F449902

General Info

Members Datasets Scaffolds Average Seq Length
467 335 409 144

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0200998|Ga0495609_0200998_361_801
Length 140
Sequence MSTIQTKDRFQSAISAGKPLRLGLWLAQIAAAGLFGMSGVMKLTTPIPELSAMMPWTGEVSPIFVRMIGLIDLAGGLGLILPSLTRVVAAMWCIVLQVLAAGFHAFRGEFAVLPLNAVLLGLVVFIAWGRSKKAPIAPRR

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
6 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
7 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
8 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
9 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
10 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
11 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
12 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
13 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
14 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
15 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
16 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
17 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
18 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
19 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
20 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
21 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
22 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
23 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
24 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
25 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
26 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
27 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
28 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
29 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
30 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
31 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
32 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
33 2922368715
34 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
35 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
36 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
37 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
38 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
39 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
40 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
41 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
42 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
43 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
44 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
45 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
46 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
47 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
48 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
49 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
50 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
51 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
52 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
53 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
54 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
61 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
62 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
107 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
108 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
170 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
171 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
179 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
180 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
183 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
194 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
197 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
200 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
201 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
202 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
203 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
206 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
300 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
306 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
307 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
308 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
309 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
310 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
311 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
312 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
313 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
314 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
315 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
316 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
317 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
318 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
321 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
322 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
323 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
324 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
325 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
326 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
327 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
328 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
329 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
330 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
331 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
332 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
333 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
334 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
335 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.77
Metatranscriptomes 0
Isolates 12.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.27
Nodule 9.64
Rhizoplane 5.57
Rhizosphere 42.83
Stem 0
Stem Tuber 0
Unclassified 13.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1004376 3300003214 Bacteria 3057
2 JGI25153J46596_10006379 3300003215 Bacteria 5980
3 JGI25153J46596_10010200 3300003215 Bacteria 4272
4 JGI25153J46596_10043969 3300003215 Bacteria 1347
5 JGI25153J46596_10133236 3300003215 Bacteria 548
6 JGI25153J46596_10135114 3300003215 Bacteria 542
7 JGI25153J46596_10135296 3300003215 Bacteria 542
8 rootH1_10079211 3300003316 Bacteria 1491
9 rootL2_10206084 3300003322 Bacteria 1251
10 rootH1_10266041 3300003323 Bacteria 1001
11 JGI25160J50197_1000955 3300003354 Bacteria 15154
12 JGI25160J50197_1004203 3300003354 Bacteria 6256
13 Ga0055539_1004109 3300003752 Bacteria 1961
14 Ga0055525_1007230 3300003759 Bacteria 938
15 Ga0055526_1017424 3300003771 Bacteria 2743
16 Ga0055530_10001494 3300003791 Bacteria 16973
17 Ga0055540_1000045 3300003792 Bacteria 152083
18 Ga0055531_10000062 3300003794 Bacteria 120504
19 Ga0055531_10111547 3300003794 Bacteria 545
20 Ga0055543_1002750 3300004625 Bacteria 5592
21 Ga0065165_1001735 3300005262 Bacteria 21799
22 Ga0065165_1125971 3300005262 Bacteria 617
23 Ga0070670_100325846 3300005331 Bacteria 1346
24 Ga0070666_10756895 3300005335 Bacteria 714
25 Ga0068868_100578464 3300005338 Bacteria 993
26 Ga0070669_100672694 3300005353 Bacteria 872
27 Ga0070675_101170147 3300005354 Bacteria 708
28 Ga0070671_100036131 3300005355 Bacteria 4096
29 Ga0070674_101246827 3300005356 Bacteria 661
30 Ga0070659_100848940 3300005366 Bacteria 796
31 Ga0070708_100162149 3300005445 Bacteria 2084
32 Ga0070663_100038725 3300005455 Bacteria 3327
33 Ga0070678_100957887 3300005456 Bacteria 785
34 Ga0070662_100425094 3300005457 Bacteria 1100
35 Ga0070662_100674444 3300005457 Bacteria 873
36 Ga0068867_101379108 3300005459 Bacteria 653
37 Ga0070706_100000388 3300005467 Bacteria 52771
38 Ga0070707_100071369 3300005468 Bacteria 3346
39 Ga0070698_100250786 3300005471 Bacteria 1703
40 Ga0070699_100221696 3300005518 Bacteria 1685
41 Ga0070672_100668081 3300005543 Bacteria 908
42 Ga0070665_100117210 3300005548 Bacteria 2666
43 Ga0070665_100790730 3300005548 Bacteria 962
44 Ga0070665_100997854 3300005548 Bacteria 849
45 Ga0070665_101247892 3300005548 Bacteria 754
46 Ga0068855_102012535 3300005563 Bacteria 583
47 Ga0068854_100070508 3300005578 Bacteria 2554
48 Ga0068856_100047652 3300005614 Bacteria 4222
49 Ga0068852_100009329 3300005616 Bacteria 7281
50 Ga0068859_101163199 3300005617 Bacteria 849
51 Ga0068861_100027756 3300005719 Bacteria 4127
52 Ga0068858_101374621 3300005842 Bacteria 695
53 Ga0068860_100001474 3300005843 Bacteria 25421
54 Ga0068862_100013475 3300005844 Bacteria 6769
55 Ga0068862_101520333 3300005844 Bacteria 675
56 Ga0075365_10101796 3300006038 Bacteria 1967
57 Ga0075365_10299336 3300006038 Bacteria 1132
58 Ga0075368_10469498 3300006042 Bacteria 559
59 Ga0075363_100188342 3300006048 Bacteria 1176
60 Ga0075364_10018240 3300006051 Bacteria 4392
61 Ga0075364_10321519 3300006051 Bacteria 1053
62 Ga0075362_10185990 3300006177 Bacteria 1008
63 Ga0075367_10051839 3300006178 Bacteria 2427
64 Ga0075367_10084374 3300006178 Bacteria 1926
65 Ga0075367_10916188 3300006178 Bacteria 559
66 Ga0075367_11041699 3300006178 Bacteria 523
67 Ga0075369_10036333 3300006186 Bacteria 2096
68 Ga0075369_10230373 3300006186 Bacteria 858
69 Ga0075366_10000186 3300006195 Bacteria 27357
70 Ga0075366_10032521 3300006195 Bacteria 3070
71 Ga0075366_10052968 3300006195 Bacteria 2410
72 Ga0075366_10103111 3300006195 Bacteria 1713
73 Ga0075366_10632949 3300006195 Bacteria 663
74 Ga0075370_10031513 3300006353 Bacteria 2960
75 Ga0075370_10104511 3300006353 Bacteria 1641
76 Ga0097620_101163307 3300006931 Bacteria 849
77 Ga0099825_1028597 3300006941 Bacteria 2690
78 Ga0099823_1047852 3300006944 Bacteria 2745
79 Ga0099826_10035115 3300006948 Bacteria 3570
80 Ga0105240_11003110 3300009093 Bacteria 893
81 Ga0105240_11280324 3300009093 Bacteria 774
82 Ga0111539_11272305 3300009094 Bacteria 854
83 Ga0105245_10018634 3300009098 Bacteria 6070
84 Ga0105245_10507066 3300009098 Bacteria 1223
85 Ga0105247_10032496 3300009101 Bacteria 3171
86 Ga0105247_10093571 3300009101 Bacteria 1911
87 Ga0105243_10044514 3300009148 Bacteria 3483
88 Ga0105241_10003792 3300009174 Bacteria 11210
89 Ga0105241_10037000 3300009174 Bacteria 3675
90 Ga0105248_10195947 3300009177 Bacteria 2276
91 Ga0105237_10012663 3300009545 Bacteria 8878
92 Ga0105237_10079948 3300009545 Bacteria 3259
93 Ga0105237_10723473 3300009545 Bacteria 1002
94 Ga0105238_10018315 3300009551 Bacteria 7126
95 Ga0105238_10060577 3300009551 Bacteria 3789
96 Ga0105249_10033865 3300009553 Bacteria 4627
97 Ga0105239_10128431 3300010375 Bacteria 2818
98 Ga0105239_10224913 3300010375 Bacteria 2105
99 Ga0105239_10484497 3300010375 Bacteria 1405
100 Ga0105239_10657408 3300010375 Bacteria 1197
101 Ga0105239_10769509 3300010375 Bacteria 1102
102 Ga0105246_10020604 3300011119 Bacteria 4231
103 Ga0157313_1015678 3300012503 Bacteria 715
104 Ga0157374_10026771 3300013296 Bacteria 5192
105 Ga0157378_12095411 3300013297 Unclassified 616
106 Ga0163162_10497338 3300013306 Bacteria 1350
107 Ga0163163_10039967 3300014325 Bacteria 4579
108 Ga0157379_10160315 3300014968 Bacteria 2030
109 Ga0157376_10245640 3300014969 Bacteria 1669
110 Ga0182007_10096150 3300015262 Bacteria 978
111 Ga0209563_102487 3300025230 Bacteria 4147
112 Ga0209677_100366 3300025253 Bacteria 27688
113 Ga0209148_1000469 3300025254 Bacteria 43128
114 Ga0209759_1000948 3300025256 Bacteria 20815
115 Ga0209233_1012967 3300025261 Bacteria 2397
116 Ga0209455_1005428 3300025272 Bacteria 3941
117 Ga0209455_1005690 3300025272 Bacteria 3801
118 Ga0209676_1000135 3300025292 Bacteria 182756
119 Ga0209564_1007974 3300025295 Bacteria 5327
120 Ga0209758_1001668 3300025297 Bacteria 25107
121 Ga0209758_1015906 3300025297 Bacteria 3863
122 Ga0209758_1027283 3300025297 Bacteria 2444
123 Ga0209758_1028200 3300025297 Bacteria 2381
124 Ga0209758_1048249 3300025297 Bacteria 1515
125 Ga0209758_1078232 3300025297 Bacteria 1011
126 Ga0209758_1127625 3300025297 Bacteria 677
127 Ga0209050_1000100 3300025298 Bacteria 231385
128 Ga0209256_1016850 3300025299 Bacteria 2463
129 Ga0207426_1000347 3300025302 Bacteria 85420
130 Ga0207426_1026583 3300025302 Bacteria 1936
131 Ga0207426_1085785 3300025302 Bacteria 844
132 Ga0209051_1000067 3300025303 Bacteria 227181
133 Ga0209257_1000095 3300025304 Bacteria 259437
134 Ga0209257_1004512 3300025304 Bacteria 10712
135 Ga0209257_1047379 3300025304 Bacteria 1236
136 Ga0207710_10296745 3300025900 Bacteria 816
137 Ga0207688_10195899 3300025901 Bacteria 1210
138 Ga0207647_10001188 3300025904 Bacteria 20058
139 Ga0207647_10171933 3300025904 Bacteria 1261
140 Ga0207684_10001941 3300025910 Bacteria 21443
141 Ga0207654_10043172 3300025911 Bacteria 2555
142 Ga0207654_10086622 3300025911 Bacteria 1899
143 Ga0207695_10000006 3300025913 Bacteria 1135309
144 Ga0207695_11226208 3300025913 Bacteria 630
145 Ga0207671_10064833 3300025914 Bacteria 2716
146 Ga0207671_10142395 3300025914 Bacteria 1848
147 Ga0207671_10659740 3300025914 Bacteria 833
148 Ga0207649_11563113 3300025920 Bacteria 522
149 Ga0207694_10030985 3300025924 Bacteria 4085
150 Ga0207659_10378077 3300025926 Bacteria 1181
151 Ga0207687_10309031 3300025927 Bacteria 1276
152 Ga0207690_10449262 3300025932 Bacteria 1036
153 Ga0207706_10329286 3300025933 Bacteria 1329
154 Ga0207706_11064747 3300025933 Bacteria 677
155 Ga0207709_10236989 3300025935 Bacteria 1325
156 Ga0207667_12140083 3300025949 Bacteria 517
157 Ga0207712_10045365 3300025961 Bacteria 3043
158 Ga0207668_11334965 3300025972 Bacteria 646
159 Ga0207640_10347080 3300025981 Bacteria 1191
160 Ga0207658_10745305 3300025986 Bacteria 887
161 Ga0207677_10266785 3300026023 Bacteria 1398
162 Ga0207703_10440577 3300026035 Bacteria 1215
163 Ga0207639_10073398 3300026041 Bacteria 2682
164 Ga0207639_10091930 3300026041 Bacteria 2431
165 Ga0207678_10034820 3300026067 Bacteria 4385
166 Ga0207702_10068619 3300026078 Bacteria 3046
167 Ga0207675_100062483 3300026118 Bacteria 3478
168 Ga0207698_10165887 3300026142 Bacteria 1938
169 Ga0209389_1000015 3300027296 Bacteria 188311
170 Ga0209489_100072 3300027361 Bacteria 138111
171 Ga0209700_100034 3300027363 Bacteria 197276
172 Ga0268266_10025618 3300028379 Bacteria 5017
173 Ga0268266_10182439 3300028379 Bacteria 1912
174 Ga0268266_10580107 3300028379 Bacteria 1076
175 Ga0268266_11271463 3300028379 Bacteria 711
176 Ga0268265_10312994 3300028380 Bacteria 1418
177 Ga0268264_10000119 3300028381 Bacteria 192507
178 Ga0268264_10410656 3300028381 Bacteria 1303
179 Ga0265337_1035196 3300028556 Bacteria 1468
180 Ga0265319_1025028 3300028563 Bacteria 2140
181 Ga0265334_10002358 3300028573 Bacteria 8890
182 Ga0265323_10000434 3300028653 Bacteria 23913
183 Ga0265322_10023692 3300028654 Bacteria 1755
184 Ga0265336_10000649 3300028666 Bacteria 18964
185 Ga0265338_10000280 3300028800 Bacteria 91942
186 Ga0265324_10010204 3300029957 Bacteria 3632
187 Ga0307512_10025046 3300030522 Bacteria 5294
188 Ga0307513_10803842 3300031456 Bacteria 646
189 Ga0307508_10612604 3300031616 Bacteria 691
190 Ga0307516_10009299 3300031730 Bacteria 10981
191 Ga0307516_10023804 3300031730 Bacteria 6266
192 Ga0307507_10211764 3300033179 Unclassified 1320
193 Ga0307507_10488108 3300033179 Bacteria 668
194 Ga0307510_10007078 3300033180 Bacteria 13364
195 Ga0307510_10037765 3300033180 Bacteria 5353
196 Ga0307510_10328094 3300033180 Bacteria 986
197 Ga0307510_10431116 3300033180 Bacteria 760
198 Ga0395900_1546509 3300037418 Bacteria 575
199 Ga0436364_0914149 3300037853 Bacteria 1937
200 Ga0436365_0057994 3300039437 Bacteria 2545
201 Ga0436365_1646390 3300039437 Bacteria 581
202 Ga0436361_0644153 3300039447 Bacteria 1259
203 Ga0436361_0870621 3300039447 Bacteria 973
204 Ga0436361_0966806 3300039447 Bacteria 1322
205 Ga0451789_0436694 3300041443 Bacteria 1062
206 Ga0451791_1011064 3300041451 Unclassified 1400
207 Ga0451793_1873426 3300041452 Bacteria 999
208 Ga0451795_1305124 3300041456 Bacteria 587
209 Ga0451800_0578289 3300041459 Bacteria 1891
210 Ga0451802_1037132 3300041460 Unclassified 1811
211 Ga0451804_0039962 3300041463 Bacteria 981
212 Ga0451833_1128143 3300041491 Bacteria 2206
213 Ga0451839_0854493 3300041496 Bacteria 1774
214 Ga0451849_1366188 3300041505 Bacteria 1111
215 Ga0451855_1449691 3300041511 Bacteria 811
216 Ga0439448_0114339 3300042005 Bacteria 923
217 Ga0450919_000024 3300042121 Bacteria 12284
218 Ga0450918_000043 3300042531 Bacteria 25951
219 Ga0466969_0010417 3300044656 Bacteria 4928
220 Ga0466972_0018293 3300044658 Bacteria 3502
221 Ga0466972_0042011 3300044658 Bacteria 2224
222 Ga0466966_0000384 3300044684 Bacteria 28738
223 Ga0466966_0005799 3300044684 Bacteria 8144
224 Ga0466961_0000018 3300044693 Bacteria 109837
225 Ga0466961_0004929 3300044693 Bacteria 8391
226 Ga0466964_0002600 3300044706 Bacteria 6447
227 Ga0466970_0007978 3300044765 Bacteria 5317
228 Ga0466957_0004206 3300044842 Bacteria 7982
229 Ga0466960_0059765 3300044901 Bacteria 1866
230 Ga0466959_0016490 3300045049 Bacteria 5398
231 Ga0466959_0920987 3300045049 Bacteria 583
232 Ga0451576_0250380 3300045051 Bacteria 1851
233 Ga0466958_0009631 3300045836 Bacteria 5388
234 Ga0495592_0090183 3300046454 Bacteria 2200
235 Ga0495629_0002395 3300046459 Bacteria 14415
236 Ga0495651_0030158 3300046462 Bacteria 4229
237 Ga0495653_0085681 3300046463 Bacteria 2317
238 Ga0495650_0263707 3300046471 Bacteria 583
239 Ga0495639_0067451 3300046475 Bacteria 1648
240 Ga0495662_0339929 3300046476 Bacteria 738
241 Ga0495585_0073633 3300046492 Bacteria 1859
242 Ga0495594_0562502 3300046499 Bacteria 647
243 Ga0495583_0052130 3300046506 Bacteria 1863
244 Ga0495606_0035165 3300046507 Bacteria 3428
245 Ga0495606_0549621 3300046507 Bacteria 575
246 Ga0495608_0064887 3300046511 Bacteria 2392
247 Ga0495610_0078251 3300046512 Bacteria 1525
248 Ga0495610_0188214 3300046512 Unclassified 853
249 Ga0495610_0215226 3300046512 Bacteria 779
250 Ga0495616_0105062 3300046513 Bacteria 1319
251 Ga0495620_0012241 3300046515 Bacteria 4443
252 Ga0495632_0467001 3300046519 Bacteria 546
253 Ga0495643_0023056 3300046522 Bacteria 3542
254 Ga0495648_0016650 3300046524 Bacteria 5290
255 Ga0495648_0035423 3300046524 Bacteria 3236
256 Ga0495652_0039970 3300046529 Bacteria 4054
257 Ga0495665_0334220 3300046531 Bacteria 773
258 Ga0495640_0130007 3300046533 Bacteria 1630
259 Ga0495587_0085675 3300046536 Bacteria 1824
260 Ga0495609_0200998 3300046538 Bacteria 833
261 Ga0495622_0017931 3300046557 Bacteria 3296
262 Ga0495668_0054334 3300046616 Bacteria 2214
263 Ga0495634_0028288 3300046642 Bacteria 3892
264 Ga0495625_0029535 3300046660 Bacteria 4098
265 Ga0495635_0002322 3300046663 Bacteria 12926
266 Ga0495588_0107796 3300046674 Bacteria 1467
267 Ga0495657_0004282 3300046675 Bacteria 11395
268 Ga0495646_0050743 3300046680 Bacteria 2513
269 Ga0495613_0093220 3300046689 Bacteria 2180
270 Ga0495624_0519700 3300046690 Unclassified 712
271 Ga0495649_0033366 3300046694 Bacteria 2833
272 Ga0495649_0094202 3300046694 Bacteria 1594
273 Ga0495600_0007662 3300046809 Bacteria 6615
274 Ga0495660_0189044 3300046810 Bacteria 991
275 Ga0495581_0028971 3300047315 Bacteria 3211
276 Ga0495604_0172311 3300047317 Bacteria 1520
277 Ga0495672_0221081 3300047320 Bacteria 935
278 Ga0495676_0002485 3300047321 Bacteria 16404
279 Ga0495676_0008762 3300047321 Bacteria 9253
280 Ga0495683_0110173 3300047323 Unclassified 1315
281 Ga0495683_0210665 3300047323 Bacteria 872
282 Ga0495687_011887 3300047443 Bacteria 4648
283 Ga0495673_0210853 3300047469 Bacteria 723
284 Ga0495673_0326640 3300047469 Bacteria 545
285 Ga0495681_0011219 3300047470 Bacteria 5356
286 Ga0495686_0013950 3300047472 Bacteria 5556
287 Ga0495686_0014259 3300047472 Bacteria 5476
288 Ga0495686_0170507 3300047472 Bacteria 1266
289 Ga0495593_0034100 3300047673 Bacteria 2770
290 Ga0495593_0107916 3300047673 Bacteria 1423
291 Ga0495602_0075193 3300048088 Bacteria 2868
292 Ga0495614_0048541 3300048089 Bacteria 1820
293 Ga0495614_0187848 3300048089 Bacteria 931
294 Ga0496100_0119198 3300048903 Bacteria 1844
295 Ga0496101_0076533 3300048904 Bacteria 2465
296 Ga0496102_0354436 3300048905 Bacteria 1381
297 Ga0496103_0025651 3300048906 Bacteria 3564
298 Ga0496103_0744821 3300048906 Bacteria 620
299 Ga0496104_0013526 3300048907 Bacteria 7353
300 Ga0496104_0752340 3300048907 Bacteria 881
301 Ga0496105_0001000 3300048908 Bacteria 19533
302 Ga0496105_0037272 3300048908 Bacteria 4004
303 Ga0496108_0075572 3300048911 Bacteria 2847
304 Ga0496108_0166805 3300048911 Bacteria 1904
305 Ga0496110_0482430 3300048913 Bacteria 1129
306 Ga0496111_0045594 3300048914 Bacteria 3155
307 Ga0496112_0067802 3300048915 Bacteria 3522
308 Ga0496112_0598563 3300048915 Bacteria 1034
309 Ga0496113_0044060 3300048916 Bacteria 3304
310 Ga0496113_0101767 3300048916 Bacteria 2227
311 Ga0496115_0060951 3300048918 Bacteria 3041
312 Ga0496115_0852999 3300048918 Bacteria 705
313 Ga0496118_0092585 3300048921 Bacteria 2074
314 Ga0496118_0131269 3300048921 Bacteria 1608
315 Ga0496119_0001056 3300048922 Bacteria 35138
316 Ga0496119_0008066 3300048922 Bacteria 9345
317 Ga0496119_0038425 3300048922 Bacteria 3093
318 Ga0496119_0150232 3300048922 Bacteria 1249
319 Ga0496120_0000170 3300048923 Bacteria 110378
320 Ga0496120_0044403 3300048923 Bacteria 2582
321 Ga0496121_0029944 3300048924 Bacteria 5014
322 Ga0496121_0157861 3300048924 Bacteria 1662
323 Ga0496121_0164237 3300048924 Bacteria 1620
324 Ga0496121_0204240 3300048924 Bacteria 1405
325 Ga0496121_0750642 3300048924 Bacteria 580
326 Ga0496122_0237123 3300048925 Bacteria 1032
327 Ga0496124_0014900 3300048927 Bacteria 7491
328 Ga0496124_0055707 3300048927 Bacteria 3340
329 Ga0496125_0050855 3300048928 Bacteria 3426
330 Ga0496125_0051080 3300048928 Bacteria 3414
331 Ga0496125_0058938 3300048928 Bacteria 3097
332 Ga0496125_0100760 3300048928 Bacteria 2128
333 Ga0496125_0487250 3300048928 Bacteria 697
334 Ga0496125_0741324 3300048928 Unclassified 516
335 Ga0496126_0007179 3300048929 Bacteria 12262
336 Ga0496126_0289752 3300048929 Bacteria 1354
337 Ga0496126_0608122 3300048929 Bacteria 860
338 Ga0495682_0020840 3300049460 Bacteria 2459
339 Ga0495682_0023121 3300049460 Bacteria 2322
340 nmdc:mga03683_277926_c1 3300050489 Bacteria 782
341 nmdc:mga03683_355811_c1 3300050489 Bacteria 694
342 nmdc:mga03n38_13016_c1 3300050490 Bacteria 3148
343 nmdc:mga00v17_22650_c1 3300050491 Bacteria 3627
344 nmdc:mga00v17_348945_c1 3300050491 Bacteria 962
345 nmdc:mga0yw44_380822_c1 3300050492 Bacteria 953
346 nmdc:mga0yw44_458706_c1 3300050492 Bacteria 864
347 nmdc:mga0k408_200454_c1 3300050493 Bacteria 1191
348 nmdc:mga0k408_366279_c1 3300050493 Bacteria 859
349 nmdc:mga0k408_414_c1 3300050493 Bacteria 23298
350 nmdc:mga0k408_48253_c1 3300050493 Bacteria 2462
351 nmdc:mga0k408_49389_c1 3300050493 Bacteria 2435
352 nmdc:mga06z11_377945_c1 3300050494 Bacteria 851
353 nmdc:mga06z11_402771_c1 3300050494 Bacteria 824
354 nmdc:mga06z11_750141_c1 3300050494 Bacteria 595
355 nmdc:mga06z11_916030_c1 3300050494 Bacteria 534
356 nmdc:mga07m45_430088_c1 3300050496 Bacteria 766
357 nmdc:mga07m45_44423_c1 3300050496 Bacteria 2494
358 nmdc:mga0sz30_19100_c1 3300050516 Bacteria 2173
359 nmdc:mga0sz30_33314_c1 3300050516 Bacteria 2141
360 nmdc:mga0sz30_594644_c1 3300050516 Bacteria 501
361 Ga0500610_0245673 3300053079 Bacteria 829
362 Ga0495619_0227708 3300053085 Bacteria 1291
363 Ga0500578_0009951 3300053086 Bacteria 6170
364 Ga0500578_0193935 3300053086 Bacteria 1246
365 Ga0500643_000018 3300053087 Bacteria 296505
366 Ga0500643_000328 3300053087 Bacteria 38149
367 Ga0500643_001321 3300053087 Bacteria 14552
368 Ga0500646_0049533 3300053090 Bacteria 1208
369 Ga0500647_0207388 3300053091 Bacteria 885
370 Ga0500583_0042294 3300053092 Bacteria 2075
371 Ga0500583_0250301 3300053092 Bacteria 875
372 Ga0500651_0207122 3300053093 Bacteria 1155
373 Ga0500640_186690 3300053095 Bacteria 743
374 Ga0500641_0027821 3300053096 Bacteria 2204
375 Ga0500650_0323298 3300053098 Bacteria 679
376 Ga0500555_021630 3300053103 Bacteria 1852
377 Ga0500556_0116774 3300053104 Bacteria 1038
378 Ga0500557_000019 3300053105 Bacteria 93216
379 Ga0500569_111757 3300053109 Bacteria 904
380 Ga0500572_001006 3300053111 Bacteria 8512
381 Ga0500595_034321 3300053119 Bacteria 1678
382 Ga0500595_036114 3300053119 Bacteria 1622
383 Ga0500597_214905 3300053120 Bacteria 802
384 Ga0500608_006938 3300053122 Bacteria 4652
385 Ga0500618_003502 3300053125 Bacteria 5353
386 Ga0500628_009614 3300053129 Bacteria 1709
387 Ga0500642_0000064 3300053130 Bacteria 58285
388 Ga0500642_0005550 3300053130 Bacteria 4079
389 Ga0500655_000085 3300053133 Bacteria 24719
390 Ga0500655_014819 3300053133 Bacteria 1428
391 Ga0500658_0016048 3300053134 Bacteria 2788
392 Ga0500559_0001342 3300053136 Bacteria 14123
393 Ga0500559_0011985 3300053136 Bacteria 3694
394 Ga0500574_000046 3300053141 Bacteria 14738
395 Ga0500588_0016716 3300053146 Bacteria 1903
396 Ga0500589_179892 3300053147 Bacteria 832
397 Ga0500622_0011980 3300053156 Bacteria 4714
398 Ga0500634_0000866 3300053161 Bacteria 10766
399 Ga0500638_018009 3300053162 Bacteria 3289
400 Ga0500638_110360 3300053162 Bacteria 1271
401 Ga0500639_004522 3300053163 Bacteria 7069
402 Ga0500639_080012 3300053163 Bacteria 1648
403 Ga0500636_0010450 3300053177 Bacteria 5416
404 Ga0500636_0160880 3300053177 Bacteria 1224
405 Ga0500636_0244148 3300053177 Bacteria 920
406 Ga0500637_0440585 3300053178 Bacteria 664
407 Ga0500576_001460 3300053725 Bacteria 7974
408 Ga0500625_012486 3300053729 Bacteria 3883
409 Ga0500596_002703 3300053735 Bacteria 3476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_101374621 Ga0068858_1013746212 126
2 3300028381 Ga0268264_10410656 Ga0268264_104106562 126
3 3300042121 Ga0450919_000024 Ga0450919_000024_9087_9491 134
4 3300042531 Ga0450918_000043 Ga0450918_000043_2886_3290 134
5 3300046538 Ga0495609_0200998 Ga0495609_0200998_361_801 135
6 iso_pu_bacteria 2585428062 2587757063 135
7 iso_pu_bacteria 2922368715 2922377929 135
8 3300009098 Ga0105245_10507066 Ga0105245_105070662 136
9 3300009545 Ga0105237_10723473 Ga0105237_107234731 136
10 3300013297 Ga0157378_12095411 Ga0157378_120954111 136
11 3300025914 Ga0207671_10659740 Ga0207671_106597402 136
12 3300048928 Ga0496125_0741324 Ga0496125_0741324_75_497 137
13 3300005445 Ga0070708_100162149 Ga0070708_1001621492 138
14 3300005467 Ga0070706_100000388 Ga0070706_10000038821 138
15 3300005468 Ga0070707_100071369 Ga0070707_1000713692 138
16 3300005471 Ga0070698_100250786 Ga0070698_1002507861 138
17 3300005518 Ga0070699_100221696 Ga0070699_1002216962 138
18 3300006042 Ga0075368_10469498 Ga0075368_104694982 138
19 3300006178 Ga0075367_10084374 Ga0075367_100843742 138
20 3300006353 Ga0075370_10031513 Ga0075370_100315133 138
21 3300025910 Ga0207684_10001941 Ga0207684_1000194122 138
22 3300050493 nmdc:mga0k408_49389_c1 nmdc:mga0k408_49389_c1_616_1035 138
23 3300050494 nmdc:mga06z11_377945_c1 nmdc:mga06z11_377945_c1_309_728 138
24 iso_pu_bacteria 2511231028 2511395790 138
25 iso_pu_bacteria 2513237095 2513651771 138
26 iso_pu_bacteria 2513237104 2513721998 138
27 iso_pu_bacteria 2513237139 2513879252 138
28 iso_pu_bacteria 2528768022 2528850687 138
29 iso_pu_bacteria 2744054633 2745077759 138
30 iso_pu_bacteria 2791355196 2793065774 138
31 iso_pu_bacteria 2802429603 2805920323 138
32 iso_pu_bacteria 2816332527 2818239323 138
33 iso_pu_bacteria 2824696289 2824702411 138
34 iso_pu_bacteria 2841957949 2841959087 138
35 iso_pu_bacteria 2841957949 2841965690 138
36 iso_pu_bacteria 2842038055 2842041472 138
37 iso_pu_bacteria 2842045827 2842049514 138
38 iso_pu_bacteria 2844315083 2844322655 138
39 iso_pu_bacteria 2847930680 2847939849 138
40 iso_pu_bacteria 2874612657 2874618657 138
41 iso_pu_bacteria 2874628541 2874629246 138
42 iso_pu_bacteria 2876761206 2876769815 138
43 iso_pu_bacteria 2879083081 2879083591 138
44 iso_pu_bacteria 2888378607 2888379044 138
45 iso_pu_bacteria 2888388044 2888390222 138
46 iso_pu_bacteria 2903727486 2903734830 138
47 iso_pu_bacteria 2906602504 2906604859 138
48 iso_pu_bacteria 2906626472 2906634476 138
49 iso_pu_bacteria 2922393267 2922400830 138
50 iso_pu_bacteria 2935684952 2935686866 138
51 iso_pu_bacteria 2935713505 2935716554 138
52 iso_pu_bacteria 2935722832 2935723321 138
53 iso_pu_bacteria 2935732158 2935734877 138
54 iso_pu_bacteria 2935741537 2935744332 138
55 iso_pu_bacteria 2935750917 2935752832 138
56 iso_pu_bacteria 2935760218 2935767920 138
57 iso_pu_bacteria 2935777560 2935779630 138
58 iso_pu_bacteria 2940556831 2940558745 138
59 iso_pu_bacteria 3005594810 3005602751 138
60 iso_pu_bacteria 3005718088 3005725223 138
61 iso_pu_bacteria 8016603502 8016606985 138
62 iso_pu_bacteria 8016613128 8016618892 138
63 iso_pu_bacteria 8019538911 8019540974 138
64 iso_pu_bacteria 8056967851 8056976686 138
65 3300025256 Ga0209759_1000948 Ga0209759_100094814 139
66 3300046512 Ga0495610_0188214 Ga0495610_0188214_208_630 139
67 3300047323 Ga0495683_0110173 Ga0495683_0110173_844_1266 139
68 iso_pu_bacteria 2824679649 2824683625 139
69 iso_pu_bacteria 2824704595 2824708013 139
70 iso_pu_bacteria 2824753945 2824758388 139
71 iso_pu_bacteria 2824763712 2824768910 139
72 iso_pu_bacteria 2904711408 2904716073 139
73 3300003791 Ga0055530_10001494 Ga0055530_100014947 140
74 3300003792 Ga0055540_1000045 Ga0055540_100004598 140
75 3300003794 Ga0055531_10000062 Ga0055531_1000006212 140
76 3300006178 Ga0075367_10916188 Ga0075367_109161882 140
77 3300006195 Ga0075366_10000186 Ga0075366_1000018616 140
78 3300006948 Ga0099826_10035115 Ga0099826_100351157 140
79 3300009094 Ga0111539_11272305 Ga0111539_112723052 140
80 3300025292 Ga0209676_1000135 Ga0209676_100013561 140
81 3300025298 Ga0209050_1000100 Ga0209050_1000100123 140
82 3300025303 Ga0209051_1000067 Ga0209051_1000067104 140
83 3300025304 Ga0209257_1000095 Ga0209257_1000095137 140
84 3300046690 Ga0495624_0519700 Ga0495624_0519700_158_583 140
85 3300047321 Ga0495676_0002485 Ga0495676_0002485_5382_5807 140
86 3300047673 Ga0495593_0034100 Ga0495593_0034100_1188_1613 140
87 3300048089 Ga0495614_0048541 Ga0495614_0048541_366_791 140
88 3300048929 Ga0496126_0289752 Ga0496126_0289752_186_608 140
89 3300050489 nmdc:mga03683_355811_c1 nmdc:mga03683_355811_c1_254_679 140
90 3300050493 nmdc:mga0k408_414_c1 nmdc:mga0k408_414_c1_14290_14715 140
91 3300050494 nmdc:mga06z11_750141_c1 nmdc:mga06z11_750141_c1_18_443 140
92 3300053087 Ga0500643_001321 Ga0500643_001321_4140_4565 140
93 3300053133 Ga0500655_000085 Ga0500655_000085_7318_7743 140
94 3300053141 Ga0500574_000046 Ga0500574_000046_8718_9143 140
95 3300053161 Ga0500634_0000866 Ga0500634_0000866_2749_3174 140
96 3300053162 Ga0500638_018009 Ga0500638_018009_947_1372 140
97 3300006195 Ga0075366_10632949 Ga0075366_106329492 141
98 3300028556 Ga0265337_1035196 Ga0265337_10351962 141
99 3300028563 Ga0265319_1025028 Ga0265319_10250283 141
100 3300028573 Ga0265334_10002358 Ga0265334_1000235810 141
101 3300028653 Ga0265323_10000434 Ga0265323_1000043419 141
102 3300028654 Ga0265322_10023692 Ga0265322_100236922 141
103 3300028666 Ga0265336_10000649 Ga0265336_1000064912 141
104 3300028800 Ga0265338_10000280 Ga0265338_1000028045 141
105 3300029957 Ga0265324_10010204 Ga0265324_100102043 141
106 3300030522 Ga0307512_10025046 Ga0307512_100250462 141
107 3300031456 Ga0307513_10803842 Ga0307513_108038421 141
108 3300031730 Ga0307516_10023804 Ga0307516_100238048 141
109 3300033179 Ga0307507_10211764 Ga0307507_102117642 141
110 3300033180 Ga0307510_10037765 Ga0307510_100377654 141
111 3300039437 Ga0436365_0057994 Ga0436365_0057994_1743_2168 141
112 3300041443 Ga0451789_0436694 Ga0451789_0436694_108_536 141
113 3300041451 Ga0451791_1011064 Ga0451791_1011064_707_1135 141
114 3300041452 Ga0451793_1873426 Ga0451793_1873426_494_922 141
115 3300041459 Ga0451800_0578289 Ga0451800_0578289_1064_1492 141
116 3300041460 Ga0451802_1037132 Ga0451802_1037132_736_1164 141
117 3300041463 Ga0451804_0039962 Ga0451804_0039962_50_478 141
118 3300041491 Ga0451833_1128143 Ga0451833_1128143_811_1239 141
119 3300041496 Ga0451839_0854493 Ga0451839_0854493_381_809 141
120 3300041505 Ga0451849_1366188 Ga0451849_1366188_10_438 141
121 3300041511 Ga0451855_1449691 Ga0451855_1449691_40_468 141
122 3300044684 Ga0466966_0005799 Ga0466966_0005799_1654_2124 141
123 3300044693 Ga0466961_0004929 Ga0466961_0004929_1604_2074 141
124 3300044706 Ga0466964_0002600 Ga0466964_0002600_4331_4801 141
125 3300044765 Ga0466970_0007978 Ga0466970_0007978_1534_2004 141
126 3300044842 Ga0466957_0004206 Ga0466957_0004206_1667_2137 141
127 3300045049 Ga0466959_0016490 Ga0466959_0016490_1528_1998 141
128 3300045051 Ga0451576_0250380 Ga0451576_0250380_1227_1658 141
129 3300045836 Ga0466958_0009631 Ga0466958_0009631_1523_1993 141
130 3300046492 Ga0495585_0073633 Ga0495585_0073633_698_1141 141
131 3300046512 Ga0495610_0215226 Ga0495610_0215226_27_455 141
132 3300046515 Ga0495620_0012241 Ga0495620_0012241_1015_1458 141
133 3300046519 Ga0495632_0467001 Ga0495632_0467001_97_525 141
134 3300046524 Ga0495648_0016650 Ga0495648_0016650_3020_3463 141
135 3300047320 Ga0495672_0221081 Ga0495672_0221081_264_710 141
136 3300047470 Ga0495681_0011219 Ga0495681_0011219_1875_2318 141
137 3300047472 Ga0495686_0013950 Ga0495686_0013950_2107_2550 141
138 3300053086 Ga0500578_0009951 Ga0500578_0009951_2989_3432 141
139 3300053087 Ga0500643_000018 Ga0500643_000018_121971_122411 141
140 3300053111 Ga0500572_001006 Ga0500572_001006_4809_5234 141
141 3300053122 Ga0500608_006938 Ga0500608_006938_1814_2257 141
142 3300053125 Ga0500618_003502 Ga0500618_003502_1875_2318 141
143 3300053129 Ga0500628_009614 Ga0500628_009614_836_1327 141
144 3300053136 Ga0500559_0001342 Ga0500559_0001342_9283_9708 141
145 3300053163 Ga0500639_004522 Ga0500639_004522_1811_2236 141
146 3300053177 Ga0500636_0010450 Ga0500636_0010450_3021_3464 141
147 3300053725 Ga0500576_001460 Ga0500576_001460_3266_3691 141
148 3300053735 Ga0500596_002703 Ga0500596_002703_1344_1769 141
149 3300003214 JGI25165J46597_1004376 JGI25165J46597_10043763 142
150 3300003215 JGI25153J46596_10006379 JGI25153J46596_100063796 142
151 3300003215 JGI25153J46596_10010200 JGI25153J46596_100102004 142
152 3300003215 JGI25153J46596_10043969 JGI25153J46596_100439692 142
153 3300003215 JGI25153J46596_10133236 JGI25153J46596_101332361 142
154 3300003215 JGI25153J46596_10135114 JGI25153J46596_101351141 142
155 3300003215 JGI25153J46596_10135296 JGI25153J46596_101352961 142
156 3300003316 rootH1_10079211 rootH1_100792113 142
157 3300003322 rootL2_10206084 rootL2_102060842 142
158 3300003323 rootH1_10266041 rootH1_102660412 142
159 3300003354 JGI25160J50197_1000955 JGI25160J50197_10009555 142
160 3300003354 JGI25160J50197_1004203 JGI25160J50197_10042034 142
161 3300003752 Ga0055539_1004109 Ga0055539_10041092 142
162 3300003759 Ga0055525_1007230 Ga0055525_10072301 142
163 3300003771 Ga0055526_1017424 Ga0055526_10174243 142
164 3300003794 Ga0055531_10111547 Ga0055531_101115471 142
165 3300004625 Ga0055543_1002750 Ga0055543_10027503 142
166 3300005262 Ga0065165_1001735 Ga0065165_10017352 142
167 3300005262 Ga0065165_1125971 Ga0065165_11259711 142
168 3300005331 Ga0070670_100325846 Ga0070670_1003258461 142
169 3300005335 Ga0070666_10756895 Ga0070666_107568951 142
170 3300005338 Ga0068868_100578464 Ga0068868_1005784642 142
171 3300005353 Ga0070669_100672694 Ga0070669_1006726942 142
172 3300005354 Ga0070675_101170147 Ga0070675_1011701471 142
173 3300005355 Ga0070671_100036131 Ga0070671_1000361313 142
174 3300005356 Ga0070674_101246827 Ga0070674_1012468272 142
175 3300005366 Ga0070659_100848940 Ga0070659_1008489401 142
176 3300005455 Ga0070663_100038725 Ga0070663_1000387254 142
177 3300005456 Ga0070678_100957887 Ga0070678_1009578872 142
178 3300005457 Ga0070662_100425094 Ga0070662_1004250941 142
179 3300005457 Ga0070662_100674444 Ga0070662_1006744442 142
180 3300005459 Ga0068867_101379108 Ga0068867_1013791081 142
181 3300005543 Ga0070672_100668081 Ga0070672_1006680812 142
182 3300005548 Ga0070665_100117210 Ga0070665_1001172104 142
183 3300005548 Ga0070665_100790730 Ga0070665_1007907302 142
184 3300005548 Ga0070665_100997854 Ga0070665_1009978542 142
185 3300005548 Ga0070665_101247892 Ga0070665_1012478921 142
186 3300005563 Ga0068855_102012535 Ga0068855_1020125351 142
187 3300005578 Ga0068854_100070508 Ga0068854_1000705083 142
188 3300005614 Ga0068856_100047652 Ga0068856_1000476521 142
189 3300005616 Ga0068852_100009329 Ga0068852_1000093291 142
190 3300005617 Ga0068859_101163199 Ga0068859_1011631992 142
191 3300005719 Ga0068861_100027756 Ga0068861_1000277563 142
192 3300005843 Ga0068860_100001474 Ga0068860_10000147411 142
193 3300005844 Ga0068862_100013475 Ga0068862_1000134757 142
194 3300005844 Ga0068862_101520333 Ga0068862_1015203332 142
195 3300006038 Ga0075365_10101796 Ga0075365_101017961 142
196 3300006038 Ga0075365_10299336 Ga0075365_102993361 142
197 3300006048 Ga0075363_100188342 Ga0075363_1001883421 142
198 3300006051 Ga0075364_10018240 Ga0075364_100182405 142
199 3300006051 Ga0075364_10321519 Ga0075364_103215192 142
200 3300006177 Ga0075362_10185990 Ga0075362_101859902 142
201 3300006178 Ga0075367_10051839 Ga0075367_100518394 142
202 3300006178 Ga0075367_11041699 Ga0075367_110416991 142
203 3300006186 Ga0075369_10036333 Ga0075369_100363333 142
204 3300006186 Ga0075369_10230373 Ga0075369_102303732 142
205 3300006195 Ga0075366_10032521 Ga0075366_100325215 142
206 3300006195 Ga0075366_10052968 Ga0075366_100529682 142
207 3300006195 Ga0075366_10103111 Ga0075366_101031113 142
208 3300006353 Ga0075370_10104511 Ga0075370_101045113 142
209 3300006931 Ga0097620_101163307 Ga0097620_1011633072 142
210 3300006941 Ga0099825_1028597 Ga0099825_10285972 142
211 3300006944 Ga0099823_1047852 Ga0099823_10478524 142
212 3300009093 Ga0105240_11003110 Ga0105240_110031102 142
213 3300009093 Ga0105240_11280324 Ga0105240_112803242 142
214 3300009098 Ga0105245_10018634 Ga0105245_100186345 142
215 3300009101 Ga0105247_10032496 Ga0105247_100324962 142
216 3300009101 Ga0105247_10093571 Ga0105247_100935713 142
217 3300009148 Ga0105243_10044514 Ga0105243_100445143 142
218 3300009174 Ga0105241_10003792 Ga0105241_100037922 142
219 3300009174 Ga0105241_10037000 Ga0105241_100370005 142
220 3300009177 Ga0105248_10195947 Ga0105248_101959473 142
221 3300009545 Ga0105237_10012663 Ga0105237_100126637 142
222 3300009545 Ga0105237_10079948 Ga0105237_100799481 142
223 3300009551 Ga0105238_10018315 Ga0105238_100183157 142
224 3300009551 Ga0105238_10060577 Ga0105238_100605775 142
225 3300009553 Ga0105249_10033865 Ga0105249_100338658 142
226 3300010375 Ga0105239_10128431 Ga0105239_101284313 142
227 3300010375 Ga0105239_10224913 Ga0105239_102249133 142
228 3300010375 Ga0105239_10484497 Ga0105239_104844972 142
229 3300010375 Ga0105239_10657408 Ga0105239_106574082 142
230 3300010375 Ga0105239_10769509 Ga0105239_107695092 142
231 3300011119 Ga0105246_10020604 Ga0105246_100206045 142
232 3300012503 Ga0157313_1015678 Ga0157313_10156782 142
233 3300013296 Ga0157374_10026771 Ga0157374_100267718 142
234 3300013306 Ga0163162_10497338 Ga0163162_104973382 142
235 3300014325 Ga0163163_10039967 Ga0163163_100399673 142
236 3300014968 Ga0157379_10160315 Ga0157379_101603154 142
237 3300014969 Ga0157376_10245640 Ga0157376_102456403 142
238 3300015262 Ga0182007_10096150 Ga0182007_100961502 142
239 3300025230 Ga0209563_102487 Ga0209563_1024873 142
240 3300025253 Ga0209677_100366 Ga0209677_10036610 142
241 3300025254 Ga0209148_1000469 Ga0209148_100046929 142
242 3300025261 Ga0209233_1012967 Ga0209233_10129672 142
243 3300025272 Ga0209455_1005428 Ga0209455_10054283 142
244 3300025272 Ga0209455_1005690 Ga0209455_10056903 142
245 3300025295 Ga0209564_1007974 Ga0209564_10079743 142
246 3300025297 Ga0209758_1001668 Ga0209758_100166824 142
247 3300025297 Ga0209758_1015906 Ga0209758_10159062 142
248 3300025297 Ga0209758_1027283 Ga0209758_10272833 142
249 3300025297 Ga0209758_1028200 Ga0209758_10282003 142
250 3300025297 Ga0209758_1048249 Ga0209758_10482492 142
251 3300025297 Ga0209758_1078232 Ga0209758_10782322 142
252 3300025297 Ga0209758_1127625 Ga0209758_11276252 142
253 3300025299 Ga0209256_1016850 Ga0209256_10168501 142
254 3300025302 Ga0207426_1000347 Ga0207426_100034715 142
255 3300025302 Ga0207426_1026583 Ga0207426_10265832 142
256 3300025302 Ga0207426_1085785 Ga0207426_10857852 142
257 3300025304 Ga0209257_1004512 Ga0209257_10045123 142
258 3300025304 Ga0209257_1047379 Ga0209257_10473791 142
259 3300025900 Ga0207710_10296745 Ga0207710_102967452 142
260 3300025901 Ga0207688_10195899 Ga0207688_101958991 142
261 3300025904 Ga0207647_10001188 Ga0207647_1000118814 142
262 3300025904 Ga0207647_10171933 Ga0207647_101719332 142
263 3300025911 Ga0207654_10043172 Ga0207654_100431722 142
264 3300025911 Ga0207654_10086622 Ga0207654_100866224 142
265 3300025913 Ga0207695_10000006 Ga0207695_100000065 142
266 3300025913 Ga0207695_11226208 Ga0207695_112262081 142
267 3300025914 Ga0207671_10064833 Ga0207671_100648333 142
268 3300025914 Ga0207671_10142395 Ga0207671_101423952 142
269 3300025920 Ga0207649_11563113 Ga0207649_115631131 142
270 3300025924 Ga0207694_10030985 Ga0207694_100309855 142
271 3300025926 Ga0207659_10378077 Ga0207659_103780772 142
272 3300025927 Ga0207687_10309031 Ga0207687_103090312 142
273 3300025932 Ga0207690_10449262 Ga0207690_104492622 142
274 3300025933 Ga0207706_10329286 Ga0207706_103292862 142
275 3300025933 Ga0207706_11064747 Ga0207706_110647472 142
276 3300025935 Ga0207709_10236989 Ga0207709_102369891 142
277 3300025949 Ga0207667_12140083 Ga0207667_121400831 142
278 3300025961 Ga0207712_10045365 Ga0207712_100453652 142
279 3300025972 Ga0207668_11334965 Ga0207668_113349652 142
280 3300025981 Ga0207640_10347080 Ga0207640_103470802 142
281 3300025986 Ga0207658_10745305 Ga0207658_107453052 142
282 3300026023 Ga0207677_10266785 Ga0207677_102667853 142
283 3300026035 Ga0207703_10440577 Ga0207703_104405772 142
284 3300026041 Ga0207639_10073398 Ga0207639_100733982 142
285 3300026041 Ga0207639_10091930 Ga0207639_100919302 142
286 3300026067 Ga0207678_10034820 Ga0207678_100348204 142
287 3300026078 Ga0207702_10068619 Ga0207702_100686192 142
288 3300026118 Ga0207675_100062483 Ga0207675_1000624833 142
289 3300026142 Ga0207698_10165887 Ga0207698_101658873 142
290 3300027296 Ga0209389_1000015 Ga0209389_100001544 142
291 3300027361 Ga0209489_100072 Ga0209489_1000725 142
292 3300027363 Ga0209700_100034 Ga0209700_100034139 142
293 3300028379 Ga0268266_10025618 Ga0268266_100256184 142
294 3300028379 Ga0268266_10182439 Ga0268266_101824392 142
295 3300028379 Ga0268266_10580107 Ga0268266_105801072 142
296 3300028379 Ga0268266_11271463 Ga0268266_112714631 142
297 3300028380 Ga0268265_10312994 Ga0268265_103129942 142
298 3300028381 Ga0268264_10000119 Ga0268264_1000011958 142
299 3300031616 Ga0307508_10612604 Ga0307508_106126042 142
300 3300031730 Ga0307516_10009299 Ga0307516_100092995 142
301 3300033179 Ga0307507_10488108 Ga0307507_104881082 142
302 3300033180 Ga0307510_10007078 Ga0307510_100070785 142
303 3300033180 Ga0307510_10328094 Ga0307510_103280941 142
304 3300033180 Ga0307510_10431116 Ga0307510_104311162 142
305 3300037418 Ga0395900_1546509 Ga0395900_1546509_57_485 142
306 3300037853 Ga0436364_0914149 Ga0436364_0914149_514_942 142
307 3300039437 Ga0436365_1646390 Ga0436365_1646390_74_535 142
308 3300039447 Ga0436361_0644153 Ga0436361_0644153_778_1206 142
309 3300039447 Ga0436361_0870621 Ga0436361_0870621_487_918 142
310 3300039447 Ga0436361_0966806 Ga0436361_0966806_303_731 142
311 3300041456 Ga0451795_1305124 Ga0451795_1305124_131_559 142
312 3300042005 Ga0439448_0114339 Ga0439448_0114339_243_671 142
313 3300044656 Ga0466969_0010417 Ga0466969_0010417_112_600 142
314 3300044658 Ga0466972_0018293 Ga0466972_0018293_1583_2011 142
315 3300044658 Ga0466972_0042011 Ga0466972_0042011_556_984 142
316 3300044684 Ga0466966_0000384 Ga0466966_0000384_20958_21446 142
317 3300044693 Ga0466961_0000018 Ga0466961_0000018_91883_92371 142
318 3300044901 Ga0466960_0059765 Ga0466960_0059765_138_566 142
319 3300045049 Ga0466959_0920987 Ga0466959_0920987_35_463 142
320 3300046454 Ga0495592_0090183 Ga0495592_0090183_712_1173 142
321 3300046459 Ga0495629_0002395 Ga0495629_0002395_13335_13796 142
322 3300046462 Ga0495651_0030158 Ga0495651_0030158_416_877 142
323 3300046463 Ga0495653_0085681 Ga0495653_0085681_935_1396 142
324 3300046471 Ga0495650_0263707 Ga0495650_0263707_43_504 142
325 3300046475 Ga0495639_0067451 Ga0495639_0067451_1068_1529 142
326 3300046476 Ga0495662_0339929 Ga0495662_0339929_37_498 142
327 3300046499 Ga0495594_0562502 Ga0495594_0562502_69_530 142
328 3300046506 Ga0495583_0052130 Ga0495583_0052130_56_484 142
329 3300046507 Ga0495606_0035165 Ga0495606_0035165_1402_1830 142
330 3300046507 Ga0495606_0549621 Ga0495606_0549621_55_483 142
331 3300046511 Ga0495608_0064887 Ga0495608_0064887_930_1391 142
332 3300046512 Ga0495610_0078251 Ga0495610_0078251_935_1414 142
333 3300046513 Ga0495616_0105062 Ga0495616_0105062_476_904 142
334 3300046522 Ga0495643_0023056 Ga0495643_0023056_371_799 142
335 3300046524 Ga0495648_0035423 Ga0495648_0035423_1452_1880 142
336 3300046529 Ga0495652_0039970 Ga0495652_0039970_2165_2626 142
337 3300046531 Ga0495665_0334220 Ga0495665_0334220_291_752 142
338 3300046533 Ga0495640_0130007 Ga0495640_0130007_22_483 142
339 3300046536 Ga0495587_0085675 Ga0495587_0085675_1042_1503 142
340 3300046557 Ga0495622_0017931 Ga0495622_0017931_530_991 142
341 3300046616 Ga0495668_0054334 Ga0495668_0054334_1483_1911 142
342 3300046642 Ga0495634_0028288 Ga0495634_0028288_1123_1584 142
343 3300046660 Ga0495625_0029535 Ga0495625_0029535_3126_3554 142
344 3300046663 Ga0495635_0002322 Ga0495635_0002322_7836_8297 142
345 3300046674 Ga0495588_0107796 Ga0495588_0107796_547_1008 142
346 3300046675 Ga0495657_0004282 Ga0495657_0004282_6612_7073 142
347 3300046680 Ga0495646_0050743 Ga0495646_0050743_1199_1660 142
348 3300046689 Ga0495613_0093220 Ga0495613_0093220_62_523 142
349 3300046694 Ga0495649_0033366 Ga0495649_0033366_2018_2446 142
350 3300046694 Ga0495649_0094202 Ga0495649_0094202_723_1202 142
351 3300046809 Ga0495600_0007662 Ga0495600_0007662_2585_3046 142
352 3300046810 Ga0495660_0189044 Ga0495660_0189044_196_675 142
353 3300047315 Ga0495581_0028971 Ga0495581_0028971_1782_2243 142
354 3300047317 Ga0495604_0172311 Ga0495604_0172311_558_1019 142
355 3300047321 Ga0495676_0008762 Ga0495676_0008762_6842_7303 142
356 3300047323 Ga0495683_0210665 Ga0495683_0210665_231_659 142
357 3300047443 Ga0495687_011887 Ga0495687_011887_803_1231 142
358 3300047469 Ga0495673_0210853 Ga0495673_0210853_182_610 142
359 3300047469 Ga0495673_0326640 Ga0495673_0326640_87_515 142
360 3300047472 Ga0495686_0014259 Ga0495686_0014259_207_635 142
361 3300047472 Ga0495686_0170507 Ga0495686_0170507_735_1163 142
362 3300047673 Ga0495593_0107916 Ga0495593_0107916_654_1115 142
363 3300048088 Ga0495602_0075193 Ga0495602_0075193_828_1289 142
364 3300048089 Ga0495614_0187848 Ga0495614_0187848_207_668 142
365 3300048903 Ga0496100_0119198 Ga0496100_0119198_922_1383 142
366 3300048904 Ga0496101_0076533 Ga0496101_0076533_779_1240 142
367 3300048905 Ga0496102_0354436 Ga0496102_0354436_271_699 142
368 3300048906 Ga0496103_0025651 Ga0496103_0025651_1276_1704 142
369 3300048906 Ga0496103_0744821 Ga0496103_0744821_113_574 142
370 3300048907 Ga0496104_0013526 Ga0496104_0013526_6814_7275 142
371 3300048907 Ga0496104_0752340 Ga0496104_0752340_139_567 142
372 3300048908 Ga0496105_0001000 Ga0496105_0001000_6888_7349 142
373 3300048908 Ga0496105_0037272 Ga0496105_0037272_179_607 142
374 3300048911 Ga0496108_0075572 Ga0496108_0075572_278_706 142
375 3300048911 Ga0496108_0166805 Ga0496108_0166805_249_677 142
376 3300048913 Ga0496110_0482430 Ga0496110_0482430_397_825 142
377 3300048914 Ga0496111_0045594 Ga0496111_0045594_837_1265 142
378 3300048915 Ga0496112_0067802 Ga0496112_0067802_2778_3206 142
379 3300048915 Ga0496112_0598563 Ga0496112_0598563_375_803 142
380 3300048916 Ga0496113_0044060 Ga0496113_0044060_2424_2852 142
381 3300048916 Ga0496113_0101767 Ga0496113_0101767_256_717 142
382 3300048918 Ga0496115_0060951 Ga0496115_0060951_1449_1910 142
383 3300048918 Ga0496115_0852999 Ga0496115_0852999_177_605 142
384 3300048921 Ga0496118_0092585 Ga0496118_0092585_539_967 142
385 3300048921 Ga0496118_0131269 Ga0496118_0131269_486_914 142
386 3300048922 Ga0496119_0001056 Ga0496119_0001056_6535_6963 142
387 3300048922 Ga0496119_0008066 Ga0496119_0008066_5796_6257 142
388 3300048922 Ga0496119_0038425 Ga0496119_0038425_2205_2666 142
389 3300048922 Ga0496119_0150232 Ga0496119_0150232_172_660 142
390 3300048923 Ga0496120_0000170 Ga0496120_0000170_28233_28661 142
391 3300048923 Ga0496120_0044403 Ga0496120_0044403_1207_1668 142
392 3300048924 Ga0496121_0029944 Ga0496121_0029944_1249_1677 142
393 3300048924 Ga0496121_0157861 Ga0496121_0157861_77_538 142
394 3300048924 Ga0496121_0164237 Ga0496121_0164237_587_1015 142
395 3300048924 Ga0496121_0204240 Ga0496121_0204240_170_598 142
396 3300048924 Ga0496121_0750642 Ga0496121_0750642_129_557 142
397 3300048925 Ga0496122_0237123 Ga0496122_0237123_71_532 142
398 3300048927 Ga0496124_0014900 Ga0496124_0014900_1941_2369 142
399 3300048927 Ga0496124_0055707 Ga0496124_0055707_1349_1810 142
400 3300048928 Ga0496125_0050855 Ga0496125_0050855_2177_2638 142
401 3300048928 Ga0496125_0051080 Ga0496125_0051080_664_1092 142
402 3300048928 Ga0496125_0058938 Ga0496125_0058938_2482_2910 142
403 3300048928 Ga0496125_0100760 Ga0496125_0100760_1306_1734 142
404 3300048928 Ga0496125_0487250 Ga0496125_0487250_169_597 142
405 3300048929 Ga0496126_0007179 Ga0496126_0007179_8532_8993 142
406 3300048929 Ga0496126_0608122 Ga0496126_0608122_273_758 142
407 3300049460 Ga0495682_0020840 Ga0495682_0020840_27_455 142
408 3300049460 Ga0495682_0023121 Ga0495682_0023121_1680_2108 142
409 3300050489 nmdc:mga03683_277926_c1 nmdc:mga03683_277926_c1_330_758 142
410 3300050490 nmdc:mga03n38_13016_c1 nmdc:mga03n38_13016_c1_2322_2750 142
411 3300050491 nmdc:mga00v17_22650_c1 nmdc:mga00v17_22650_c1_2968_3396 142
412 3300050491 nmdc:mga00v17_348945_c1 nmdc:mga00v17_348945_c1_157_618 142
413 3300050492 nmdc:mga0yw44_380822_c1 nmdc:mga0yw44_380822_c1_473_934 142
414 3300050492 nmdc:mga0yw44_458706_c1 nmdc:mga0yw44_458706_c1_216_644 142
415 3300050493 nmdc:mga0k408_200454_c1 nmdc:mga0k408_200454_c1_651_1079 142
416 3300050493 nmdc:mga0k408_366279_c1 nmdc:mga0k408_366279_c1_151_579 142
417 3300050493 nmdc:mga0k408_48253_c1 nmdc:mga0k408_48253_c1_1002_1463 142
418 3300050494 nmdc:mga06z11_402771_c1 nmdc:mga06z11_402771_c1_176_604 142
419 3300050494 nmdc:mga06z11_916030_c1 nmdc:mga06z11_916030_c1_26_454 142
420 3300050496 nmdc:mga07m45_430088_c1 nmdc:mga07m45_430088_c1_307_735 142
421 3300050496 nmdc:mga07m45_44423_c1 nmdc:mga07m45_44423_c1_1159_1620 142
422 3300050516 nmdc:mga0sz30_19100_c1 nmdc:mga0sz30_19100_c1_1553_1981 142
423 3300050516 nmdc:mga0sz30_33314_c1 nmdc:mga0sz30_33314_c1_32_460 142
424 3300050516 nmdc:mga0sz30_594644_c1 nmdc:mga0sz30_594644_c1_42_470 142
425 3300053079 Ga0500610_0245673 Ga0500610_0245673_49_477 142
426 3300053085 Ga0495619_0227708 Ga0495619_0227708_68_529 142
427 3300053086 Ga0500578_0193935 Ga0500578_0193935_246_674 142
428 3300053087 Ga0500643_000328 Ga0500643_000328_11622_12050 142
429 3300053090 Ga0500646_0049533 Ga0500646_0049533_33_512 142
430 3300053091 Ga0500647_0207388 Ga0500647_0207388_86_547 142
431 3300053092 Ga0500583_0042294 Ga0500583_0042294_1384_1812 142
432 3300053092 Ga0500583_0250301 Ga0500583_0250301_344_772 142
433 3300053093 Ga0500651_0207122 Ga0500651_0207122_159_587 142
434 3300053095 Ga0500640_186690 Ga0500640_186690_112_540 142
435 3300053096 Ga0500641_0027821 Ga0500641_0027821_1303_1731 142
436 3300053098 Ga0500650_0323298 Ga0500650_0323298_204_665 142
437 3300053103 Ga0500555_021630 Ga0500555_021630_1021_1449 142
438 3300053104 Ga0500556_0116774 Ga0500556_0116774_354_833 142
439 3300053105 Ga0500557_000019 Ga0500557_000019_16668_17129 142
440 3300053109 Ga0500569_111757 Ga0500569_111757_293_721 142
441 3300053119 Ga0500595_034321 Ga0500595_034321_789_1274 142
442 3300053119 Ga0500595_036114 Ga0500595_036114_846_1274 142
443 3300053120 Ga0500597_214905 Ga0500597_214905_156_617 142
444 3300053130 Ga0500642_0000064 Ga0500642_0000064_20633_21094 142
445 3300053130 Ga0500642_0005550 Ga0500642_0005550_1075_1503 142
446 3300053133 Ga0500655_014819 Ga0500655_014819_629_1108 142
447 3300053134 Ga0500658_0016048 Ga0500658_0016048_662_1090 142
448 3300053136 Ga0500559_0011985 Ga0500559_0011985_2172_2633 142
449 3300053146 Ga0500588_0016716 Ga0500588_0016716_719_1180 142
450 3300053147 Ga0500589_179892 Ga0500589_179892_80_508 142
451 3300053156 Ga0500622_0011980 Ga0500622_0011980_2258_2737 142
452 3300053162 Ga0500638_110360 Ga0500638_110360_34_522 142
453 3300053163 Ga0500639_080012 Ga0500639_080012_502_963 142
454 3300053177 Ga0500636_0160880 Ga0500636_0160880_556_1044 142
455 3300053177 Ga0500636_0244148 Ga0500636_0244148_343_771 142
456 3300053178 Ga0500637_0440585 Ga0500637_0440585_43_504 142
457 3300053729 Ga0500625_012486 Ga0500625_012486_2614_3075 142
458 iso_pu_bacteria 2508501042 2508695950 142
459 iso_pu_bacteria 2517093001 2517106551 142
460 iso_pu_bacteria 2935648319 2935649133 142
461 iso_pu_bacteria 2935656913 2935658095 142
462 iso_pu_bacteria 2935984226 2935985417 142
463 iso_pu_bacteria 2936011229 2936012314 142
464 iso_pu_bacteria 2936019824 2936020605 142
465 iso_pu_bacteria 2936028420 2936029607 142
466 iso_pu_bacteria 2936046547 2936051928 142
467 iso_pu_bacteria 2936055302 2936056815 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13564

DoxX_2

DoxX-like family

26

126

0.94

PF07681

DoxX

DoxX

23

105

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p06-assembly1.cif.gz_B-2 crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304 0.5855 61 133
5uhq-assembly1.cif.gz_A structure of a semisweet q20a mutant 0.5608 56 135
4x5m-assembly2.cif.gz_B crystal structure of semisweet in the inward-open conformation 0.5436 14 128
5tcx-assembly1.cif.gz_A crystal structure of human tetraspanin cd81 0.5162 20 124
8e0m-assembly1.cif.gz_A homotrimeric variant of tctrp9, bgl15 0.4934 20 129
ID Description Score Start End Superfamily
af_Q2FUU3_358_449_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8825 88 129 1.10.287.1080
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8254 17 134 1.10.10.1740
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8066 17 134 1.10.10.1740
af_P75685_2_182_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7463 13 134 1.20.120.550
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7386 17 134 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A0Q4TYF8-F1-model_v4 deleted 1.002 13 141
AF-A0A547AGW7-F1-model_v4 DoxX family protein 0.9918 8 141 GO:0016020
AF-Q89Y33-F1-model_v4 Blr0122 protein 0.9874 1 142 GO:0016020
AF-A0A2W5SX17-F1-model_v4 DoxX family protein 0.9862 12 133 GO:0016020
AF-A0A4R8DVY1-F1-model_v4 DoxX-like protein 0.9828 16 133 GO:0016020

Feature Viewer

pLDDT pTM Quality
94.07 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map