974_c1	3300050511	Bacteria	1333
447	nmdc:mga0n895_12457_c1	3300050512	Bacteria	7631
448	nmdc:mga0n895_420301_c1	3300050512	Bacteria	1351
449	nmdc:mga0a205_264435_c1	3300050515	Bacteria	1598
450	nmdc:mga0a205_60199_c1	3300050515	Bacteria	3667
451	Ga0495601_0000286	3300053077	Bacteria	26967
452	Ga0495601_0032566	3300053077	Bacteria	3245
453	Ga0495601_0043639	3300053077	Bacteria	2816
454	Ga0495595_0046421	3300053084	Bacteria	2001
455	Ga0495619_0001105	3300053085	Bacteria	17719
456	Ga0501084_0014794	3300054114	Bacteria	6472
457	Ga0501084_0171773	3300054114	Bacteria	1830
458	Ga0501084_0401432	3300054114	Bacteria	1158
459	Ga0501082_0012409	3300060353	Bacteria	7323
460	Ga0501082_0047130	3300060353	Bacteria	3714
461	Ga0501082_1046582	3300060353	Unclassified	714
462	Ga0466962_0023881	3300061719	Bacteria	2938
463	Ga0466962_0114141	3300061719	Bacteria	1301
464	Ga0530510_0001647	3300061734	Bacteria	15107
465	Ga0530510_0065970	3300061734	Bacteria	2623
466	Ga0530510_0073298	3300061734	Bacteria	2485
467	Ga0530510_0507392	3300061734	Bacteria	914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300037466	Ga0395898_0708634	Ga0395898_0708634_392_922	147
2	3300046462	Ga0495651_0305533	Ga0495651_0305533_42_617	160
3	3300009148	Ga0105243_10178760	Ga0105243_101787602	163
4	3300049568	Ga0501031_0007069	Ga0501031_0007069_6141_6782	164
5	3300049572	Ga0501036_0024270	Ga0501036_0024270_1791_2432	164
6	3300049576	Ga0501040_0148908	Ga0501040_0148908_420_1061	164
7	3300049577	Ga0501041_0021177	Ga0501041_0021177_2835_3476	164
8	3300049578	Ga0501042_0002916	Ga0501042_0002916_1792_2433	164
9	3300049580	Ga0501046_0005463	Ga0501046_0005463_7900_8541	164
10	3300049582	Ga0501048_0023272	Ga0501048_0023272_2964_3605	164
11	3300049584	Ga0501068_0016279	Ga0501068_0016279_816_1457	164
12	3300049587	Ga0501071_0030243	Ga0501071_0030243_182_823	164
13	3300049588	Ga0501072_0019895	Ga0501072_0019895_4130_4771	164
14	3300049589	Ga0501073_0167980	Ga0501073_0167980_570_1211	164
15	3300049591	Ga0501075_0026835	Ga0501075_0026835_173_814	164
16	3300049592	Ga0501076_0034176	Ga0501076_0034176_2681_3322	164
17	3300049741	Ga0501079_0034446	Ga0501079_0034446_154_795	164
18	3300049742	Ga0501080_0019781	Ga0501080_0019781_5413_6054	164
19	3300049743	Ga0501081_0002051	Ga0501081_0002051_6886_7527	164
20	3300049744	Ga0501083_0063726	Ga0501083_0063726_1609_2250	164
21	3300049822	Ga0501035_0044260	Ga0501035_0044260_386_1027	164
22	3300054114	Ga0501084_0401432	Ga0501084_0401432_271_912	164
23	3300060353	Ga0501082_0047130	Ga0501082_0047130_1044_1685	164
24	3300049579	Ga0501043_0028794	Ga0501043_0028794_2383_3024	169
25	3300045976	Ga0466967_1163747	Ga0466967_1163747_101_727	173
26	3300005718	Ga0068866_10003174	Ga0068866_100031746	175
27	3300025899	Ga0207642_10134361	Ga0207642_101343612	175
28	3300025935	Ga0207709_10149771	Ga0207709_101497712	175
29	3300025937	Ga0207669_10000010	Ga0207669_10000010110	175
30	3300037466	Ga0395898_0047270	Ga0395898_0047270_3584_4201	176
31	3300037471	Ga0395905_0426328	Ga0395905_0426328_582_1199	176
32	3300013308	Ga0157375_10101149	Ga0157375_101011493	177
33	3300005445	Ga0070708_100602164	Ga0070708_1006021642	179
34	3300005459	Ga0068867_100444933	Ga0068867_1004449332	179
35	3300006880	Ga0075429_100103734	Ga0075429_1001037341	179
36	3300009094	Ga0111539_10026129	Ga0111539_100261292	179
37	3300009098	Ga0105245_10501543	Ga0105245_105015431	179
38	3300041492	Ga0451835_0411128	Ga0451835_0411128_150_764	179
39	3300044712	Ga0453684_0520244	Ga0453684_0520244_340_951	179
40	3300046529	Ga0495652_0098083	Ga0495652_0098083_1757_2371	179
41	3300005338	Ga0068868_100000325	Ga0068868_10000032516	180
42	3300005440	Ga0070705_100314094	Ga0070705_1003140942	180
43	3300005518	Ga0070699_100010746	Ga0070699_1000107462	180
44	3300005545	Ga0070695_100160164	Ga0070695_1001601642	180
45	3300005546	Ga0070696_100350009	Ga0070696_1003500092	180
46	3300005549	Ga0070704_100779960	Ga0070704_1007799601	180
47	3300006847	Ga0075431_100308037	Ga0075431_1003080372	180
48	3300006871	Ga0075434_100241644	Ga0075434_1002416444	180
49	3300006880	Ga0075429_100550820	Ga0075429_1005508202	180
50	3300009176	Ga0105242_10085329	Ga0105242_100853291	180
51	3300025940	Ga0207691_10323915	Ga0207691_103239153	180
52	3300025961	Ga0207712_10732822	Ga0207712_107328222	180
53	3300026023	Ga0207677_10000813	Ga0207677_1000081317	180
54	3300027907	Ga0207428_10551809	Ga0207428_105518092	180
55	3300046615	Ga0495656_0183028	Ga0495656_0183028_391_1008	180
56	3300049576	Ga0501040_0370571	Ga0501040_0370571_42_659	180
57	3300006852	Ga0075433_10000520	Ga0075433_1000052026	181
58	3300006871	Ga0075434_100005471	Ga0075434_1000054716	181
59	3300007076	Ga0075435_100001601	Ga0075435_10000160115	181
60	3300009147	Ga0114129_10033177	Ga0114129_100331773	181
61	3300048903	Ga0496100_0000049	Ga0496100_0000049_37898_38533	181
62	3300048904	Ga0496101_0000010	Ga0496101_0000010_62027_62662	181
63	3300048909	Ga0496106_0000018	Ga0496106_0000018_10617_11252	181
64	3300048910	Ga0496107_0000032	Ga0496107_0000032_37235_37870	181
65	3300048916	Ga0496113_0482001	Ga0496113_0482001_293_928	181
66	3300050512	nmdc:mga0n895_12457_c1	nmdc:mga0n895_12457_c1_1519_2157	181
67	3300050515	nmdc:mga0a205_264435_c1	nmdc:mga0a205_264435_c1_72_710	181
68	3300005536	Ga0070697_100228544	Ga0070697_1002285442	182
69	3300046516	Ga0495628_0053571	Ga0495628_0053571_1282_1923	182
70	3300046678	Ga0495599_0089907	Ga0495599_0089907_247_888	182
71	3300047319	Ga0495674_0140566	Ga0495674_0140566_925_1566	182
72	3300047471	Ga0495684_0478280	Ga0495684_0478280_192_833	182
73	3300053077	Ga0495601_0000286	Ga0495601_0000286_10686_11327	182
74	3300053084	Ga0495595_0046421	Ga0495595_0046421_1034_1675	182
75	iso_pu_bacteria	2919443155	2919445443	182
76	3300048912	Ga0496109_1069884	Ga0496109_1069884_100_699	183
77	3300049578	Ga0501042_0152511	Ga0501042_0152511_240_839	183
78	3300049590	Ga0501074_0312199	Ga0501074_0312199_299_898	183
79	3300049591	Ga0501075_0091667	Ga0501075_0091667_310_909	183
80	3300049593	Ga0501077_0383601	Ga0501077_0383601_195_794	183
81	3300049824	Ga0501045_0067281	Ga0501045_0067281_530_1129	183
82	3300050507	nmdc:mga05p37_437176_c1	nmdc:mga05p37_437176_c1_17_637	183
83	3300061734	Ga0530510_0073298	Ga0530510_0073298_1756_2355	183
84	3300005356	Ga0070674_100000006	Ga0070674_10000000648	184
85	3300009148	Ga0105243_10267006	Ga0105243_102670062	184
86	3300032005	Ga0307411_10166147	Ga0307411_101661471	184
87	3300037418	Ga0395900_0097168	Ga0395900_0097168_889_1530	184
88	3300037466	Ga0395898_0278023	Ga0395898_0278023_415_1056	184
89	3300038443	Ga0395901_0432385	Ga0395901_0432385_161_802	184
90	3300046471	Ga0495650_0000063	Ga0495650_0000063_161580_162194	184
91	3300049582	Ga0501048_0376318	Ga0501048_0376318_51_680	184
92	3300050510	nmdc:mga06r32_550449_c1	nmdc:mga06r32_550449_c1_214_843	184
93	3300005618	Ga0068864_100000023	Ga0068864_10000002333	185
94	3300013102	Ga0157371_10529074	Ga0157371_105290741	185
95	3300026095	Ga0207676_10000025	Ga0207676_10000025242	185
96	3300031251	Ga0265327_10126819	Ga0265327_101268192	185
97	3300044765	Ga0466970_0066300	Ga0466970_0066300_877_1485	185
98	3300048922	Ga0496119_0000367	Ga0496119_0000367_56297_56920	185
99	3300049586	Ga0501070_0513463	Ga0501070_0513463_242_859	185
100	3300005547	Ga0070693_100001020	Ga0070693_1000010206	186
101	3300005981	Ga0081538_10034373	Ga0081538_100343733	186
102	3300026116	Ga0207674_10292815	Ga0207674_102928153	186
103	3300032002	Ga0307416_100011634	Ga0307416_1000116345	186
104	3300048912	Ga0496109_0331437	Ga0496109_0331437_440_1054	186
105	3300050510	nmdc:mga06r32_231331_c1	nmdc:mga06r32_231331_c1_539_1174	186
106	3300005337	Ga0070682_100246308	Ga0070682_1002463082	187
107	3300005340	Ga0070689_100036026	Ga0070689_1000360265	187
108	3300005435	Ga0070714_100006631	Ga0070714_1000066312	187
109	3300005457	Ga0070662_100000005	Ga0070662_10000000583	187
110	3300005544	Ga0070686_100296232	Ga0070686_1002962322	187
111	3300005548	Ga0070665_100119332	Ga0070665_1001193324	187
112	3300005841	Ga0068863_100273485	Ga0068863_1002734852	187
113	3300005937	Ga0081455_10059298	Ga0081455_100592982	187
114	3300009094	Ga0111539_10761974	Ga0111539_107619742	187
115	3300009098	Ga0105245_10006357	Ga0105245_100063577	187
116	3300009176	Ga0105242_10224667	Ga0105242_102246673	187
117	3300009177	Ga0105248_10086279	Ga0105248_100862794	187
118	3300010375	Ga0105239_10260759	Ga0105239_102607592	187
119	3300013297	Ga0157378_10429689	Ga0157378_104296892	187
120	3300013306	Ga0163162_10381109	Ga0163162_103811092	187
121	3300025908	Ga0207643_10031162	Ga0207643_100311625	187
122	3300025927	Ga0207687_10026386	Ga0207687_100263865	187
123	3300025929	Ga0207664_10021212	Ga0207664_100212125	187
124	3300025933	Ga0207706_10000006	Ga0207706_10000006157	187
125	3300025935	Ga0207709_10057767	Ga0207709_100577674	187
126	3300026067	Ga0207678_10144474	Ga0207678_101444743	187
127	3300026121	Ga0207683_10050951	Ga0207683_100509515	187
128	3300026121	Ga0207683_10255129	Ga0207683_102551293	187
129	3300031548	Ga0307408_100348875	Ga0307408_1003488751	187
130	3300046683	Ga0495658_0000696	Ga0495658_0000696_5589_6230	187
131	3300048903	Ga0496100_0101411	Ga0496100_0101411_1088_1735	187
132	3300048904	Ga0496101_0158232	Ga0496101_0158232_123_770	187
133	3300048905	Ga0496102_0008946	Ga0496102_0008946_5637_6284	187
134	3300048906	Ga0496103_0040674	Ga0496103_0040674_163_810	187
135	3300048907	Ga0496104_0394275	Ga0496104_0394275_291_938	187
136	3300048908	Ga0496105_0016492	Ga0496105_0016492_4582_5229	187
137	3300048909	Ga0496106_0017303	Ga0496106_0017303_2890_3537	187
138	3300048913	Ga0496110_0048518	Ga0496110_0048518_2459_3106	187
139	3300048914	Ga0496111_0021772	Ga0496111_0021772_962_1609	187
140	3300048915	Ga0496112_0766566	Ga0496112_0766566_72_719	187
141	3300048916	Ga0496113_0117745	Ga0496113_0117745_563_1210	187
142	3300048917	Ga0496114_0002528	Ga0496114_0002528_4450_5097	187
143	3300048918	Ga0496115_0072501	Ga0496115_0072501_1228_1875	187
144	3300049575	Ga0501039_0203722	Ga0501039_0203722_833_1495	187
145	3300049592	Ga0501076_0013371	Ga0501076_0013371_3233_3895	187
146	3300005353	Ga0070669_100043145	Ga0070669_1000431452	188
147	3300005458	Ga0070681_10394591	Ga0070681_103945912	188
148	3300005618	Ga0068864_100668651	Ga0068864_1006686512	188
149	3300005981	Ga0081538_10032140	Ga0081538_100321405	188
150	3300005983	Ga0081540_1000006	Ga0081540_10000062	188
151	3300009094	Ga0111539_10287835	Ga0111539_102878352	188
152	3300027907	Ga0207428_10361614	Ga0207428_103616142	188
153	3300035117	Ga0373953_0050282	Ga0373953_0050282_765_1406	188
154	3300035410	Ga0373924_0099628	Ga0373924_0099628_263_904	188
155	3300035692	Ga0373935_0163861	Ga0373935_0163861_542_1183	188
156	3300036401	Ga0373937_0028140	Ga0373937_0028140_2587_3228	188
157	3300041494	Ga0451837_1629395	Ga0451837_1629395_244_912	188
158	3300042876	Ga0451577_0290493	Ga0451577_0290493_388_1029	188
159	3300044683	Ga0466965_0290004	Ga0466965_0290004_219_857	188
160	3300045049	Ga0466959_0476648	Ga0466959_0476648_170_811	188
161	3300045051	Ga0451576_0001308	Ga0451576_0001308_5419_6060	188
162	3300045051	Ga0451576_0063683	Ga0451576_0063683_3011_3652	188
163	3300045976	Ga0466967_0034809	Ga0466967_0034809_3230_3871	188
164	3300046454	Ga0495592_0014278	Ga0495592_0014278_1310_1951	188
165	3300046476	Ga0495662_0020619	Ga0495662_0020619_43_684	188
166	3300046476	Ga0495662_0047799	Ga0495662_0047799_807_1448	188
167	3300046499	Ga0495594_0000032	Ga0495594_0000032_15290_15934	188
168	3300046511	Ga0495608_0000884	Ga0495608_0000884_1403_2044	188
169	3300046514	Ga0495618_0030123	Ga0495618_0030123_2522_3163	188
170	3300046516	Ga0495628_0031159	Ga0495628_0031159_2335_2976	188
171	3300046517	Ga0495630_0012039	Ga0495630_0012039_1538_2179	188
172	3300046526	Ga0495666_0008003	Ga0495666_0008003_707_1348	188
173	3300046533	Ga0495640_0046013	Ga0495640_0046013_2320_2961	188
174	3300046533	Ga0495640_0090510	Ga0495640_0090510_1307_1948	188
175	3300046535	Ga0495586_0000884	Ga0495586_0000884_148_789	188
176	3300046543	Ga0495645_0159101	Ga0495645_0159101_549_1190	188
177	3300046557	Ga0495622_0003642	Ga0495622_0003642_5742_6386	188
178	3300046559	Ga0495667_0003283	Ga0495667_0003283_6603_7244	188
179	3300046642	Ga0495634_0003189	Ga0495634_0003189_2355_2996	188
180	3300046642	Ga0495634_0200132	Ga0495634_0200132_461_1102	188
181	3300046663	Ga0495635_0169468	Ga0495635_0169468_527_1168	188
182	3300046683	Ga0495658_0003908	Ga0495658_0003908_1820_2461	188
183	3300046689	Ga0495613_0150720	Ga0495613_0150720_954_1595	188
184	3300046809	Ga0495600_0040585	Ga0495600_0040585_248_889	188
185	3300047317	Ga0495604_0046056	Ga0495604_0046056_2376_3017	188
186	3300047322	Ga0495680_0001972	Ga0495680_0001972_18860_19501	188
187	3300049574	Ga0501038_0004049	Ga0501038_0004049_5234_5875	188
188	3300049576	Ga0501040_0001346	Ga0501040_0001346_8304_8945	188
189	3300049577	Ga0501041_0003789	Ga0501041_0003789_6003_6644	188
190	3300049580	Ga0501046_0000720	Ga0501046_0000720_28743_29384	188
191	3300049582	Ga0501048_0004385	Ga0501048_0004385_5123_5764	188
192	3300049587	Ga0501071_0054497	Ga0501071_0054497_1006_1647	188
193	3300049588	Ga0501072_0007025	Ga0501072_0007025_142_783	188
194	3300049591	Ga0501075_0003926	Ga0501075_0003926_8347_8988	188
195	3300049741	Ga0501079_0007673	Ga0501079_0007673_6060_6701	188
196	3300049822	Ga0501035_0016621	Ga0501035_0016621_2939_3580	188
197	3300050511	nmdc:mga08y16_438974_c1	nmdc:mga08y16_438974_c1_144_785	188
198	3300050512	nmdc:mga0n895_420301_c1	nmdc:mga0n895_420301_c1_434_1075	188
199	3300053077	Ga0495601_0032566	Ga0495601_0032566_1558_2199	188
200	3300053077	Ga0495601_0043639	Ga0495601_0043639_1569_2210	188
201	3300060353	Ga0501082_0012409	Ga0501082_0012409_6541_7182	188
202	3300061719	Ga0466962_0114141	Ga0466962_0114141_77_718	188
203	3300061734	Ga0530510_0001647	Ga0530510_0001647_1429_2070	188
204	3300005336	Ga0070680_100020043	Ga0070680_1000200434	189
205	3300005336	Ga0070680_100041844	Ga0070680_1000418444	189
206	3300005353	Ga0070669_100007595	Ga0070669_1000075953	189
207	3300005356	Ga0070674_100049847	Ga0070674_1000498472	189
208	3300005441	Ga0070700_100000652	Ga0070700_1000006523	189
209	3300005445	Ga0070708_100641469	Ga0070708_1006414692	189
210	3300005457	Ga0070662_100073598	Ga0070662_1000735983	189
211	3300005458	Ga0070681_10060080	Ga0070681_100600804	189
212	3300005459	Ga0068867_100000876	Ga0068867_1000008764	189
213	3300005467	Ga0070706_100154194	Ga0070706_1001541941	189
214	3300005468	Ga0070707_100021057	Ga0070707_1000210572	189
215	3300005471	Ga0070698_100025343	Ga0070698_1000253432	189
216	3300005518	Ga0070699_100012160	Ga0070699_1000121602	189
217	3300005518	Ga0070699_100134713	Ga0070699_1001347133	189
218	3300005530	Ga0070679_100059844	Ga0070679_1000598444	189
219	3300005536	Ga0070697_100007736	Ga0070697_1000077364	189
220	3300005543	Ga0070672_100162904	Ga0070672_1001629042	189
221	3300005546	Ga0070696_100169877	Ga0070696_1001698772	189
222	3300005549	Ga0070704_100026645	Ga0070704_1000266453	189
223	3300005578	Ga0068854_100200521	Ga0068854_1002005212	189
224	3300005719	Ga0068861_100010290	Ga0068861_1000102903	189
225	3300005844	Ga0068862_100001923	Ga0068862_10000192319	189
226	3300006844	Ga0075428_100101872	Ga0075428_1001018723	189
227	3300006852	Ga0075433_10078190	Ga0075433_100781905	189
228	3300009093	Ga0105240_10268522	Ga0105240_102685222	189
229	3300009094	Ga0111539_10220748	Ga0111539_102207484	189
230	3300009094	Ga0111539_10320686	Ga0111539_103206862	189
231	3300009147	Ga0114129_10317715	Ga0114129_103177152	189
232	3300009147	Ga0114129_10658073	Ga0114129_106580732	189
233	3300009147	Ga0114129_11253582	Ga0114129_112535822	189
234	3300009148	Ga0105243_10003195	Ga0105243_100031954	189
235	3300009553	Ga0105249_10003043	Ga0105249_100030433	189
236	3300013104	Ga0157370_10487104	Ga0157370_104871042	189
237	3300013307	Ga0157372_10731999	Ga0157372_107319991	189
238	3300014326	Ga0157380_10007802	Ga0157380_100078022	189
239	3300017792	Ga0163161_10130890	Ga0163161_101308902	189
240	3300021384	Ga0213876_10039714	Ga0213876_100397143	189
241	3300025899	Ga0207642_10035696	Ga0207642_100356961	189
242	3300025908	Ga0207643_10026777	Ga0207643_100267775	189
243	3300025910	Ga0207684_10002038	Ga0207684_100020382	189
244	3300025912	Ga0207707_10041065	Ga0207707_100410652	189
245	3300025913	Ga0207695_10079040	Ga0207695_100790405	189
246	3300025917	Ga0207660_10116625	Ga0207660_101166252	189
247	3300025917	Ga0207660_10203202	Ga0207660_102032022	189
248	3300025921	Ga0207652_10193922	Ga0207652_101939222	189
249	3300025922	Ga0207646_10000810	Ga0207646_1000081011	189
250	3300025923	Ga0207681_10002855	Ga0207681_100028554	189
251	3300025934	Ga0207686_10024014	Ga0207686_100240145	189
252	3300025935	Ga0207709_10032478	Ga0207709_100324783	189
253	3300025938	Ga0207704_10015036	Ga0207704_100150364	189
254	3300025940	Ga0207691_10095028	Ga0207691_100950283	189
255	3300025961	Ga0207712_10047557	Ga0207712_100475573	189
256	3300025981	Ga0207640_10005392	Ga0207640_100053928	189
257	3300026075	Ga0207708_10006233	Ga0207708_100062338	189
258	3300026075	Ga0207708_10574631	Ga0207708_105746311	189
259	3300026089	Ga0207648_10007378	Ga0207648_100073784	189
260	3300026118	Ga0207675_100016021	Ga0207675_1000160217	189
261	3300027907	Ga0207428_10151840	Ga0207428_101518403	189
262	3300028380	Ga0268265_10000922	Ga0268265_1000092227	189
263	3300028577	Ga0265318_10028052	Ga0265318_100280523	189
264	3300031731	Ga0307405_10019284	Ga0307405_100192843	189
265	3300031824	Ga0307413_10070880	Ga0307413_100708803	189
266	3300031824	Ga0307413_10546631	Ga0307413_105466311	189
267	3300031852	Ga0307410_10054248	Ga0307410_100542483	189
268	3300031901	Ga0307406_10171225	Ga0307406_101712252	189
269	3300031903	Ga0307407_10043075	Ga0307407_100430752	189
270	3300031995	Ga0307409_100055714	Ga0307409_1000557143	189
271	3300032002	Ga0307416_100180124	Ga0307416_1001801241	189
272	3300032002	Ga0307416_100621119	Ga0307416_1006211192	189
273	3300032005	Ga0307411_10042492	Ga0307411_100424921	189
274	3300032126	Ga0307415_100035830	Ga0307415_1000358304	189
275	3300035691	Ga0373931_0005440	Ga0373931_0005440_4278_4925	189
276	3300039437	Ga0436365_1560757	Ga0436365_1560757_1737_2381	189
277	3300042015	Ga0439462_0028954	Ga0439462_0028954_706_1350	189
278	3300044693	Ga0466961_0042049	Ga0466961_0042049_2018_2662	189
279	3300044694	Ga0466963_0018410	Ga0466963_0018410_1371_2015	189
280	3300044719	Ga0466971_0008634	Ga0466971_0008634_3550_4194	189
281	3300044842	Ga0466957_0101645	Ga0466957_0101645_261_905	189
282	3300045049	Ga0466959_0110246	Ga0466959_0110246_792_1436	189
283	3300045051	Ga0451576_0149975	Ga0451576_0149975_1003_1650	189
284	3300046460	Ga0495638_0041236	Ga0495638_0041236_1709_2362	189
285	3300046533	Ga0495640_0012029	Ga0495640_0012029_2649_3296	189
286	3300047319	Ga0495674_0000020	Ga0495674_0000020_144883_145530	189
287	3300049568	Ga0501031_0250219	Ga0501031_0250219_85_723	189
288	3300050507	nmdc:mga05p37_1847_c1	nmdc:mga05p37_1847_c1_13625_14269	189
289	3300050507	nmdc:mga05p37_264011_c1	nmdc:mga05p37_264011_c1_1264_1908	189
290	3300050507	nmdc:mga05p37_377936_c1	nmdc:mga05p37_377936_c1_776_1420	189
291	3300050509	nmdc:mga0qj67_255595_c1	nmdc:mga0qj67_255595_c1_13_657	189
292	3300050511	nmdc:mga08y16_207769_c1	nmdc:mga08y16_207769_c1_270_914	189
293	3300050511	nmdc:mga08y16_307875_c1	nmdc:mga08y16_307875_c1_604_1248	189
294	3300050515	nmdc:mga0a205_60199_c1	nmdc:mga0a205_60199_c1_2852_3496	189
295	3300060353	Ga0501082_1046582	Ga0501082_1046582_43_687	189
296	3300061719	Ga0466962_0023881	Ga0466962_0023881_969_1613	189
297	3300005545	Ga0070695_100075625	Ga0070695_1000756253	190
298	3300005719	Ga0068861_101408428	Ga0068861_1014084281	190
299	3300009094	Ga0111539_11519897	Ga0111539_115198971	190
300	3300026118	Ga0207675_100484459	Ga0207675_1004844592	190
301	3300031901	Ga0307406_10532239	Ga0307406_105322391	190
302	3300035086	Ga0373934_0004110	Ga0373934_0004110_2873_3520	190
303	3300035119	Ga0373956_0000012	Ga0373956_0000012_25983_26630	190
304	3300035120	Ga0373957_0025878	Ga0373957_0025878_96_743	190
305	3300035724	Ga0373933_0000864	Ga0373933_0000864_15138_15785	190
306	3300036401	Ga0373937_0000290	Ga0373937_0000290_3974_4621	190
307	3300046462	Ga0495651_0000027	Ga0495651_0000027_103589_104236	190
308	3300046675	Ga0495657_0124961	Ga0495657_0124961_679_1326	190
309	3300049575	Ga0501039_0023460	Ga0501039_0023460_1624_2271	190
310	3300049578	Ga0501042_0066849	Ga0501042_0066849_953_1600	190
311	3300049580	Ga0501046_0173777	Ga0501046_0173777_76_723	190
312	3300049582	Ga0501048_0448193	Ga0501048_0448193_36_686	190
313	3300049584	Ga0501068_0303108	Ga0501068_0303108_40_687	190
314	3300049588	Ga0501072_0028749	Ga0501072_0028749_886_1533	190
315	3300049590	Ga0501074_0068519	Ga0501074_0068519_388_1035	190
316	3300049591	Ga0501075_0380843	Ga0501075_0380843_139_786	190
317	3300049593	Ga0501077_0204541	Ga0501077_0204541_196_843	190
318	3300049743	Ga0501081_0018235	Ga0501081_0018235_3927_4574	190
319	3300049824	Ga0501045_0177678	Ga0501045_0177678_652_1299	190
320	3300050507	nmdc:mga05p37_889563_c1	nmdc:mga05p37_889563_c1_113_760	190
321	3300054114	Ga0501084_0014794	Ga0501084_0014794_545_1192	190
322	3300054114	Ga0501084_0171773	Ga0501084_0171773_504_1151	190
323	3300061734	Ga0530510_0065970	Ga0530510_0065970_670_1317	190
324	3300061734	Ga0530510_0507392	Ga0530510_0507392_100_750	190
325	3300005328	Ga0070676_10150250	Ga0070676_101502502	191
326	3300005334	Ga0068869_100048061	Ga0068869_1000480613	191
327	3300005334	Ga0068869_100462392	Ga0068869_1004623922	191
328	3300005338	Ga0068868_100181913	Ga0068868_1001819133	191
329	3300005338	Ga0068868_100352029	Ga0068868_1003520292	191
330	3300005340	Ga0070689_101008437	Ga0070689_1010084371	191
331	3300005354	Ga0070675_100182164	Ga0070675_1001821643	191
332	3300005364	Ga0070673_100016753	Ga0070673_1000167534	191
333	3300005366	Ga0070659_100156044	Ga0070659_1001560443	191
334	3300005441	Ga0070700_100039685	Ga0070700_1000396854	191
335	3300005457	Ga0070662_100890681	Ga0070662_1008906811	191
336	3300005459	Ga0068867_100009897	Ga0068867_1000098973	191
337	3300005544	Ga0070686_100132260	Ga0070686_1001322603	191
338	3300005545	Ga0070695_100619242	Ga0070695_1006192421	191
339	3300005547	Ga0070693_100776870	Ga0070693_1007768701	191
340	3300005548	Ga0070665_100690587	Ga0070665_1006905872	191
341	3300005615	Ga0070702_100167301	Ga0070702_1001673013	191
342	3300005615	Ga0070702_100285488	Ga0070702_1002854882	191
343	3300005618	Ga0068864_100053566	Ga0068864_1000535662	191
344	3300005834	Ga0068851_10233800	Ga0068851_102338002	191
345	3300005842	Ga0068858_100848683	Ga0068858_1008486831	191
346	3300005843	Ga0068860_100460110	Ga0068860_1004601102	191
347	3300005844	Ga0068862_100491740	Ga0068862_1004917402	191
348	3300005983	Ga0081540_1129260	Ga0081540_11292602	191
349	3300006163	Ga0070715_10011923	Ga0070715_100119234	191
350	3300006163	Ga0070715_10333612	Ga0070715_103336122	191
351	3300006173	Ga0070716_100192941	Ga0070716_1001929413	191
352	3300006175	Ga0070712_100009755	Ga0070712_1000097556	191
353	3300006881	Ga0068865_100043184	Ga0068865_1000431843	191
354	3300009011	Ga0105251_10153429	Ga0105251_101534291	191
355	3300009098	Ga0105245_10130908	Ga0105245_101309084	191
356	3300009098	Ga0105245_10950135	Ga0105245_109501352	191
357	3300009148	Ga0105243_10243842	Ga0105243_102438423	191
358	3300009176	Ga0105242_10623011	Ga0105242_106230112	191
359	3300009177	Ga0105248_10045036	Ga0105248_100450364	191
360	3300009545	Ga0105237_10729413	Ga0105237_107294131	191
361	3300009551	Ga0105238_10497175	Ga0105238_104971752	191
362	3300011119	Ga0105246_10668795	Ga0105246_106687952	191
363	3300013297	Ga0157378_10141845	Ga0157378_101418453	191
364	3300013306	Ga0163162_10173336	Ga0163162_101733363	191
365	3300013308	Ga0157375_10009461	Ga0157375_100094614	191
366	3300014325	Ga0163163_10136999	Ga0163163_101369991	191
367	3300014745	Ga0157377_10077533	Ga0157377_100775332	191
368	3300014745	Ga0157377_10397510	Ga0157377_103975101	191
369	3300014968	Ga0157379_10022354	Ga0157379_100223544	191
370	3300014969	Ga0157376_10023327	Ga0157376_100233276	191
371	3300025321	Ga0207656_10082931	Ga0207656_100829313	191
372	3300025901	Ga0207688_10263879	Ga0207688_102638792	191
373	3300025907	Ga0207645_10024134	Ga0207645_100241346	191
374	3300025915	Ga0207693_10003232	Ga0207693_100032328	191
375	3300025924	Ga0207694_10072571	Ga0207694_100725712	191
376	3300025926	Ga0207659_10376457	Ga0207659_103764571	191
377	3300025927	Ga0207687_10151053	Ga0207687_101510533	191
378	3300025927	Ga0207687_10243054	Ga0207687_102430543	191
379	3300025932	Ga0207690_10549017	Ga0207690_105490172	191
380	3300025934	Ga0207686_10028296	Ga0207686_100282962	191
381	3300025935	Ga0207709_10165173	Ga0207709_101651733	191
382	3300025937	Ga0207669_10040806	Ga0207669_100408063	191
383	3300025938	Ga0207704_10033933	Ga0207704_100339332	191
384	3300025939	Ga0207665_10249972	Ga0207665_102499723	191
385	3300025941	Ga0207711_10050425	Ga0207711_100504253	191
386	3300025942	Ga0207689_10142051	Ga0207689_101420513	191
387	3300025942	Ga0207689_10147684	Ga0207689_101476842	191
388	3300025960	Ga0207651_10082788	Ga0207651_100827883	191
389	3300026023	Ga0207677_10068643	Ga0207677_100686433	191
390	3300026023	Ga0207677_10166995	Ga0207677_101669951	191
391	3300026035	Ga0207703_10111024	Ga0207703_101110242	191
392	3300026075	Ga0207708_10021101	Ga0207708_100211013	191
393	3300026089	Ga0207648_10023098	Ga0207648_100230982	191
394	3300026095	Ga0207676_10378263	Ga0207676_103782632	191
395	3300026121	Ga0207683_10141129	Ga0207683_101411292	191
396	3300028380	Ga0268265_10572921	Ga0268265_105729212	191
397	3300035083	Ga0373926_0000052	Ga0373926_0000052_8868_9482	191
398	3300035089	Ga0373944_0000143	Ga0373944_0000143_1666_2280	191
399	3300035113	Ga0373936_0000345	Ga0373936_0000345_9834_10448	191
400	3300035116	Ga0373945_0027625	Ga0373945_0027625_143_757	191
401	3300035170	Ga0373943_0004370	Ga0373943_0004370_4567_5181	191
402	3300035171	Ga0373946_0001367	Ga0373946_0001367_3290_3904	191
403	3300035692	Ga0373935_0084256	Ga0373935_0084256_1141_1755	191
404	3300035695	Ga0373927_0003274	Ga0373927_0003274_1829_2443	191
405	3300046455	Ga0495603_0033664	Ga0495603_0033664_2199_2813	191
406	3300046459	Ga0495629_0001186	Ga0495629_0001186_5568_6182	191
407	3300046461	Ga0495641_0010189	Ga0495641_0010189_2368_2982	191
408	3300046463	Ga0495653_0088870	Ga0495653_0088870_84_698	191
409	3300046472	Ga0495580_0067881	Ga0495580_0067881_74_688	191
410	3300046473	Ga0495582_0002607	Ga0495582_0002607_660_1274	191
411	3300046475	Ga0495639_0002310	Ga0495639_0002310_7086_7700	191
412	3300046476	Ga0495662_0022950	Ga0495662_0022950_443_1057	191
413	3300046514	Ga0495618_0178521	Ga0495618_0178521_29_643	191
414	3300046517	Ga0495630_0006500	Ga0495630_0006500_7049_7663	191
415	3300046526	Ga0495666_0000435	Ga0495666_0000435_11006_11620	191
416	3300046531	Ga0495665_0001041	Ga0495665_0001041_2431_3045	191
417	3300046533	Ga0495640_0005016	Ga0495640_0005016_5029_5643	191
418	3300046535	Ga0495586_0014381	Ga0495586_0014381_215_829	191
419	3300046535	Ga0495586_0059507	Ga0495586_0059507_911_1555	191
420	3300046559	Ga0495667_0014531	Ga0495667_0014531_2245_2859	191
421	3300046663	Ga0495635_0001657	Ga0495635_0001657_9011_9625	191
422	3300046674	Ga0495588_0010493	Ga0495588_0010493_139_753	191
423	3300046681	Ga0495647_0001417	Ga0495647_0001417_5482_6096	191
424	3300046683	Ga0495658_0001013	Ga0495658_0001013_5213_5827	191
425	3300046683	Ga0495658_0571197	Ga0495658_0571197_65_679	191
426	3300046689	Ga0495613_0005153	Ga0495613_0005153_5354_5968	191
427	3300046689	Ga0495613_0034168	Ga0495613_0034168_2224_2868	191
428	3300046690	Ga0495624_0046616	Ga0495624_0046616_143_757	191
429	3300047315	Ga0495581_0012590	Ga0495581_0012590_3972_4586	191
430	3300047319	Ga0495674_0002693	Ga0495674_0002693_4604_5218	191
431	3300047322	Ga0495680_0000050	Ga0495680_0000050_37038_37682	191
432	3300047673	Ga0495593_0083695	Ga0495593_0083695_627_1241	191
433	3300048089	Ga0495614_0002902	Ga0495614_0002902_2210_2824	191
434	3300048903	Ga0496100_0356605	Ga0496100_0356605_238_852	191
435	3300048904	Ga0496101_0040300	Ga0496101_0040300_882_1496	191
436	3300048904	Ga0496101_0146939	Ga0496101_0146939_582_1196	191
437	3300048905	Ga0496102_0082381	Ga0496102_0082381_1399_2013	191
438	3300048905	Ga0496102_0097371	Ga0496102_0097371_1037_1651	191
439	3300048909	Ga0496106_0012648	Ga0496106_0012648_2712_3326	191
440	3300048910	Ga0496107_0047753	Ga0496107_0047753_1139_1753	191
441	3300048911	Ga0496108_0022471	Ga0496108_0022471_2439_3053	191
442	3300048912	Ga0496109_0079322	Ga0496109_0079322_1404_2018	191
443	3300048913	Ga0496110_0049752	Ga0496110_0049752_2335_2949	191
444	3300048914	Ga0496111_0004245	Ga0496111_0004245_5438_6052	191
445	3300048915	Ga0496112_0083196	Ga0496112_0083196_2247_2861	191
446	3300048916	Ga0496113_0247806	Ga0496113_0247806_455_1069	191
447	3300048917	Ga0496114_0068844	Ga0496114_0068844_1328_1942	191
448	3300048917	Ga0496114_0736062	Ga0496114_0736062_73_687	191
449	3300048918	Ga0496115_0786199	Ga0496115_0786199_26_640	191
450	3300049583	Ga0501067_0100626	Ga0501067_0100626_505_1119	191
451	3300053085	Ga0495619_0001105	Ga0495619_0001105_11837_12451	191
452	3300005467	Ga0070706_100142598	Ga0070706_1001425983	192
453	3300005471	Ga0070698_100061392	Ga0070698_1000613925	192
454	3300025910	Ga0207684_10033061	Ga0207684_100330616	192
455	3300046642	Ga0495634_0000212	Ga0495634_0000212_9803_10450	192
456	3300005289	Ga0065704_10100335	Ga0065704_101003352	193
457	3300005295	Ga0065707_10081998	Ga0065707_1008199813	193
458	3300005356	Ga0070674_100110750	Ga0070674_1001107502	193
459	3300005549	Ga0070704_100103828	Ga0070704_1001038282	193
460	3300006058	Ga0075432_10048683	Ga0075432_100486832	193
461	3300006847	Ga0075431_100315733	Ga0075431_1003157331	193
462	3300027907	Ga0207428_10213922	Ga0207428_102139221	193
463	3300046472	Ga0495580_0094020	Ga0495580_0094020_56_718	193
464	3300046475	Ga0495639_0183227	Ga0495639_0183227_200_862	193
465	3300048921	Ga0496118_0069576	Ga0496118_0069576_804_1466	193
466	3300048924	Ga0496121_0062609	Ga0496121_0062609_1609_2310	193
467	3300003203	JGI25406J46586_10167258	JGI25406J46586_101672581	196
468	3300005985	Ga0081539_10014382	Ga0081539_100143823	196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

24

230

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3kgy-assembly1.cif.gz_B	crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution	0.9503	1	192
3kgy-assembly1.cif.gz_B	crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution	0.9268	1	192
7xh2-assembly1.cif.gz_A	dihydrofolate reductase-like protein sach in safracin biosynthesis	0.8471	1	191
7xh2-assembly1.cif.gz_A	dihydrofolate reductase-like protein sach in safracin biosynthesis	0.8426	1	191
3jtw-assembly1.cif.gz_A-2	crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution	0.8056	1	190

ID	Description	Score	Start	End	Superfamily
3kgyB00	Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A	0.8292	2	192	3.40.430.10
3kgyB00	Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A	0.8046	2	192	3.40.430.10
af_Q19962_62_333_1.10.510.10	Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1	0.7937	173	190	1.10.510.10
af_A4I347_14_125_3.30.200.20	Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1	0.7894	173	190	3.30.200.20
af_Q86C56_1_188_3.90.1520.10	Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain	0.7873	171	194	3.90.1520.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2E0KX71-F1-model_v4	Deaminase	0.9933	1	193	GO:0008703 GO:0009231
AF-A0A2E0KX71-F1-model_v4	Deaminase	0.9882	1	193	GO:0008703 GO:0009231
AF-Q0RY85-F1-model_v4	Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein	0.9828	46	193	GO:0008703 GO:0009231
AF-A0A6J4QSE7-F1-model_v4	Dihydrofolate reductase homolog	0.9826	63	193	GO:0008703 GO:0009231
AF-A0A1G0QRM1-F1-model_v4	Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein	0.9768	106	193	GO:0008703 GO:0009231

Feature Viewer

pLDDT	pTM	Quality
89.87	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F449995

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01872

RibD_C

RibD C-terminal domain

24

230

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map