F449913

General Info

Members Datasets Scaffolds Average Seq Length
467 255 432 435

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000433|Ga0496125_0000433_47130_48647
Length 486
Sequence VQVASRSQGWFPWQAAQRSNTPKQDIPEGFALKGQTHLVDLGEMSSKYNRAHADPSVLTEGAGDMTKLSRREFLIPTAPGGIDYPIEKGATLRVLRWKRFVQGDEDLWNENVKKFTELTGVPVRTDSEGFEDVRPKAAVAANVGSGPDIVLGWFDDPHQYPTKLLDVSDLANSLGSRYGGWYDVFQKYGKSNGKWIAIPLGVIGICLVYRDSHLKAAGFEAVPKDLPGFLKMAQALKAKNTPIGFAHGKAVGDANNYAHWLLWAHGGKLVDEHGSVVINSAETRAALEYGKQLYQTMVQGTLSWQDPSNNKAYLDGQVSLTNNGISIYYAAKNSTDPKLLELAKDTQHTHYPIGVSGKPTELMQLTQMMAFKHTKYPNAAKAFLQFMMEPDQFNPWMKAAIGYVSQPLKAYEKNPVWTADPKATPYRDAASLMLDHGHAGPLGQASAACLADYVLVDMVAEAASGSKTVQQAIDRAAERAKRFYKT

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
7 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
8 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
9 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
10 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
11 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
12 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
13 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
14 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
15 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
16 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
17 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
18 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
19 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
20 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
21 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
22 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
23 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
24 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
25 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
26 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
27 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
28 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
29 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
30 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
31 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
37 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
38 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
39 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
203 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.86
Metatranscriptomes 0.64
Isolates 7.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.42
Nodule 1.28
Rhizoplane 3.21
Rhizosphere 75.37
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000076 3300002704 Bacteria 59158
2 JGI25156J39149_1000032 3300002705 Bacteria 118609
3 JGI25156J39149_1000675 3300002705 Bacteria 18418
4 JGI25156J39149_1007399 3300002705 Bacteria 2889
5 JGI25162J39368_1001832 3300002737 Bacteria 9928
6 JGI25154J39366_1000095 3300002738 Bacteria 79187
7 JGI25157J39369_1000212 3300002741 Bacteria 48259
8 JGI25157J39369_1001106 3300002741 Bacteria 12030
9 JGI25151J46595_10001193 3300003187 Bacteria 18647
10 JGI25151J46595_10009780 3300003187 Bacteria 4515
11 Ga0055538_1000054 3300003751 Bacteria 123566
12 Ga0055539_1000066 3300003752 Bacteria 136557
13 Ga0055533_1000076 3300003756 Bacteria 136557
14 Ga0055532_1000083 3300003758 Bacteria 118609
15 Ga0055532_1000157 3300003758 Bacteria 59670
16 Ga0055525_1000098 3300003759 Bacteria 136557
17 Ga0055535_1001985 3300003761 Bacteria 8446
18 Ga0055526_1000723 3300003771 Bacteria 24955
19 Ga0055526_1006049 3300003771 Bacteria 6703
20 Ga0055524_1001068 3300003775 Bacteria 16849
21 Ga0055536_1000219 3300003781 Bacteria 46718
22 Ga0055534_1001363 3300003784 Bacteria 9779
23 Ga0055540_1009900 3300003792 Bacteria 3228
24 Ga0055531_10000192 3300003794 Bacteria 67874
25 Ga0055541_1000056 3300003841 Bacteria 123566
26 Ga0070658_10012521 3300005327 Bacteria 6805
27 Ga0070690_100005910 3300005330 Bacteria 6903
28 Ga0070677_10033357 3300005333 Bacteria 1982
29 Ga0068869_100001111 3300005334 Bacteria 15680
30 Ga0068869_100023373 3300005334 Bacteria 4268
31 Ga0068869_100102908 3300005334 Bacteria 2163
32 Ga0070666_10139530 3300005335 Unclassified 1688
33 Ga0070680_100084832 3300005336 Bacteria 2616
34 Ga0070682_100112170 3300005337 Bacteria 1819
35 Ga0068868_100008536 3300005338 Bacteria 7336
36 Ga0068868_100017828 3300005338 Bacteria 5296
37 Ga0068868_100068076 3300005338 Archaea 2834
38 Ga0068868_100203660 3300005338 Bacteria 1651
39 Ga0068868_100268693 3300005338 Bacteria 1440
40 Ga0070689_100009272 3300005340 Bacteria 6973
41 Ga0070689_100010513 3300005340 Bacteria 6597
42 Ga0070691_10009266 3300005341 Bacteria 4499
43 Ga0070661_100060602 3300005344 Bacteria 2777
44 Ga0070692_10001690 3300005345 Bacteria 8182
45 Ga0070692_10009480 3300005345 Bacteria 4393
46 Ga0070692_10035362 3300005345 Bacteria 2529
47 Ga0070692_10048469 3300005345 Bacteria 2201
48 Ga0070668_100012754 3300005347 Bacteria 6255
49 Ga0070675_100010314 3300005354 Bacteria 7293
50 Ga0070673_100126913 3300005364 Bacteria 2136
51 Ga0070688_100054905 3300005365 Bacteria 2497
52 Ga0070659_100071131 3300005366 Bacteria 2765
53 Ga0070659_100073701 3300005366 Bacteria 2718
54 Ga0070659_100195696 3300005366 Bacteria 1663
55 Ga0070714_100005537 3300005435 Bacteria 9645
56 Ga0070701_10000947 3300005438 Bacteria 10503
57 Ga0070701_10008850 3300005438 Bacteria 4377
58 Ga0070700_100001391 3300005441 Bacteria 12017
59 Ga0070700_100008103 3300005441 Bacteria 5712
60 Ga0070700_100165086 3300005441 Bacteria 1528
61 Ga0070694_100051267 3300005444 Bacteria 2785
62 Ga0070708_100000292 3300005445 Bacteria 37727
63 Ga0070708_100008387 3300005445 Bacteria 8297
64 Ga0070708_100077567 3300005445 Bacteria 3002
65 Ga0070708_100100984 3300005445 Bacteria 2641
66 Ga0070678_100067388 3300005456 Bacteria 2664
67 Ga0070662_100016681 3300005457 Bacteria 4935
68 Ga0070662_100156478 3300005457 Bacteria 1779
69 Ga0070681_10152829 3300005458 Bacteria 2234
70 Ga0068867_100012345 3300005459 Bacteria 6043
71 Ga0068867_100040202 3300005459 Bacteria 3411
72 Ga0068867_100090365 3300005459 Bacteria 2323
73 Ga0070706_100109810 3300005467 Bacteria 2566
74 Ga0070698_100019505 3300005471 Bacteria 7117
75 Ga0070679_100053529 3300005530 Bacteria 4017
76 Ga0070697_100014081 3300005536 Bacteria 6280
77 Ga0070697_100017621 3300005536 Bacteria 5624
78 Ga0070697_100069468 3300005536 Bacteria 2885
79 Ga0068853_100011708 3300005539 Bacteria 7128
80 Ga0068853_100028825 3300005539 Bacteria 4672
81 Ga0068853_100095778 3300005539 Bacteria 2618
82 Ga0070686_100001046 3300005544 Bacteria 15928
83 Ga0070686_100053038 3300005544 Bacteria 2587
84 Ga0070695_100005269 3300005545 Bacteria 7612
85 Ga0070696_100030025 3300005546 Bacteria 3719
86 Ga0070696_100033569 3300005546 Bacteria 3527
87 Ga0070696_100033628 3300005546 Bacteria 3524
88 Ga0070696_100109836 3300005546 Bacteria 1985
89 Ga0070693_100086052 3300005547 Bacteria 1885
90 Ga0070665_100079791 3300005548 Bacteria 3278
91 Ga0070665_100115209 3300005548 Bacteria 2690
92 Ga0070704_100020448 3300005549 Bacteria 4268
93 Ga0070704_100055899 3300005549 Bacteria 2800
94 Ga0068855_100000791 3300005563 Bacteria 39102
95 Ga0068855_100019387 3300005563 Bacteria 8172
96 Ga0068855_100071556 3300005563 Bacteria 4033
97 Ga0068855_100106657 3300005563 Bacteria 3219
98 Ga0068855_100148510 3300005563 Bacteria 2667
99 Ga0068855_100323173 3300005563 Bacteria 1705
100 Ga0070664_100268210 3300005564 Bacteria 1537
101 Ga0068857_100013406 3300005577 Bacteria 7140
102 Ga0068857_100042988 3300005577 Bacteria 4009
103 Ga0068857_100081110 3300005577 Bacteria 2897
104 Ga0068857_100174261 3300005577 Bacteria 1956
105 Ga0068854_100127384 3300005578 Bacteria 1940
106 Ga0068856_100056797 3300005614 Bacteria 3863
107 Ga0068856_100107697 3300005614 Bacteria 2783
108 Ga0068856_100203022 3300005614 Bacteria 1997
109 Ga0068856_100215841 3300005614 Bacteria 1934
110 Ga0068856_100277948 3300005614 Bacteria 1691
111 Ga0070702_100000641 3300005615 Bacteria 12981
112 Ga0068852_100006348 3300005616 Bacteria 8534
113 Ga0068852_100006577 3300005616 Bacteria 8414
114 Ga0068852_100055000 3300005616 Bacteria 3433
115 Ga0068852_100120302 3300005616 Bacteria 2402
116 Ga0068859_100027104 3300005617 Bacteria 5748
117 Ga0068859_100073598 3300005617 Bacteria 3455
118 Ga0068864_100097304 3300005618 Bacteria 2605
119 Ga0068866_10001033 3300005718 Bacteria 12241
120 Ga0068866_10003238 3300005718 Bacteria 6706
121 Ga0068866_10047052 3300005718 Bacteria 2173
122 Ga0068861_100001865 3300005719 Bacteria 13569
123 Ga0068861_100003892 3300005719 Bacteria 9982
124 Ga0068861_100010032 3300005719 Bacteria 6565
125 Ga0068870_10010548 3300005840 Bacteria 4251
126 Ga0068858_100000679 3300005842 Bacteria 35449
127 Ga0068858_100015042 3300005842 Bacteria 7278
128 Ga0068858_100041121 3300005842 Bacteria 4287
129 Ga0068860_100009556 3300005843 Bacteria 9633
130 Ga0068860_100021211 3300005843 Bacteria 6293
131 Ga0068862_100015052 3300005844 Bacteria 6424
132 Ga0068862_100030154 3300005844 Bacteria 4570
133 Ga0068862_100143188 3300005844 Bacteria 2123
134 Ga0081455_10057144 3300005937 Bacteria 3308
135 Ga0097621_100017693 3300006237 Bacteria 5421
136 Ga0097621_100073984 3300006237 Bacteria 2821
137 Ga0097621_100158581 3300006237 Bacteria 1944
138 Ga0097621_100219621 3300006237 Bacteria 1656
139 Ga0068871_100006781 3300006358 Bacteria 8138
140 Ga0068871_100012320 3300006358 Bacteria 6299
141 Ga0068871_100048348 3300006358 Bacteria 3434
142 Ga0075434_100102147 3300006871 Bacteria 2875
143 Ga0075429_100000320 3300006880 Bacteria 34451
144 Ga0068865_100022697 3300006881 Bacteria 4098
145 Ga0068865_100033142 3300006881 Bacteria 3456
146 Ga0097620_100027104 3300006931 Bacteria 5748
147 Ga0097620_100073598 3300006931 Bacteria 3455
148 Ga0079104_1004787 3300006946 Bacteria 5640
149 Ga0075435_100001710 3300007076 Bacteria 14255
150 Ga0075435_100080165 3300007076 Bacteria 2680
151 Ga0105240_10002015 3300009093 Bacteria 33500
152 Ga0105240_10005343 3300009093 Bacteria 19158
153 Ga0105240_10008689 3300009093 Bacteria 14492
154 Ga0105240_10015015 3300009093 Bacteria 10546
155 Ga0105240_10044364 3300009093 Bacteria 5650
156 Ga0105245_10004092 3300009098 Bacteria 12945
157 Ga0105245_10008233 3300009098 Bacteria 9112
158 Ga0105245_10088819 3300009098 Bacteria 2840
159 Ga0105245_10281290 3300009098 Bacteria 1626
160 Ga0105247_10069131 3300009101 Bacteria 2203
161 Ga0114129_10039254 3300009147 Bacteria 6675
162 Ga0105243_10015745 3300009148 Bacteria 5719
163 Ga0105241_10004458 3300009174 Bacteria 10357
164 Ga0105241_10007759 3300009174 Bacteria 7890
165 Ga0105241_10039667 3300009174 Bacteria 3552
166 Ga0105241_10105698 3300009174 Bacteria 2246
167 Ga0105242_10008454 3300009176 Bacteria 7909
168 Ga0105242_10087057 3300009176 Bacteria 2622
169 Ga0105242_10123747 3300009176 Bacteria 2223
170 Ga0105248_10045951 3300009177 Bacteria 4895
171 Ga0105237_10016720 3300009545 Bacteria 7617
172 Ga0105237_10031873 3300009545 Bacteria 5338
173 Ga0105237_10036514 3300009545 Bacteria 4973
174 Ga0105237_10111587 3300009545 Bacteria 2726
175 Ga0105238_10000632 3300009551 Bacteria 37034
176 Ga0105238_10007883 3300009551 Bacteria 10653
177 Ga0105238_10022892 3300009551 Bacteria 6369
178 Ga0105238_10052495 3300009551 Bacteria 4098
179 Ga0105238_10086380 3300009551 Bacteria 3124
180 Ga0105238_10131300 3300009551 Bacteria 2483
181 Ga0105238_10149651 3300009551 Bacteria 2310
182 Ga0105238_10340856 3300009551 Bacteria 1487
183 Ga0105249_10013998 3300009553 Bacteria 7090
184 Ga0105249_10017247 3300009553 Bacteria 6408
185 Ga0105239_10018198 3300010375 Bacteria 7768
186 Ga0105239_10043254 3300010375 Bacteria 4936
187 Ga0105239_10075103 3300010375 Bacteria 3716
188 Ga0105239_10090918 3300010375 Bacteria 3368
189 Ga0105239_10112133 3300010375 Bacteria 3024
190 Ga0105239_10141658 3300010375 Bacteria 2680
191 Ga0105246_10210468 3300011119 Bacteria 1517
192 Ga0157371_10156577 3300013102 Bacteria 1626
193 Ga0157370_10032636 3300013104 Bacteria 5083
194 Ga0157369_10127566 3300013105 Bacteria 2696
195 Ga0157374_10040727 3300013296 Bacteria 4280
196 Ga0157374_10122936 3300013296 Bacteria 2507
197 Ga0157374_10192274 3300013296 Unclassified 1996
198 Ga0157378_10003424 3300013297 Bacteria 14077
199 Ga0157378_10041912 3300013297 Bacteria 4062
200 Ga0157378_10164311 3300013297 Unclassified 2078
201 Ga0163162_10062755 3300013306 Bacteria 3756
202 Ga0157375_10055609 3300013308 Bacteria 3903
203 Ga0157375_10108897 3300013308 Bacteria 2866
204 Ga0157380_10003649 3300014326 Bacteria 10586
205 Ga0157380_10012821 3300014326 Bacteria 6092
206 Ga0157379_10038095 3300014968 Bacteria 4290
207 Ga0157379_10208631 3300014968 Unclassified 1768
208 Ga0157379_10210761 3300014968 Bacteria 1759
209 Ga0157379_10212815 3300014968 Bacteria 1750
210 Ga0157376_10210496 3300014969 Bacteria 1795
211 Ga0182006_1015758 3300015261 Bacteria 3235
212 Ga0209435_100013 3300025206 Bacteria 366789
213 Ga0209435_100085 3300025206 Bacteria 45218
214 Ga0209435_100486 3300025206 Bacteria 7854
215 Ga0209784_100002 3300025224 Bacteria 1753105
216 Ga0209566_100003 3300025225 Bacteria 1753105
217 Ga0209674_100004 3300025226 Bacteria 1753105
218 Ga0209147_100030 3300025229 Bacteria 366789
219 Ga0209147_100217 3300025229 Bacteria 59789
220 Ga0209563_100006 3300025230 Bacteria 1753105
221 Ga0209437_100419 3300025233 Bacteria 38515
222 Ga0209437_100432 3300025233 Bacteria 36626
223 Ga0209258_100390 3300025242 Bacteria 55905
224 Ga0209258_100433 3300025242 Bacteria 48200
225 Ga0209646_1000034 3300025246 Bacteria 366789
226 Ga0209646_1000204 3300025246 Bacteria 69552
227 Ga0209646_1000227 3300025246 Bacteria 59789
228 Ga0209026_1000022 3300025250 Bacteria 366789
229 Ga0209026_1000340 3300025250 Bacteria 45211
230 Ga0209026_1004699 3300025250 Bacteria 3946
231 Ga0209677_100003 3300025253 Bacteria 1753105
232 Ga0209759_1000018 3300025256 Bacteria 366789
233 Ga0209759_1000298 3300025256 Bacteria 68472
234 Ga0209759_1000561 3300025256 Bacteria 37637
235 Ga0209565_1000021 3300025263 Bacteria 406281
236 Ga0209673_1009563 3300025273 Bacteria 4178
237 Ga0209675_1000040 3300025291 Bacteria 247535
238 Ga0209676_1000014 3300025292 Bacteria 793514
239 Ga0209025_1000092 3300025294 Bacteria 247020
240 Ga0209025_1048278 3300025294 Bacteria 1727
241 Ga0209564_1000159 3300025295 Bacteria 164319
242 Ga0209564_1000218 3300025295 Bacteria 130563
243 Ga0209564_1000452 3300025295 Bacteria 69505
244 Ga0209758_1010313 3300025297 Bacteria 5612
245 Ga0209256_1003336 3300025299 Bacteria 11391
246 Ga0209051_1000281 3300025303 Bacteria 83196
247 Ga0209257_1000039 3300025304 Bacteria 591694
248 Ga0207697_10055030 3300025315 Bacteria 1649
249 Ga0207642_10000792 3300025899 Bacteria 9809
250 Ga0207642_10002165 3300025899 Bacteria 6093
251 Ga0207642_10104498 3300025899 Unclassified 1429
252 Ga0207680_10034211 3300025903 Bacteria 2906
253 Ga0207643_10009245 3300025908 Bacteria 5293
254 Ga0207654_10012729 3300025911 Bacteria 4317
255 Ga0207654_10058805 3300025911 Bacteria 2239
256 Ga0207654_10063423 3300025911 Bacteria 2169
257 Ga0207707_10054717 3300025912 Bacteria 3473
258 Ga0207707_10102678 3300025912 Bacteria 2499
259 Ga0207707_10201963 3300025912 Bacteria 1733
260 Ga0207695_10001105 3300025913 Bacteria 46872
261 Ga0207695_10001995 3300025913 Bacteria 31509
262 Ga0207695_10004190 3300025913 Bacteria 19814
263 Ga0207695_10006194 3300025913 Bacteria 15592
264 Ga0207695_10012196 3300025913 Bacteria 10324
265 Ga0207671_10016590 3300025914 Bacteria 5718
266 Ga0207671_10033225 3300025914 Bacteria 3838
267 Ga0207671_10049119 3300025914 Bacteria 3123
268 Ga0207671_10065756 3300025914 Bacteria 2697
269 Ga0207660_10112139 3300025917 Bacteria 2054
270 Ga0207649_10055756 3300025920 Bacteria 2465
271 Ga0207646_10104733 3300025922 Bacteria 2537
272 Ga0207681_10028175 3300025923 Bacteria 3637
273 Ga0207694_10000171 3300025924 Bacteria 66876
274 Ga0207694_10041449 3300025924 Bacteria 3548
275 Ga0207694_10060031 3300025924 Bacteria 2959
276 Ga0207659_10068274 3300025926 Bacteria 2585
277 Ga0207687_10003861 3300025927 Bacteria 10059
278 Ga0207687_10037391 3300025927 Bacteria 3312
279 Ga0207664_10004401 3300025929 Bacteria 9540
280 Ga0207690_10007532 3300025932 Bacteria 6460
281 Ga0207690_10107217 3300025932 Bacteria 2006
282 Ga0207686_10001479 3300025934 Bacteria 13268
283 Ga0207686_10003638 3300025934 Bacteria 8258
284 Ga0207686_10133108 3300025934 Bacteria 1708
285 Ga0207670_10003899 3300025936 Bacteria 7960
286 Ga0207669_10019594 3300025937 Bacteria 3527
287 Ga0207704_10001625 3300025938 Bacteria 10096
288 Ga0207711_10003165 3300025941 Bacteria 14351
289 Ga0207689_10000392 3300025942 Bacteria 41178
290 Ga0207689_10000550 3300025942 Bacteria 35746
291 Ga0207689_10001736 3300025942 Bacteria 20587
292 Ga0207689_10017767 3300025942 Bacteria 6009
293 Ga0207661_10259608 3300025944 Bacteria 1547
294 Ga0207667_10000191 3300025949 Bacteria 89641
295 Ga0207667_10002722 3300025949 Bacteria 21860
296 Ga0207667_10003921 3300025949 Bacteria 18305
297 Ga0207667_10020526 3300025949 Bacteria 7343
298 Ga0207667_10048606 3300025949 Bacteria 4485
299 Ga0207667_10065049 3300025949 Bacteria 3805
300 Ga0207667_10078817 3300025949 Bacteria 3414
301 Ga0207667_10096505 3300025949 Bacteria 3051
302 Ga0207712_10047240 3300025961 Bacteria 2988
303 Ga0207640_10072670 3300025981 Bacteria 2321
304 Ga0207640_10127063 3300025981 Bacteria 1837
305 Ga0207677_10004108 3300026023 Bacteria 7787
306 Ga0207677_10033386 3300026023 Bacteria 3320
307 Ga0207703_10008734 3300026035 Bacteria 7997
308 Ga0207703_10028026 3300026035 Bacteria 4436
309 Ga0207703_10030512 3300026035 Bacteria 4261
310 Ga0207703_10056327 3300026035 Bacteria 3202
311 Ga0207639_10005658 3300026041 Bacteria 8457
312 Ga0207639_10008661 3300026041 Bacteria 6983
313 Ga0207639_10016794 3300026041 Bacteria 5186
314 Ga0207639_10018667 3300026041 Bacteria 4932
315 Ga0207678_10014250 3300026067 Bacteria 6989
316 Ga0207708_10002193 3300026075 Bacteria 14415
317 Ga0207708_10005789 3300026075 Bacteria 9137
318 Ga0207708_10015508 3300026075 Bacteria 5715
319 Ga0207708_10120356 3300026075 Bacteria 2045
320 Ga0207708_10251138 3300026075 Bacteria 1425
321 Ga0207702_10083259 3300026078 Bacteria 2783
322 Ga0207702_10092922 3300026078 Bacteria 2645
323 Ga0207702_10167390 3300026078 Bacteria 2012
324 Ga0207702_10241514 3300026078 Bacteria 1692
325 Ga0207648_10006481 3300026089 Bacteria 11625
326 Ga0207648_10007807 3300026089 Bacteria 10448
327 Ga0207648_10092855 3300026089 Bacteria 2639
328 Ga0207648_10103380 3300026089 Bacteria 2498
329 Ga0207676_10045564 3300026095 Bacteria 3389
330 Ga0207674_10032457 3300026116 Bacteria 5477
331 Ga0207674_10048785 3300026116 Bacteria 4332
332 Ga0207674_10154049 3300026116 Bacteria 2254
333 Ga0207675_100000576 3300026118 Bacteria 35873
334 Ga0207675_100002917 3300026118 Bacteria 16822
335 Ga0207675_100004949 3300026118 Bacteria 12840
336 Ga0207683_10027137 3300026121 Bacteria 4949
337 Ga0207698_10044122 3300026142 Bacteria 3347
338 Ga0207698_10060608 3300026142 Bacteria 2943
339 Ga0268265_10080624 3300028380 Bacteria 2567
340 Ga0268264_10028804 3300028381 Bacteria 4546
341 Ga0268264_10107207 3300028381 Bacteria 2440
342 Ga0265318_10015153 3300028577 Bacteria 3214
343 Ga0307515_10147648 3300028794 Bacteria 2480
344 Ga0265338_10163289 3300028800 Bacteria 1718
345 Ga0265330_10002659 3300031235 Bacteria 9677
346 Ga0265332_10000694 3300031238 Bacteria 21499
347 Ga0265332_10003742 3300031238 Bacteria 7280
348 Ga0265328_10006406 3300031239 Bacteria 4987
349 Ga0265320_10008016 3300031240 Bacteria 6504
350 Ga0265325_10011026 3300031241 Bacteria 5203
351 Ga0265329_10002182 3300031242 Bacteria 9041
352 Ga0265329_10012724 3300031242 Bacteria 3016
353 Ga0265331_10001220 3300031250 Bacteria 19327
354 Ga0265331_10026551 3300031250 Bacteria 2909
355 Ga0265327_10010221 3300031251 Bacteria 6629
356 Ga0265327_10042720 3300031251 Bacteria 2431
357 Ga0265316_10011543 3300031344 Bacteria 7955
358 Ga0265316_10053784 3300031344 Bacteria 3154
359 Ga0307513_10023595 3300031456 Bacteria 7183
360 Ga0265314_10001520 3300031711 Bacteria 25622
361 Ga0265314_10008184 3300031711 Bacteria 8991
362 Ga0307414_10007333 3300032004 Bacteria 6197
363 Ga0316588_1019709 3300033528 Bacteria 1522
364 Ga0316587_1004378 3300033529 Unclassified 2053
365 Ga0316596_1023929 3300033541 Bacteria 1567
366 Ga0373931_0002282 3300035691 Bacteria 8477
367 Ga0373927_0015575 3300035695 Bacteria 5023
368 Ga0373937_0189535 3300036401 Bacteria 1932
369 Ga0373937_0245368 3300036401 Bacteria 1688
370 Ga0373937_0307643 3300036401 Bacteria 1499
371 Ga0395900_0032253 3300037418 Bacteria 5386
372 Ga0395905_0210222 3300037471 Bacteria 1823
373 Ga0436364_0294446 3300037853 Bacteria 2205
374 Ga0436361_0532183 3300039447 Bacteria 5597
375 Ga0436361_0601494 3300039447 Bacteria 2783
376 Ga0436361_1085109 3300039447 Bacteria 7859
377 Ga0451577_0048792 3300042876 Bacteria 3781
378 Ga0451577_0054387 3300042876 Bacteria 3573
379 Ga0451577_0137460 3300042876 Bacteria 2194
380 Ga0451577_0207969 3300042876 Bacteria 1767
381 Ga0453684_0001209 3300044712 Bacteria 79474
382 Ga0453684_0005063 3300044712 Bacteria 26699
383 Ga0453684_0018355 3300044712 Bacteria 10741
384 Ga0453684_0021041 3300044712 Bacteria 9780
385 Ga0453684_0101689 3300044712 Bacteria 3516
386 Ga0453684_0111567 3300044712 Bacteria 3321
387 Ga0495580_0051560 3300046472 Bacteria 2909
388 Ga0495661_0054250 3300046665 Bacteria 2407
389 Ga0496101_0051300 3300048904 Bacteria 2972
390 Ga0496102_0134442 3300048905 Bacteria 2317
391 Ga0496102_0204335 3300048905 Bacteria 1862
392 Ga0496104_0114732 3300048907 Bacteria 2584
393 Ga0496105_0151706 3300048908 Bacteria 1904
394 Ga0496106_0007766 3300048909 Bacteria 7936
395 Ga0496106_0237888 3300048909 Bacteria 1455
396 Ga0496107_0029226 3300048910 Bacteria 3920
397 Ga0496109_0085898 3300048912 Bacteria 2905
398 Ga0496110_0088272 3300048913 Bacteria 2769
399 Ga0496110_0099036 3300048913 Bacteria 2614
400 Ga0496110_0116386 3300048913 Bacteria 2406
401 Ga0496110_0193865 3300048913 Bacteria 1845
402 Ga0496111_0034868 3300048914 Bacteria 3594
403 Ga0496115_0056798 3300048918 Bacteria 3146
404 Ga0496116_0014781 3300048919 Bacteria 6209
405 Ga0496116_0021941 3300048919 Bacteria 4801
406 Ga0496118_0093284 3300048921 Bacteria 2063
407 Ga0496121_0003466 3300048924 Bacteria 22480
408 Ga0496121_0050538 3300048924 Bacteria 3511
409 Ga0496122_0000134 3300048925 Bacteria 171080
410 Ga0496122_0000693 3300048925 Bacteria 67068
411 Ga0496123_0000307 3300048926 Bacteria 95174
412 Ga0496123_0000433 3300048926 Bacteria 75427
413 Ga0496125_0000433 3300048928 Bacteria 76686
414 Ga0501037_0183990 3300049573 Bacteria 1482
415 Ga0501047_0026236 3300049581 Bacteria 5605
416 Ga0501069_0015512 3300049585 Bacteria 4085
417 Ga0501069_0063213 3300049585 Bacteria 2067
418 Ga0501070_0004818 3300049586 Bacteria 11531
419 Ga0501071_0086812 3300049587 Bacteria 2295
420 Ga0501073_0082558 3300049589 Bacteria 2236
421 Ga0501080_0053387 3300049742 Bacteria 3762
422 Ga0501083_0006285 3300049744 Bacteria 8428
423 Ga0501083_0053572 3300049744 Bacteria 2708
424 Ga0501035_0038184 3300049822 Bacteria 4348
425 Ga0501044_0046382 3300049823 Bacteria 4499
426 Ga0501044_0162795 3300049823 Bacteria 2206
427 Ga0501044_0206626 3300049823 Bacteria 1920
428 nmdc:mga0k408_98177_c1 3300050493 Bacteria 1726
429 nmdc:mga0n895_124075_c1 3300050512 Bacteria 2605
430 nmdc:mga0rr50_152524_c1 3300050513 Bacteria 1868
431 nmdc:mga0rr50_46631_c1 3300050513 Bacteria 3191
432 Ga0500641_0047674 3300053096 Bacteria 1753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0307643 Ga0373937_0307643_37_1170 377
2 3300049573 Ga0501037_0183990 Ga0501037_0183990_282_1463 386
3 3300048913 Ga0496110_0088272 Ga0496110_0088272_18_1334 391
4 3300037853 Ga0436364_0294446 Ga0436364_0294446_36_1355 394
5 iso_pu_bacteria 2548876994 2550694037 398
6 3300025922 Ga0207646_10104733 Ga0207646_101047332 399
7 3300007076 Ga0075435_100001710 Ga0075435_1000017104 402
8 3300050512 nmdc:mga0n895_124075_c1 nmdc:mga0n895_124075_c1_141_1469 402
9 3300032004 Ga0307414_10007333 Ga0307414_100073332 404
10 3300009147 Ga0114129_10039254 Ga0114129_100392543 405
11 3300053096 Ga0500641_0047674 Ga0500641_0047674_157_1488 407
12 3300005548 Ga0070665_100079791 Ga0070665_1000797912 408
13 3300005563 Ga0068855_100323173 Ga0068855_1003231732 408
14 3300006237 Ga0097621_100219621 Ga0097621_1002196211 408
15 3300010375 Ga0105239_10112133 Ga0105239_101121332 408
16 3300042876 Ga0451577_0054387 Ga0451577_0054387_2207_3523 408
17 3300050493 nmdc:mga0k408_98177_c1 nmdc:mga0k408_98177_c1_77_1402 408
18 3300005539 Ga0068853_100028825 Ga0068853_1000288252 409
19 3300009174 Ga0105241_10004458 Ga0105241_100044582 409
20 3300009551 Ga0105238_10022892 Ga0105238_100228925 409
21 3300010375 Ga0105239_10090918 Ga0105239_100909182 409
22 3300025917 Ga0207660_10112139 Ga0207660_101121392 409
23 3300025924 Ga0207694_10060031 Ga0207694_100600312 409
24 3300005338 Ga0068868_100203660 Ga0068868_1002036602 410
25 3300005435 Ga0070714_100005537 Ga0070714_1000055372 410
26 3300005577 Ga0068857_100081110 Ga0068857_1000811102 410
27 3300005617 Ga0068859_100073598 Ga0068859_1000735983 410
28 3300006931 Ga0097620_100073598 Ga0097620_1000735983 410
29 3300025911 Ga0207654_10012729 Ga0207654_100127292 410
30 3300025929 Ga0207664_10004401 Ga0207664_100044012 410
31 3300026041 Ga0207639_10008661 Ga0207639_100086616 410
32 3300048905 Ga0496102_0134442 Ga0496102_0134442_846_2153 410
33 3300005344 Ga0070661_100060602 Ga0070661_1000606022 411
34 3300005563 Ga0068855_100000791 Ga0068855_1000007912 411
35 3300005614 Ga0068856_100215841 Ga0068856_1002158412 411
36 3300005616 Ga0068852_100120302 Ga0068852_1001203022 411
37 3300009174 Ga0105241_10039667 Ga0105241_100396672 411
38 3300009176 Ga0105242_10123747 Ga0105242_101237472 411
39 3300013105 Ga0157369_10127566 Ga0157369_101275662 411
40 3300025911 Ga0207654_10063423 Ga0207654_100634232 411
41 3300025912 Ga0207707_10201963 Ga0207707_102019632 411
42 3300025944 Ga0207661_10259608 Ga0207661_102596082 411
43 3300026078 Ga0207702_10092922 Ga0207702_100929222 411
44 3300036401 Ga0373937_0189535 Ga0373937_0189535_565_1878 411
45 3300048909 Ga0496106_0237888 Ga0496106_0237888_19_1266 411
46 3300025913 Ga0207695_10006194 Ga0207695_100061947 412
47 3300025949 Ga0207667_10000191 Ga0207667_100001912 412
48 3300025949 Ga0207667_10002722 Ga0207667_1000272221 412
49 3300005445 Ga0070708_100008387 Ga0070708_1000083876 413
50 3300005530 Ga0070679_100053529 Ga0070679_1000535292 414
51 3300025912 Ga0207707_10054717 Ga0207707_100547172 414
52 3300048908 Ga0496105_0151706 Ga0496105_0151706_572_1870 414
53 3300005337 Ga0070682_100112170 Ga0070682_1001121702 415
54 3300005458 Ga0070681_10152829 Ga0070681_101528293 416
55 3300005577 Ga0068857_100042988 Ga0068857_1000429884 416
56 3300014968 Ga0157379_10212815 Ga0157379_102128152 416
57 3300044712 Ga0453684_0005063 Ga0453684_0005063_8183_9505 416
58 3300049581 Ga0501047_0026236 Ga0501047_0026236_180_1499 416
59 3300049589 Ga0501073_0082558 Ga0501073_0082558_499_1818 416
60 3300049742 Ga0501080_0053387 Ga0501080_0053387_94_1413 416
61 3300049823 Ga0501044_0162795 Ga0501044_0162795_159_1478 416
62 3300026116 Ga0207674_10048785 Ga0207674_100487852 417
63 3300046665 Ga0495661_0054250 Ga0495661_0054250_947_2260 417
64 3300049744 Ga0501083_0006285 Ga0501083_0006285_1791_3116 417
65 3300025294 Ga0209025_1048278 Ga0209025_10482782 418
66 3300002705 JGI25156J39149_1000675 JGI25156J39149_100067517 419
67 3300002705 JGI25156J39149_1007399 JGI25156J39149_10073992 419
68 3300002737 JGI25162J39368_1001832 JGI25162J39368_10018329 419
69 3300002741 JGI25157J39369_1001106 JGI25157J39369_10011069 419
70 3300003758 Ga0055532_1000157 Ga0055532_100015734 419
71 3300005563 Ga0068855_100106657 Ga0068855_1001066572 419
72 3300005616 Ga0068852_100006348 Ga0068852_1000063488 419
73 3300009093 Ga0105240_10002015 Ga0105240_100020159 419
74 3300009093 Ga0105240_10015015 Ga0105240_100150159 419
75 3300009551 Ga0105238_10007883 Ga0105238_100078834 419
76 3300015261 Ga0182006_1015758 Ga0182006_10157581 419
77 3300025206 Ga0209435_100085 Ga0209435_10008520 419
78 3300025206 Ga0209435_100486 Ga0209435_1004868 419
79 3300025229 Ga0209147_100217 Ga0209147_10021735 419
80 3300025233 Ga0209437_100432 Ga0209437_10043229 419
81 3300025242 Ga0209258_100390 Ga0209258_10039020 419
82 3300025246 Ga0209646_1000204 Ga0209646_100020412 419
83 3300025246 Ga0209646_1000227 Ga0209646_100022720 419
84 3300025250 Ga0209026_1000340 Ga0209026_100034021 419
85 3300025250 Ga0209026_1004699 Ga0209026_10046992 419
86 3300025256 Ga0209759_1000298 Ga0209759_100029812 419
87 3300025256 Ga0209759_1000561 Ga0209759_100056120 419
88 3300025913 Ga0207695_10001995 Ga0207695_1000199510 419
89 3300025949 Ga0207667_10003921 Ga0207667_1000392114 419
90 3300026142 Ga0207698_10060608 Ga0207698_100606082 419
91 3300048919 Ga0496116_0014781 Ga0496116_0014781_1134_2471 419
92 3300048924 Ga0496121_0050538 Ga0496121_0050538_1170_2507 419
93 3300048925 Ga0496122_0000693 Ga0496122_0000693_1015_2352 419
94 3300048926 Ga0496123_0000433 Ga0496123_0000433_9259_10596 419
95 iso_pu_bacteria 2739367655 2739612866 419
96 3300005536 Ga0070697_100069468 Ga0070697_1000694682 420
97 3300033529 Ga0316587_1004378 Ga0316587_10043782 420
98 3300037471 Ga0395905_0210222 Ga0395905_0210222_476_1801 420
99 3300039447 Ga0436361_0532183 Ga0436361_0532183_3103_4434 420
100 3300050513 nmdc:mga0rr50_152524_c1 nmdc:mga0rr50_152524_c1_13_1380 420
101 iso_pu_bacteria 2511231003 2511252190 420
102 iso_pu_bacteria 2511231026 2511383674 420
103 iso_pu_bacteria 2521172590 2521559295 420
104 iso_pu_bacteria 2548876994 2550696174 420
105 iso_pu_bacteria 2551306416 2553004094 420
106 iso_pu_bacteria 2765235838 2765568535 420
107 iso_pu_bacteria 2808606386 2808981268 420
108 iso_pu_bacteria 2808606415 2809128851 420
109 iso_pu_bacteria 2808606419 2809148472 420
110 iso_pu_bacteria 2818991445 2819591833 420
111 iso_pu_bacteria 2818991445 2819595492 420
112 iso_pu_bacteria 2818991449 2819615809 420
113 iso_pu_bacteria 2839094727 2839096586 420
114 iso_pu_bacteria 2852618963 2852621005 420
115 iso_pu_bacteria 2881927736 2881928158 420
116 iso_pu_bacteria 2884811622 2884816755 420
117 iso_pu_bacteria 2884811622 2884817058 420
118 iso_pu_bacteria 2884836552 2884836741 420
119 iso_pu_bacteria 2884836552 2884837638 420
120 iso_pu_bacteria 2884852848 2884853032 420
121 iso_pu_bacteria 2884852848 2884853929 420
122 iso_pu_bacteria 2887375801 2887376939 420
123 iso_pu_bacteria 2896154374 2896154954 420
124 iso_pu_bacteria 2896154374 2896155850 420
125 iso_pu_bacteria 2904439833 2904443704 420
126 iso_pu_bacteria 2904530477 2904532601 420
127 iso_pu_bacteria 2904584206 2904585099 420
128 iso_pu_bacteria 2904589729 2904593448 420
129 iso_pu_bacteria 2904601388 2904605628 420
130 iso_pu_bacteria 2919046199 2919048093 420
131 iso_pu_bacteria 2919079590 2919081423 420
132 iso_pu_bacteria 2923510766 2923512968 420
133 iso_pu_bacteria 2928130867 2928133807 420
134 3300005338 Ga0068868_100268693 Ga0068868_1002686931 421
135 3300005366 Ga0070659_100195696 Ga0070659_1001956961 421
136 3300005445 Ga0070708_100077567 Ga0070708_1000775672 421
137 3300005536 Ga0070697_100014081 Ga0070697_1000140815 421
138 3300005548 Ga0070665_100115209 Ga0070665_1001152092 421
139 3300009174 Ga0105241_10007759 Ga0105241_100077594 421
140 3300009545 Ga0105237_10016720 Ga0105237_100167204 421
141 3300009551 Ga0105238_10131300 Ga0105238_101313002 421
142 3300025233 Ga0209437_100419 Ga0209437_10041918 421
143 3300025914 Ga0207671_10016590 Ga0207671_100165903 421
144 3300026041 Ga0207639_10018667 Ga0207639_100186673 421
145 3300026075 Ga0207708_10251138 Ga0207708_102511381 421
146 3300035695 Ga0373927_0015575 Ga0373927_0015575_1688_3016 421
147 3300003751 Ga0055538_1000054 Ga0055538_100005497 422
148 3300003752 Ga0055539_1000066 Ga0055539_100006697 422
149 3300003756 Ga0055533_1000076 Ga0055533_100007697 422
150 3300003759 Ga0055525_1000098 Ga0055525_100009897 422
151 3300003792 Ga0055540_1009900 Ga0055540_10099003 422
152 3300003794 Ga0055531_10000192 Ga0055531_1000019267 422
153 3300003841 Ga0055541_1000056 Ga0055541_100005697 422
154 3300005333 Ga0070677_10033357 Ga0070677_100333572 422
155 3300005335 Ga0070666_10139530 Ga0070666_101395301 422
156 3300005338 Ga0068868_100008536 Ga0068868_1000085367 422
157 3300005354 Ga0070675_100010314 Ga0070675_1000103147 422
158 3300005366 Ga0070659_100071131 Ga0070659_1000711312 422
159 3300005457 Ga0070662_100016681 Ga0070662_1000166812 422
160 3300005563 Ga0068855_100148510 Ga0068855_1001485102 422
161 3300005578 Ga0068854_100127384 Ga0068854_1001273841 422
162 3300005614 Ga0068856_100056797 Ga0068856_1000567972 422
163 3300005616 Ga0068852_100055000 Ga0068852_1000550002 422
164 3300005618 Ga0068864_100097304 Ga0068864_1000973042 422
165 3300005718 Ga0068866_10047052 Ga0068866_100470522 422
166 3300005719 Ga0068861_100001865 Ga0068861_10000186512 422
167 3300005842 Ga0068858_100041121 Ga0068858_1000411212 422
168 3300005844 Ga0068862_100143188 Ga0068862_1001431882 422
169 3300006237 Ga0097621_100158581 Ga0097621_1001585811 422
170 3300006358 Ga0068871_100012320 Ga0068871_1000123206 422
171 3300007076 Ga0075435_100080165 Ga0075435_1000801652 422
172 3300009098 Ga0105245_10281290 Ga0105245_102812901 422
173 3300009101 Ga0105247_10069131 Ga0105247_100691312 422
174 3300009174 Ga0105241_10105698 Ga0105241_101056982 422
175 3300009177 Ga0105248_10045951 Ga0105248_100459514 422
176 3300009551 Ga0105238_10086380 Ga0105238_100863802 422
177 3300010375 Ga0105239_10141658 Ga0105239_101416582 422
178 3300013102 Ga0157371_10156577 Ga0157371_101565772 422
179 3300013296 Ga0157374_10040727 Ga0157374_100407272 422
180 3300013296 Ga0157374_10192274 Ga0157374_101922742 422
181 3300013297 Ga0157378_10164311 Ga0157378_101643112 422
182 3300013306 Ga0163162_10062755 Ga0163162_100627553 422
183 3300014968 Ga0157379_10038095 Ga0157379_100380953 422
184 3300014968 Ga0157379_10208631 Ga0157379_102086311 422
185 3300025224 Ga0209784_100002 Ga0209784_1000021585 422
186 3300025225 Ga0209566_100003 Ga0209566_1000031585 422
187 3300025226 Ga0209674_100004 Ga0209674_1000041585 422
188 3300025230 Ga0209563_100006 Ga0209563_1000061585 422
189 3300025253 Ga0209677_100003 Ga0209677_1000031585 422
190 3300025273 Ga0209673_1009563 Ga0209673_10095633 422
191 3300025303 Ga0209051_1000281 Ga0209051_100028185 422
192 3300025304 Ga0209257_1000039 Ga0209257_100003997 422
193 3300025315 Ga0207697_10055030 Ga0207697_100550302 422
194 3300025899 Ga0207642_10104498 Ga0207642_101044981 422
195 3300025903 Ga0207680_10034211 Ga0207680_100342112 422
196 3300025920 Ga0207649_10055756 Ga0207649_100557562 422
197 3300025923 Ga0207681_10028175 Ga0207681_100281753 422
198 3300025924 Ga0207694_10041449 Ga0207694_100414493 422
199 3300025926 Ga0207659_10068274 Ga0207659_100682742 422
200 3300025927 Ga0207687_10037391 Ga0207687_100373912 422
201 3300025932 Ga0207690_10007532 Ga0207690_100075322 422
202 3300025941 Ga0207711_10003165 Ga0207711_100031659 422
203 3300025942 Ga0207689_10000550 Ga0207689_1000055010 422
204 3300025949 Ga0207667_10078817 Ga0207667_100788172 422
205 3300026023 Ga0207677_10004108 Ga0207677_100041082 422
206 3300026035 Ga0207703_10056327 Ga0207703_100563272 422
207 3300026067 Ga0207678_10014250 Ga0207678_100142502 422
208 3300026095 Ga0207676_10045564 Ga0207676_100455642 422
209 3300026118 Ga0207675_100000576 Ga0207675_10000057610 422
210 3300026142 Ga0207698_10044122 Ga0207698_100441222 422
211 3300028380 Ga0268265_10080624 Ga0268265_100806242 422
212 3300028381 Ga0268264_10028804 Ga0268264_100288044 422
213 3300031235 Ga0265330_10002659 Ga0265330_100026592 422
214 3300031238 Ga0265332_10000694 Ga0265332_100006946 422
215 3300031241 Ga0265325_10011026 Ga0265325_100110261 422
216 3300031242 Ga0265329_10002182 Ga0265329_100021822 422
217 3300031250 Ga0265331_10001220 Ga0265331_100012208 422
218 3300031251 Ga0265327_10010221 Ga0265327_100102216 422
219 3300031344 Ga0265316_10053784 Ga0265316_100537842 422
220 3300031711 Ga0265314_10008184 Ga0265314_100081846 422
221 3300033528 Ga0316588_1019709 Ga0316588_10197091 422
222 3300033541 Ga0316596_1023929 Ga0316596_10239291 422
223 3300035691 Ga0373931_0002282 Ga0373931_0002282_3714_5045 422
224 3300039447 Ga0436361_0601494 Ga0436361_0601494_1184_2515 422
225 3300048904 Ga0496101_0051300 Ga0496101_0051300_1184_2515 422
226 3300048907 Ga0496104_0114732 Ga0496104_0114732_89_1420 422
227 3300048909 Ga0496106_0007766 Ga0496106_0007766_337_1668 422
228 3300048910 Ga0496107_0029226 Ga0496107_0029226_336_1667 422
229 3300048912 Ga0496109_0085898 Ga0496109_0085898_795_2126 422
230 3300048913 Ga0496110_0116386 Ga0496110_0116386_793_2124 422
231 3300048914 Ga0496111_0034868 Ga0496111_0034868_804_2135 422
232 3300048918 Ga0496115_0056798 Ga0496115_0056798_735_2066 422
233 3300048924 Ga0496121_0003466 Ga0496121_0003466_3339_4664 422
234 3300048928 Ga0496125_0000433 Ga0496125_0000433_47130_48647 422
235 3300049585 Ga0501069_0015512 Ga0501069_0015512_1960_3285 422
236 3300049585 Ga0501069_0063213 Ga0501069_0063213_81_1406 422
237 3300049586 Ga0501070_0004818 Ga0501070_0004818_592_1917 422
238 3300049587 Ga0501071_0086812 Ga0501071_0086812_143_1468 422
239 3300049823 Ga0501044_0046382 Ga0501044_0046382_1318_2643 422
240 3300049823 Ga0501044_0206626 Ga0501044_0206626_75_1400 422
241 3300050513 nmdc:mga0rr50_46631_c1 nmdc:mga0rr50_46631_c1_1459_2790 422
242 3300005334 Ga0068869_100001111 Ga0068869_10000111111 423
243 3300005336 Ga0070680_100084832 Ga0070680_1000848322 423
244 3300005338 Ga0068868_100017828 Ga0068868_1000178282 423
245 3300005340 Ga0070689_100010513 Ga0070689_1000105133 423
246 3300005345 Ga0070692_10001690 Ga0070692_100016905 423
247 3300005345 Ga0070692_10035362 Ga0070692_100353622 423
248 3300005345 Ga0070692_10048469 Ga0070692_100484692 423
249 3300005347 Ga0070668_100012754 Ga0070668_1000127542 423
250 3300005364 Ga0070673_100126913 Ga0070673_1001269132 423
251 3300005365 Ga0070688_100054905 Ga0070688_1000549052 423
252 3300005438 Ga0070701_10000947 Ga0070701_1000094711 423
253 3300005441 Ga0070700_100001391 Ga0070700_1000013914 423
254 3300005441 Ga0070700_100008103 Ga0070700_1000081032 423
255 3300005441 Ga0070700_100165086 Ga0070700_1001650862 423
256 3300005444 Ga0070694_100051267 Ga0070694_1000512672 423
257 3300005456 Ga0070678_100067388 Ga0070678_1000673882 423
258 3300005459 Ga0068867_100012345 Ga0068867_1000123452 423
259 3300005459 Ga0068867_100090365 Ga0068867_1000903652 423
260 3300005539 Ga0068853_100095778 Ga0068853_1000957782 423
261 3300005544 Ga0070686_100001046 Ga0070686_1000010468 423
262 3300005545 Ga0070695_100005269 Ga0070695_1000052695 423
263 3300005546 Ga0070696_100030025 Ga0070696_1000300253 423
264 3300005546 Ga0070696_100033628 Ga0070696_1000336282 423
265 3300005546 Ga0070696_100109836 Ga0070696_1001098362 423
266 3300005547 Ga0070693_100086052 Ga0070693_1000860522 423
267 3300005563 Ga0068855_100019387 Ga0068855_1000193873 423
268 3300005577 Ga0068857_100174261 Ga0068857_1001742612 423
269 3300005614 Ga0068856_100107697 Ga0068856_1001076972 423
270 3300005615 Ga0070702_100000641 Ga0070702_10000064111 423
271 3300005616 Ga0068852_100006577 Ga0068852_1000065774 423
272 3300005617 Ga0068859_100027104 Ga0068859_1000271046 423
273 3300005718 Ga0068866_10003238 Ga0068866_100032384 423
274 3300005719 Ga0068861_100003892 Ga0068861_1000038922 423
275 3300005840 Ga0068870_10010548 Ga0068870_100105484 423
276 3300005842 Ga0068858_100000679 Ga0068858_1000006794 423
277 3300005843 Ga0068860_100009556 Ga0068860_1000095562 423
278 3300005844 Ga0068862_100015052 Ga0068862_1000150522 423
279 3300006237 Ga0097621_100017693 Ga0097621_1000176932 423
280 3300006358 Ga0068871_100006781 Ga0068871_1000067812 423
281 3300006880 Ga0075429_100000320 Ga0075429_10000032023 423
282 3300006881 Ga0068865_100033142 Ga0068865_1000331422 423
283 3300006931 Ga0097620_100027104 Ga0097620_1000271046 423
284 3300006946 Ga0079104_1004787 Ga0079104_10047873 423
285 3300009093 Ga0105240_10005343 Ga0105240_1000534320 423
286 3300009093 Ga0105240_10008689 Ga0105240_100086896 423
287 3300009093 Ga0105240_10044364 Ga0105240_100443641 423
288 3300009098 Ga0105245_10004092 Ga0105245_1000409211 423
289 3300009176 Ga0105242_10008454 Ga0105242_100084544 423
290 3300009545 Ga0105237_10031873 Ga0105237_100318734 423
291 3300009545 Ga0105237_10111587 Ga0105237_101115873 423
292 3300009551 Ga0105238_10000632 Ga0105238_100006324 423
293 3300009551 Ga0105238_10149651 Ga0105238_101496512 423
294 3300009551 Ga0105238_10340856 Ga0105238_103408561 423
295 3300009553 Ga0105249_10013998 Ga0105249_100139982 423
296 3300010375 Ga0105239_10043254 Ga0105239_100432542 423
297 3300013297 Ga0157378_10003424 Ga0157378_1000342411 423
298 3300013308 Ga0157375_10108897 Ga0157375_101088972 423
299 3300014326 Ga0157380_10003649 Ga0157380_100036499 423
300 3300014969 Ga0157376_10210496 Ga0157376_102104962 423
301 3300025899 Ga0207642_10000792 Ga0207642_100007924 423
302 3300025908 Ga0207643_10009245 Ga0207643_100092452 423
303 3300025911 Ga0207654_10058805 Ga0207654_100588052 423
304 3300025912 Ga0207707_10102678 Ga0207707_101026782 423
305 3300025913 Ga0207695_10001105 Ga0207695_1000110522 423
306 3300025913 Ga0207695_10004190 Ga0207695_1000419021 423
307 3300025913 Ga0207695_10012196 Ga0207695_1001219612 423
308 3300025914 Ga0207671_10033225 Ga0207671_100332253 423
309 3300025914 Ga0207671_10065756 Ga0207671_100657562 423
310 3300025924 Ga0207694_10000171 Ga0207694_1000017155 423
311 3300025927 Ga0207687_10003861 Ga0207687_100038613 423
312 3300025934 Ga0207686_10001479 Ga0207686_1000147911 423
313 3300025934 Ga0207686_10133108 Ga0207686_101331082 423
314 3300025936 Ga0207670_10003899 Ga0207670_100038994 423
315 3300025937 Ga0207669_10019594 Ga0207669_100195942 423
316 3300025938 Ga0207704_10001625 Ga0207704_100016251 423
317 3300025942 Ga0207689_10000392 Ga0207689_1000039212 423
318 3300025949 Ga0207667_10020526 Ga0207667_100205262 423
319 3300025949 Ga0207667_10048606 Ga0207667_100486063 423
320 3300025949 Ga0207667_10096505 Ga0207667_100965053 423
321 3300025981 Ga0207640_10072670 Ga0207640_100726702 423
322 3300025981 Ga0207640_10127063 Ga0207640_101270632 423
323 3300026023 Ga0207677_10033386 Ga0207677_100333862 423
324 3300026035 Ga0207703_10008734 Ga0207703_100087344 423
325 3300026035 Ga0207703_10028026 Ga0207703_100280264 423
326 3300026041 Ga0207639_10016794 Ga0207639_100167944 423
327 3300026075 Ga0207708_10002193 Ga0207708_1000219311 423
328 3300026075 Ga0207708_10015508 Ga0207708_100155082 423
329 3300026075 Ga0207708_10120356 Ga0207708_101203562 423
330 3300026078 Ga0207702_10083259 Ga0207702_100832592 423
331 3300026089 Ga0207648_10006481 Ga0207648_100064812 423
332 3300026089 Ga0207648_10103380 Ga0207648_101033802 423
333 3300026118 Ga0207675_100004949 Ga0207675_1000049494 423
334 3300026121 Ga0207683_10027137 Ga0207683_100271372 423
335 3300028381 Ga0268264_10107207 Ga0268264_101072072 423
336 3300028577 Ga0265318_10015153 Ga0265318_100151533 423
337 3300028794 Ga0307515_10147648 Ga0307515_101476482 423
338 3300028800 Ga0265338_10163289 Ga0265338_101632892 423
339 3300031238 Ga0265332_10003742 Ga0265332_100037425 423
340 3300031239 Ga0265328_10006406 Ga0265328_100064065 423
341 3300031240 Ga0265320_10008016 Ga0265320_100080162 423
342 3300031242 Ga0265329_10012724 Ga0265329_100127242 423
343 3300031250 Ga0265331_10026551 Ga0265331_100265512 423
344 3300031344 Ga0265316_10011543 Ga0265316_100115434 423
345 3300031456 Ga0307513_10023595 Ga0307513_100235952 423
346 3300031711 Ga0265314_10001520 Ga0265314_100015207 423
347 3300048919 Ga0496116_0021941 Ga0496116_0021941_319_1644 423
348 3300048921 Ga0496118_0093284 Ga0496118_0093284_407_1732 423
349 3300048925 Ga0496122_0000134 Ga0496122_0000134_85137_86462 423
350 3300048926 Ga0496123_0000307 Ga0496123_0000307_10842_12167 423
351 3300049744 Ga0501083_0053572 Ga0501083_0053572_869_2182 423
352 3300002704 JGI25155J39150_1000076 JGI25155J39150_10000769 424
353 3300002705 JGI25156J39149_1000032 JGI25156J39149_100003266 424
354 3300002738 JGI25154J39366_1000095 JGI25154J39366_10000959 424
355 3300002741 JGI25157J39369_1000212 JGI25157J39369_100021247 424
356 3300003187 JGI25151J46595_10001193 JGI25151J46595_100011939 424
357 3300003187 JGI25151J46595_10009780 JGI25151J46595_100097803 424
358 3300003758 Ga0055532_1000083 Ga0055532_100008347 424
359 3300003761 Ga0055535_1001985 Ga0055535_10019852 424
360 3300003771 Ga0055526_1000723 Ga0055526_100072317 424
361 3300003771 Ga0055526_1006049 Ga0055526_10060494 424
362 3300003775 Ga0055524_1001068 Ga0055524_10010689 424
363 3300003781 Ga0055536_1000219 Ga0055536_10002193 424
364 3300003784 Ga0055534_1001363 Ga0055534_10013631 424
365 3300005327 Ga0070658_10012521 Ga0070658_100125213 424
366 3300005330 Ga0070690_100005910 Ga0070690_1000059102 424
367 3300005334 Ga0068869_100023373 Ga0068869_1000233733 424
368 3300005334 Ga0068869_100102908 Ga0068869_1001029081 424
369 3300005338 Ga0068868_100068076 Ga0068868_1000680763 424
370 3300005340 Ga0070689_100009272 Ga0070689_1000092723 424
371 3300005341 Ga0070691_10009266 Ga0070691_100092662 424
372 3300005345 Ga0070692_10009480 Ga0070692_100094802 424
373 3300005366 Ga0070659_100073701 Ga0070659_1000737012 424
374 3300005438 Ga0070701_10008850 Ga0070701_100088501 424
375 3300005445 Ga0070708_100000292 Ga0070708_1000002922 424
376 3300005445 Ga0070708_100100984 Ga0070708_1001009842 424
377 3300005457 Ga0070662_100156478 Ga0070662_1001564781 424
378 3300005459 Ga0068867_100040202 Ga0068867_1000402022 424
379 3300005467 Ga0070706_100109810 Ga0070706_1001098102 424
380 3300005471 Ga0070698_100019505 Ga0070698_1000195057 424
381 3300005536 Ga0070697_100017621 Ga0070697_1000176214 424
382 3300005539 Ga0068853_100011708 Ga0068853_1000117088 424
383 3300005544 Ga0070686_100053038 Ga0070686_1000530383 424
384 3300005546 Ga0070696_100033569 Ga0070696_1000335693 424
385 3300005549 Ga0070704_100020448 Ga0070704_1000204482 424
386 3300005549 Ga0070704_100055899 Ga0070704_1000558992 424
387 3300005563 Ga0068855_100071556 Ga0068855_1000715562 424
388 3300005564 Ga0070664_100268210 Ga0070664_1002682101 424
389 3300005577 Ga0068857_100013406 Ga0068857_1000134063 424
390 3300005614 Ga0068856_100203022 Ga0068856_1002030221 424
391 3300005614 Ga0068856_100277948 Ga0068856_1002779481 424
392 3300005718 Ga0068866_10001033 Ga0068866_100010334 424
393 3300005719 Ga0068861_100010032 Ga0068861_1000100322 424
394 3300005842 Ga0068858_100015042 Ga0068858_1000150422 424
395 3300005843 Ga0068860_100021211 Ga0068860_1000212113 424
396 3300005844 Ga0068862_100030154 Ga0068862_1000301543 424
397 3300005937 Ga0081455_10057144 Ga0081455_100571442 424
398 3300006237 Ga0097621_100073984 Ga0097621_1000739843 424
399 3300006358 Ga0068871_100048348 Ga0068871_1000483482 424
400 3300006871 Ga0075434_100102147 Ga0075434_1001021472 424
401 3300006881 Ga0068865_100022697 Ga0068865_1000226971 424
402 3300009098 Ga0105245_10008233 Ga0105245_100082337 424
403 3300009098 Ga0105245_10088819 Ga0105245_100888192 424
404 3300009148 Ga0105243_10015745 Ga0105243_100157454 424
405 3300009176 Ga0105242_10087057 Ga0105242_100870572 424
406 3300009545 Ga0105237_10036514 Ga0105237_100365142 424
407 3300009551 Ga0105238_10052495 Ga0105238_100524953 424
408 3300009553 Ga0105249_10017247 Ga0105249_100172473 424
409 3300010375 Ga0105239_10018198 Ga0105239_100181983 424
410 3300010375 Ga0105239_10075103 Ga0105239_100751034 424
411 3300011119 Ga0105246_10210468 Ga0105246_102104681 424
412 3300013104 Ga0157370_10032636 Ga0157370_100326365 424
413 3300013296 Ga0157374_10122936 Ga0157374_101229362 424
414 3300013297 Ga0157378_10041912 Ga0157378_100419126 424
415 3300013308 Ga0157375_10055609 Ga0157375_100556094 424
416 3300014326 Ga0157380_10012821 Ga0157380_100128212 424
417 3300014968 Ga0157379_10210761 Ga0157379_102107612 424
418 3300025206 Ga0209435_100013 Ga0209435_10001366 424
419 3300025229 Ga0209147_100030 Ga0209147_100030288 424
420 3300025242 Ga0209258_100433 Ga0209258_10043334 424
421 3300025246 Ga0209646_1000034 Ga0209646_100003466 424
422 3300025250 Ga0209026_1000022 Ga0209026_100002266 424
423 3300025256 Ga0209759_1000018 Ga0209759_100001866 424
424 3300025263 Ga0209565_1000021 Ga0209565_1000021100 424
425 3300025291 Ga0209675_1000040 Ga0209675_100004089 424
426 3300025292 Ga0209676_1000014 Ga0209676_1000014565 424
427 3300025294 Ga0209025_1000092 Ga0209025_100009289 424
428 3300025295 Ga0209564_1000159 Ga0209564_100015957 424
429 3300025295 Ga0209564_1000218 Ga0209564_100021811 424
430 3300025295 Ga0209564_1000452 Ga0209564_100045228 424
431 3300025297 Ga0209758_1010313 Ga0209758_10103135 424
432 3300025299 Ga0209256_1003336 Ga0209256_10033363 424
433 3300025899 Ga0207642_10002165 Ga0207642_100021652 424
434 3300025914 Ga0207671_10049119 Ga0207671_100491192 424
435 3300025932 Ga0207690_10107217 Ga0207690_101072172 424
436 3300025934 Ga0207686_10003638 Ga0207686_100036387 424
437 3300025942 Ga0207689_10001736 Ga0207689_1000173618 424
438 3300025942 Ga0207689_10017767 Ga0207689_100177672 424
439 3300025949 Ga0207667_10065049 Ga0207667_100650492 424
440 3300025961 Ga0207712_10047240 Ga0207712_100472402 424
441 3300026035 Ga0207703_10030512 Ga0207703_100305121 424
442 3300026041 Ga0207639_10005658 Ga0207639_100056588 424
443 3300026075 Ga0207708_10005789 Ga0207708_100057898 424
444 3300026078 Ga0207702_10167390 Ga0207702_101673902 424
445 3300026078 Ga0207702_10241514 Ga0207702_102415142 424
446 3300026089 Ga0207648_10007807 Ga0207648_100078073 424
447 3300026089 Ga0207648_10092855 Ga0207648_100928552 424
448 3300026116 Ga0207674_10032457 Ga0207674_100324572 424
449 3300026116 Ga0207674_10154049 Ga0207674_101540492 424
450 3300026118 Ga0207675_100002917 Ga0207675_10000291710 424
451 3300031251 Ga0265327_10042720 Ga0265327_100427202 424
452 3300036401 Ga0373937_0245368 Ga0373937_0245368_66_1382 424
453 3300037418 Ga0395900_0032253 Ga0395900_0032253_516_1835 424
454 3300039447 Ga0436361_1085109 Ga0436361_1085109_1106_2422 424
455 3300042876 Ga0451577_0048792 Ga0451577_0048792_2341_3660 424
456 3300042876 Ga0451577_0137460 Ga0451577_0137460_832_2151 424
457 3300042876 Ga0451577_0207969 Ga0451577_0207969_77_1396 424
458 3300044712 Ga0453684_0001209 Ga0453684_0001209_48136_49455 424
459 3300044712 Ga0453684_0018355 Ga0453684_0018355_2132_3457 424
460 3300044712 Ga0453684_0021041 Ga0453684_0021041_3205_4530 424
461 3300044712 Ga0453684_0101689 Ga0453684_0101689_2006_3325 424
462 3300044712 Ga0453684_0111567 Ga0453684_0111567_868_2187 424
463 3300046472 Ga0495580_0051560 Ga0495580_0051560_938_2266 424
464 3300048905 Ga0496102_0204335 Ga0496102_0204335_174_1496 424
465 3300048913 Ga0496110_0099036 Ga0496110_0099036_50_1372 424
466 3300048913 Ga0496110_0193865 Ga0496110_0193865_480_1802 424
467 3300049822 Ga0501035_0038184 Ga0501035_0038184_874_2205 424

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

110

425

0.87

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

103

392

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r2f-assembly1.cif.gz_A crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose 0.8639 27 419
5yse-assembly1.cif.gz_A crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotetraose 0.8538 29 423
4r2f-assembly1.cif.gz_A crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose 0.8517 27 419
6jai-assembly1.cif.gz_A crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose 0.8347 27 421
6jar-assembly1.cif.gz_A crystal structure of abc transporter alpha-glycoside-binding mutant protein r49a in complex with maltose 0.8347 27 421
ID Description Score Start End Superfamily
2gh9A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8243 30 140 3.40.190.10
5f7vA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8001 28 420 3.40.190.10
4r9gB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7999 28 359 3.40.190.10
4g68C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7932 29 142 3.40.190.10
5xpjB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7887 28 140 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A258QU41-F1-model_v4 ABC transporter substrate-binding protein 0.9869 20 135 GO:0042597
AF-A0A2H5ZTE3-F1-model_v4 Putative ABC transporter-binding protein 0.9652 20 424
AF-A0A537AUA6-F1-model_v4 Extracellular solute-binding protein 0.965 16 346
AF-A0A2H5ZSB2-F1-model_v4 Putative ABC transporter-binding protein 0.958 197 424
AF-A0A7Y8HH21-F1-model_v4 Extracellular solute-binding protein 0.9542 73 422

Feature Viewer

pLDDT pTM Quality
91.44 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map