F449895

General Info

Members Datasets Scaffolds Average Seq Length
467 249 467 190

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0383962|Ga0495582_0383962_203_772
Length 189
Sequence VRFGASAPVDWLVVGLGNPGPSYEHSPHNVGFLVARELLRRWDLGKPKKKFAGELAEGRAGVVGGPRVAVLQPQTFMNESGRSVGPARGAYKLDLDRILVLHDEIDLPFGDVRSRLGGGLAGHNGLKSLKRDLGSPDFHRVRVGVGRPDSTDPEIVAAYVLGTWRQSKADVADLVSRAADEAERVLAAS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
245 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 15.2
Rhizosphere 79.44
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000014 3300001977 Bacteria 16789
2 JGI24034J26672_10000084 3300002239 Bacteria 18659
3 JGI24742J22300_10003839 3300002244 Bacteria 2443
4 Ga0070658_10135455 3300005327 Unclassified 2055
5 Ga0070658_10431601 3300005327 Bacteria 1134
6 Ga0070676_10083870 3300005328 Bacteria 1939
7 Ga0070683_100033499 3300005329 Bacteria 4684
8 Ga0070683_100203492 3300005329 Bacteria 1880
9 Ga0070683_100246658 3300005329 Bacteria 1699
10 Ga0070670_100457039 3300005331 Bacteria 1132
11 Ga0068869_100052790 3300005334 Bacteria 2953
12 Ga0070666_10017109 3300005335 Bacteria 4646
13 Ga0070666_10098263 3300005335 Bacteria 2016
14 Ga0070680_100950612 3300005336 Bacteria 742
15 Ga0070682_100015792 3300005337 Bacteria 4382
16 Ga0070682_100026035 3300005337 Bacteria 3496
17 Ga0068868_100033641 3300005338 Bacteria 3952
18 Ga0068868_100177412 3300005338 Bacteria 1766
19 Ga0068868_100883106 3300005338 Bacteria 811
20 Ga0070689_100014689 3300005340 Bacteria 5694
21 Ga0070689_100226808 3300005340 Unclassified 1534
22 Ga0070691_10187394 3300005341 Bacteria 1080
23 Ga0070687_100096434 3300005343 Bacteria 1646
24 Ga0070668_100211491 3300005347 Bacteria 1596
25 Ga0070675_100505517 3300005354 Unclassified 1089
26 Ga0070671_100111880 3300005355 Bacteria 2294
27 Ga0070674_100107566 3300005356 Unclassified 2042
28 Ga0070674_100623943 3300005356 Bacteria 914
29 Ga0070674_100820224 3300005356 Bacteria 805
30 Ga0070688_100074933 3300005365 Bacteria 2174
31 Ga0070688_100118535 3300005365 Bacteria 1769
32 Ga0070659_100869450 3300005366 Bacteria 787
33 Ga0070667_100738916 3300005367 Bacteria 912
34 Ga0070714_100190981 3300005435 Bacteria 1869
35 Ga0070710_10060278 3300005437 Unclassified 2158
36 Ga0070701_10019432 3300005438 Bacteria 3208
37 Ga0070701_10089681 3300005438 Unclassified 1682
38 Ga0070711_100118478 3300005439 Bacteria 1954
39 Ga0070705_100020717 3300005440 Bacteria 3486
40 Ga0070700_100102560 3300005441 Bacteria 1887
41 Ga0070700_100624752 3300005441 Bacteria 847
42 Ga0070694_100079025 3300005444 Bacteria 2283
43 Ga0070708_100661328 3300005445 Bacteria 984
44 Ga0070678_100043627 3300005456 Bacteria 3196
45 Ga0070678_100129869 3300005456 Bacteria 2000
46 Ga0070678_100169557 3300005456 Bacteria 1776
47 Ga0070662_100000038 3300005457 Bacteria 75003
48 Ga0070662_100273435 3300005457 Bacteria 1365
49 Ga0068867_100060011 3300005459 Bacteria 2820
50 Ga0070685_10097892 3300005466 Bacteria 1786
51 Ga0070685_10112571 3300005466 Bacteria 1679
52 Ga0070684_100007982 3300005535 Bacteria 8262
53 Ga0070684_100029673 3300005535 Bacteria 4637
54 Ga0070684_100420835 3300005535 Bacteria 1233
55 Ga0068853_100192799 3300005539 Bacteria 1852
56 Ga0070686_100018716 3300005544 Bacteria 4072
57 Ga0070686_100832532 3300005544 Bacteria 746
58 Ga0070695_100316628 3300005545 Bacteria 1158
59 Ga0070696_100642383 3300005546 Bacteria 859
60 Ga0070693_100045893 3300005547 Bacteria 2479
61 Ga0070665_100006869 3300005548 Bacteria 11569
62 Ga0070704_100115218 3300005549 Bacteria 2053
63 Ga0070704_100121029 3300005549 Bacteria 2011
64 Ga0070704_100204423 3300005549 Bacteria 1596
65 Ga0068855_100942233 3300005563 Bacteria 910
66 Ga0070664_100199688 3300005564 Bacteria 1784
67 Ga0070664_100660952 3300005564 Bacteria 972
68 Ga0068857_100136223 3300005577 Bacteria 2217
69 Ga0068854_100142089 3300005578 Bacteria 1843
70 Ga0068856_100016998 3300005614 Bacteria 7050
71 Ga0068856_100101676 3300005614 Bacteria 2867
72 Ga0068856_100654076 3300005614 Bacteria 1071
73 Ga0070702_100089143 3300005615 Bacteria 1867
74 Ga0070702_100094131 3300005615 Bacteria 1823
75 Ga0070702_100447126 3300005615 Bacteria 937
76 Ga0068852_100064570 3300005616 Bacteria 3191
77 Ga0068852_100107248 3300005616 Bacteria 2534
78 Ga0068852_100140930 3300005616 Bacteria 2231
79 Ga0068852_100720257 3300005616 Bacteria 1009
80 Ga0068859_100516892 3300005617 Bacteria 1289
81 Ga0068864_100013710 3300005618 Bacteria 6723
82 Ga0068866_10383032 3300005718 Bacteria 902
83 Ga0068866_10496814 3300005718 Bacteria 806
84 Ga0068861_101215032 3300005719 Bacteria 729
85 Ga0068870_10098316 3300005840 Bacteria 1649
86 Ga0068863_100375858 3300005841 Bacteria 1387
87 Ga0068863_100622809 3300005841 Unclassified 1069
88 Ga0068858_100000033 3300005842 Bacteria 142748
89 Ga0068858_100525418 3300005842 Bacteria 1145
90 Ga0068860_100911582 3300005843 Unclassified 895
91 Ga0068862_100302546 3300005844 Bacteria 1472
92 Ga0081455_10015444 3300005937 Bacteria 7419
93 Ga0081455_10100614 3300005937 Bacteria 2322
94 Ga0081538_10003696 3300005981 Bacteria 14356
95 Ga0081538_10006776 3300005981 Bacteria 10011
96 Ga0081540_1000106 3300005983 Bacteria 89767
97 Ga0081539_10001198 3300005985 Bacteria 46744
98 Ga0081539_10006689 3300005985 Bacteria 10888
99 Ga0081539_10050419 3300005985 Bacteria 2356
100 Ga0070712_100000009 3300006175 Bacteria 143615
101 Ga0070712_100005927 3300006175 Bacteria 7562
102 Ga0070712_100053854 3300006175 Bacteria 2811
103 Ga0070712_100206448 3300006175 Bacteria 1547
104 Ga0097621_101292177 3300006237 Bacteria 689
105 Ga0075430_100042081 3300006846 Bacteria 3863
106 Ga0075431_100002773 3300006847 Bacteria 16973
107 Ga0075431_100089606 3300006847 Bacteria 3175
108 Ga0075433_10013755 3300006852 Bacteria 6593
109 Ga0075433_10108774 3300006852 Unclassified 2459
110 Ga0075434_100006009 3300006871 Bacteria 11108
111 Ga0075434_100011004 3300006871 Bacteria 8510
112 Ga0075434_100115285 3300006871 Bacteria 2699
113 Ga0075429_100503321 3300006880 Bacteria 1061
114 Ga0068865_100060073 3300006881 Bacteria 2660
115 Ga0068865_100093180 3300006881 Bacteria 2190
116 Ga0075436_100535926 3300006914 Bacteria 859
117 Ga0097620_100516803 3300006931 Bacteria 1289
118 Ga0075435_100006731 3300007076 Bacteria 8150
119 Ga0111539_10011166 3300009094 Bacteria 11296
120 Ga0111539_10057839 3300009094 Bacteria 4603
121 Ga0111539_10200197 3300009094 Bacteria 2329
122 Ga0111539_10712234 3300009094 Bacteria 1168
123 Ga0105245_10022774 3300009098 Bacteria 5497
124 Ga0105245_10115534 3300009098 Bacteria 2501
125 Ga0105245_10897655 3300009098 Bacteria 928
126 Ga0105247_10111991 3300009101 Bacteria 1758
127 Ga0114129_10057077 3300009147 Bacteria 5466
128 Ga0114129_11306713 3300009147 Bacteria 899
129 Ga0105243_10076823 3300009148 Bacteria 2715
130 Ga0105243_10545204 3300009148 Unclassified 1107
131 Ga0105241_11037078 3300009174 Bacteria 769
132 Ga0105241_11740199 3300009174 Bacteria 607
133 Ga0105242_10000331 3300009176 Bacteria 37975
134 Ga0105242_10036173 3300009176 Bacteria 3960
135 Ga0105242_10087133 3300009176 Bacteria 2621
136 Ga0105248_10091872 3300009177 Bacteria 3418
137 Ga0105248_10313541 3300009177 Bacteria 1767
138 Ga0105237_11299751 3300009545 Bacteria 734
139 Ga0105238_10911268 3300009551 Bacteria 898
140 Ga0105249_10169380 3300009553 Bacteria 2117
141 Ga0105249_11012306 3300009553 Bacteria 900
142 Ga0105239_10038563 3300010375 Bacteria 5236
143 Ga0105239_10248735 3300010375 Bacteria 1997
144 Ga0105246_10033197 3300011119 Bacteria 3429
145 Ga0105246_10108585 3300011119 Unclassified 2034
146 Ga0105246_10110237 3300011119 Bacteria 2021
147 Ga0157369_10199500 3300013105 Bacteria 2100
148 Ga0157374_10016918 3300013296 Bacteria 6419
149 Ga0157374_10236817 3300013296 Bacteria 1794
150 Ga0163162_10090995 3300013306 Bacteria 3133
151 Ga0163162_10462771 3300013306 Unclassified 1400
152 Ga0157372_10032843 3300013307 Bacteria 5694
153 Ga0157372_10412823 3300013307 Bacteria 1573
154 Ga0157372_10923456 3300013307 Bacteria 1012
155 Ga0157375_10000153 3300013308 Bacteria 67321
156 Ga0157375_10045039 3300013308 Bacteria 4292
157 Ga0157375_10069504 3300013308 Bacteria 3528
158 Ga0157375_10167908 3300013308 Bacteria 2340
159 Ga0163163_10006540 3300014325 Bacteria 10203
160 Ga0157380_10072478 3300014326 Bacteria 2790
161 Ga0157377_10004548 3300014745 Bacteria 6407
162 Ga0157379_10469855 3300014968 Bacteria 1163
163 Ga0157376_10349945 3300014969 Unclassified 1414
164 Ga0163161_10218001 3300017792 Bacteria 1477
165 Ga0213874_10077175 3300021377 Bacteria 1073
166 Ga0213876_10001692 3300021384 Bacteria 13415
167 Ga0213876_10266556 3300021384 Bacteria 910
168 Ga0213876_10281659 3300021384 Bacteria 884
169 Ga0207653_10015735 3300025885 Bacteria 2375
170 Ga0207642_10021915 3300025899 Bacteria 2524
171 Ga0207642_10384226 3300025899 Bacteria 836
172 Ga0207710_10025994 3300025900 Bacteria 2528
173 Ga0207688_10000561 3300025901 Bacteria 18157
174 Ga0207645_10069129 3300025907 Bacteria 2259
175 Ga0207645_10381108 3300025907 Bacteria 947
176 Ga0207643_10007490 3300025908 Bacteria 5860
177 Ga0207671_10625507 3300025914 Bacteria 858
178 Ga0207693_10000036 3300025915 Bacteria 109562
179 Ga0207693_10036788 3300025915 Bacteria 3860
180 Ga0207693_10530117 3300025915 Bacteria 919
181 Ga0207662_10009659 3300025918 Bacteria 5317
182 Ga0207657_10039790 3300025919 Bacteria 4173
183 Ga0207659_10745965 3300025926 Unclassified 840
184 Ga0207687_10716775 3300025927 Bacteria 850
185 Ga0207664_10003062 3300025929 Bacteria 11109
186 Ga0207690_10787893 3300025932 Bacteria 785
187 Ga0207706_10000026 3300025933 Bacteria 149379
188 Ga0207706_10104153 3300025933 Bacteria 2496
189 Ga0207706_10146148 3300025933 Bacteria 2080
190 Ga0207706_10332898 3300025933 Bacteria 1321
191 Ga0207686_10000032 3300025934 Bacteria 150341
192 Ga0207686_10045785 3300025934 Bacteria 2694
193 Ga0207686_10194323 3300025934 Bacteria 1449
194 Ga0207686_10306419 3300025934 Unclassified 1181
195 Ga0207709_10141645 3300025935 Bacteria 1654
196 Ga0207670_10122321 3300025936 Bacteria 1894
197 Ga0207670_10640400 3300025936 Bacteria 876
198 Ga0207669_10032843 3300025937 Bacteria 2921
199 Ga0207669_10146394 3300025937 Bacteria 1648
200 Ga0207669_10362286 3300025937 Bacteria 1124
201 Ga0207704_10080604 3300025938 Bacteria 2102
202 Ga0207704_10875163 3300025938 Bacteria 754
203 Ga0207665_10319585 3300025939 Bacteria 1164
204 Ga0207665_10384417 3300025939 Bacteria 1066
205 Ga0207711_10193245 3300025941 Bacteria 1855
206 Ga0207711_10210304 3300025941 Bacteria 1777
207 Ga0207661_10025244 3300025944 Bacteria 4515
208 Ga0207661_10372429 3300025944 Bacteria 1291
209 Ga0207679_10025351 3300025945 Bacteria 4076
210 Ga0207667_10846177 3300025949 Bacteria 909
211 Ga0207667_11348227 3300025949 Bacteria 688
212 Ga0207651_10276316 3300025960 Bacteria 1386
213 Ga0207712_10109218 3300025961 Bacteria 2071
214 Ga0207668_10059249 3300025972 Bacteria 2682
215 Ga0207668_10571991 3300025972 Bacteria 981
216 Ga0207640_10091768 3300025981 Bacteria 2105
217 Ga0207640_10118532 3300025981 Bacteria 1891
218 Ga0207677_10137194 3300026023 Bacteria 1867
219 Ga0207677_10161770 3300026023 Bacteria 1740
220 Ga0207677_10178403 3300026023 Bacteria 1668
221 Ga0207703_10000126 3300026035 Bacteria 91860
222 Ga0207703_10210443 3300026035 Bacteria 1733
223 Ga0207703_10501526 3300026035 Unclassified 1139
224 Ga0207639_11237828 3300026041 Bacteria 701
225 Ga0207678_10137348 3300026067 Bacteria 2086
226 Ga0207708_10000234 3300026075 Bacteria 43753
227 Ga0207708_10011319 3300026075 Bacteria 6642
228 Ga0207708_10081973 3300026075 Bacteria 2480
229 Ga0207641_10352626 3300026088 Bacteria 1403
230 Ga0207648_10028732 3300026089 Bacteria 4929
231 Ga0207648_10235284 3300026089 Unclassified 1630
232 Ga0207676_10213274 3300026095 Bacteria 1714
233 Ga0207674_10199146 3300026116 Bacteria 1952
234 Ga0207675_100051794 3300026118 Bacteria 3831
235 Ga0207683_10026273 3300026121 Bacteria 5025
236 Ga0207698_10079130 3300026142 Bacteria 2643
237 Ga0207698_10316424 3300026142 Bacteria 1460
238 Ga0207698_10379178 3300026142 Bacteria 1345
239 Ga0207428_10012694 3300027907 Bacteria 7387
240 Ga0207428_10041398 3300027907 Bacteria 3730
241 Ga0268264_10159978 3300028381 Unclassified 2028
242 Ga0265319_1000447 3300028563 Bacteria 29401
243 Ga0265330_10237595 3300031235 Bacteria 768
244 Ga0307416_100729485 3300032002 Bacteria 1082
245 Ga0373943_0446914 3300035170 Unclassified 751
246 Ga0373946_0046393 3300035171 Bacteria 1801
247 Ga0373931_0188323 3300035691 Bacteria 1226
248 Ga0373935_0071956 3300035692 Bacteria 2232
249 Ga0373947_0052191 3300035725 Bacteria 2463
250 Ga0395899_0232217 3300037312 Bacteria 1273
251 Ga0395900_0073891 3300037418 Bacteria 3506
252 Ga0395898_0144017 3300037466 Bacteria 2281
253 Ga0436364_0121607 3300037853 Bacteria 14288
254 Ga0436364_0600268 3300037853 Bacteria 2029
255 Ga0436364_0862120 3300037853 Bacteria 6365
256 Ga0436364_1198736 3300037853 Bacteria 1256
257 Ga0395901_0070259 3300038443 Bacteria 3648
258 Ga0436365_0205123 3300039437 Bacteria 1440
259 Ga0436365_0458644 3300039437 Bacteria 1689
260 Ga0436365_0829771 3300039437 Bacteria 8447
261 Ga0436365_1197388 3300039437 Bacteria 2330
262 Ga0436365_1326776 3300039437 Bacteria 13402
263 Ga0436365_1529058 3300039437 Bacteria 1144
264 Ga0436365_1579775 3300039437 Bacteria 2431
265 Ga0436365_1641005 3300039437 Bacteria 1104
266 Ga0436360_0129696 3300039438 Bacteria 1141
267 Ga0436363_0274208 3300039450 Bacteria 1318
268 Ga0436363_0625571 3300039450 Bacteria 917
269 Ga0436363_1596394 3300039450 Bacteria 2369
270 Ga0436363_1714030 3300039450 Bacteria 2879
271 Ga0436362_0408945 3300039453 Bacteria 876
272 Ga0436362_0818206 3300039453 Bacteria 3276
273 Ga0436362_1117690 3300039453 Bacteria 1223
274 Ga0466972_0319000 3300044658 Bacteria 726
275 Ga0466972_0386647 3300044658 Bacteria 655
276 Ga0466966_0648420 3300044684 Bacteria 636
277 Ga0466963_0003791 3300044694 Bacteria 8710
278 Ga0466963_0005849 3300044694 Bacteria 7244
279 Ga0466963_0506035 3300044694 Bacteria 853
280 Ga0466971_0010962 3300044719 Bacteria 3966
281 Ga0466968_0039067 3300044735 Bacteria 1996
282 Ga0466968_0225269 3300044735 Bacteria 884
283 Ga0466970_0273339 3300044765 Bacteria 949
284 Ga0466970_0355921 3300044765 Unclassified 831
285 Ga0466960_0040265 3300044901 Bacteria 2209
286 Ga0466959_0004861 3300045049 Bacteria 9088
287 Ga0466959_0051771 3300045049 Bacteria 3009
288 Ga0466959_0098023 3300045049 Bacteria 2100
289 Ga0466958_0064999 3300045836 Bacteria 2226
290 Ga0466958_0104253 3300045836 Bacteria 1766
291 Ga0466967_0689817 3300045976 Bacteria 1011
292 Ga0466967_0702453 3300045976 Bacteria 1002
293 Ga0466967_0909864 3300045976 Bacteria 875
294 Ga0466967_1282575 3300045976 Bacteria 730
295 Ga0495603_0002398 3300046455 Bacteria 11015
296 Ga0495603_0016459 3300046455 Bacteria 4474
297 Ga0495590_0065293 3300046457 Bacteria 1274
298 Ga0495629_0004008 3300046459 Bacteria 11067
299 Ga0495638_0016581 3300046460 Bacteria 4931
300 Ga0495641_0101448 3300046461 Bacteria 1284
301 Ga0495653_0425943 3300046463 Bacteria 839
302 Ga0495582_0053867 3300046473 Bacteria 2219
303 Ga0495582_0383962 3300046473 Bacteria 810
304 Ga0495594_0000007 3300046499 Bacteria 160047
305 Ga0495608_0431739 3300046511 Bacteria 803
306 Ga0495628_0461664 3300046516 Bacteria 921
307 Ga0495630_0255739 3300046517 Bacteria 1338
308 Ga0495630_0297916 3300046517 Bacteria 1232
309 Ga0495630_0791701 3300046517 Bacteria 724
310 Ga0495652_0000003 3300046529 Bacteria 597094
311 Ga0495586_0000501 3300046535 Bacteria 23057
312 Ga0495622_0000050 3300046557 Bacteria 106111
313 Ga0495656_0000182 3300046615 Bacteria 22447
314 Ga0495657_0000008 3300046675 Bacteria 221090
315 Ga0495599_0160689 3300046678 Bacteria 1389
316 Ga0495647_0126991 3300046681 Bacteria 1077
317 Ga0495674_0000020 3300047319 Bacteria 178465
318 Ga0495672_0034878 3300047320 Bacteria 3104
319 Ga0495676_0010921 3300047321 Bacteria 8209
320 Ga0495675_0015544 3300047444 Bacteria 4813
321 Ga0495602_0057072 3300048088 Bacteria 3429
322 Ga0495614_0149664 3300048089 Bacteria 1041
323 Ga0496100_0017626 3300048903 Bacteria 4220
324 Ga0496100_0031314 3300048903 Bacteria 3306
325 Ga0496100_0053694 3300048903 Bacteria 2625
326 Ga0496101_0005401 3300048904 Bacteria 8142
327 Ga0496101_0025466 3300048904 Bacteria 4106
328 Ga0496101_0087714 3300048904 Bacteria 2310
329 Ga0496101_0184080 3300048904 Bacteria 1609
330 Ga0496101_0185279 3300048904 Bacteria 1604
331 Ga0496101_0782626 3300048904 Bacteria 752
332 Ga0496102_0000045 3300048905 Bacteria 186726
333 Ga0496102_0008106 3300048905 Bacteria 8988
334 Ga0496102_0024794 3300048905 Bacteria 5335
335 Ga0496102_0041690 3300048905 Bacteria 4158
336 Ga0496102_0053184 3300048905 Bacteria 3692
337 Ga0496102_0216807 3300048905 Bacteria 1804
338 Ga0496103_0000050 3300048906 Bacteria 152034
339 Ga0496103_0019175 3300048906 Bacteria 4107
340 Ga0496103_0023650 3300048906 Bacteria 3706
341 Ga0496103_0094111 3300048906 Bacteria 1893
342 Ga0496104_0000001 3300048907 Bacteria 711867
343 Ga0496104_0006038 3300048907 Bacteria 10624
344 Ga0496104_0038267 3300048907 Bacteria 4488
345 Ga0496104_0044869 3300048907 Bacteria 4155
346 Ga0496104_0263262 3300048907 Bacteria 1637
347 Ga0496105_0020740 3300048908 Bacteria 5312
348 Ga0496105_0043552 3300048908 Bacteria 3702
349 Ga0496105_0067371 3300048908 Bacteria 2956
350 Ga0496106_0053599 3300048909 Bacteria 3046
351 Ga0496106_0099029 3300048909 Bacteria 2259
352 Ga0496106_0102763 3300048909 Bacteria 2217
353 Ga0496106_0286403 3300048909 Bacteria 1320
354 Ga0496106_0878315 3300048909 Bacteria 709
355 Ga0496107_0001376 3300048910 Bacteria 14979
356 Ga0496107_0010876 3300048910 Bacteria 6333
357 Ga0496107_0058571 3300048910 Bacteria 2785
358 Ga0496107_0062529 3300048910 Bacteria 2697
359 Ga0496107_0079821 3300048910 Bacteria 2385
360 Ga0496108_0007220 3300048911 Bacteria 9004
361 Ga0496108_0066973 3300048911 Bacteria 3028
362 Ga0496108_0085566 3300048911 Unclassified 2676
363 Ga0496108_0440964 3300048911 Bacteria 1137
364 Ga0496108_0987278 3300048911 Bacteria 720
365 Ga0496109_0000286 3300048912 Bacteria 47952
366 Ga0496109_0000682 3300048912 Bacteria 28239
367 Ga0496109_0026666 3300048912 Bacteria 5155
368 Ga0496109_0071347 3300048912 Unclassified 3188
369 Ga0496109_0183933 3300048912 Bacteria 1963
370 Ga0496109_0263147 3300048912 Unclassified 1625
371 Ga0496110_0003273 3300048913 Bacteria 12355
372 Ga0496110_0009173 3300048913 Bacteria 7990
373 Ga0496110_0010612 3300048913 Bacteria 7499
374 Ga0496110_0152796 3300048913 Bacteria 2090
375 Ga0496110_1183632 3300048913 Bacteria 673
376 Ga0496111_0009605 3300048914 Bacteria 6461
377 Ga0496111_0072293 3300048914 Bacteria 2510
378 Ga0496111_0095622 3300048914 Bacteria 2180
379 Ga0496111_0216329 3300048914 Bacteria 1423
380 Ga0496111_0477665 3300048914 Bacteria 918
381 Ga0496112_0000280 3300048915 Bacteria 33010
382 Ga0496112_0131324 3300048915 Bacteria 2475
383 Ga0496112_0282299 3300048915 Bacteria 1607
384 Ga0496112_1093667 3300048915 Unclassified 715
385 Ga0496112_1409493 3300048915 Bacteria 611
386 Ga0496113_0002300 3300048916 Bacteria 11027
387 Ga0496113_0013805 3300048916 Bacteria 5488
388 Ga0496113_0109984 3300048916 Bacteria 2144
389 Ga0496113_0210272 3300048916 Unclassified 1548
390 Ga0496114_0085321 3300048917 Bacteria 2674
391 Ga0496115_0003871 3300048918 Bacteria 10793
392 Ga0496115_0023083 3300048918 Bacteria 4826
393 Ga0496115_0031050 3300048918 Bacteria 4207
394 Ga0496119_0009607 3300048922 Bacteria 8259
395 Ga0496121_0015041 3300048924 Bacteria 8145
396 Ga0496125_0080295 3300048928 Bacteria 2497
397 Ga0501031_0090650 3300049568 Bacteria 1994
398 Ga0501031_0130757 3300049568 Unclassified 1640
399 Ga0501036_0136696 3300049572 Bacteria 2069
400 Ga0501036_0160565 3300049572 Bacteria 1895
401 Ga0501039_0033261 3300049575 Unclassified 3977
402 Ga0501039_0109334 3300049575 Bacteria 2161
403 Ga0501039_0689807 3300049575 Bacteria 799
404 Ga0501040_0020788 3300049576 Bacteria 4377
405 Ga0501041_0103638 3300049577 Bacteria 1762
406 Ga0501042_0111557 3300049578 Bacteria 1969
407 Ga0501042_0295932 3300049578 Bacteria 1169
408 Ga0501047_0008438 3300049581 Bacteria 9723
409 Ga0501048_0050956 3300049582 Bacteria 2948
410 Ga0501048_0151167 3300049582 Bacteria 1642
411 Ga0501069_0021326 3300049585 Bacteria 3514
412 Ga0501071_0536159 3300049587 Bacteria 898
413 Ga0501072_0063833 3300049588 Bacteria 2905
414 Ga0501072_0109996 3300049588 Bacteria 2193
415 Ga0501072_0275343 3300049588 Bacteria 1339
416 Ga0501072_0711728 3300049588 Bacteria 789
417 Ga0501074_0022175 3300049590 Bacteria 4614
418 Ga0501074_0048104 3300049590 Bacteria 3081
419 Ga0501074_0064369 3300049590 Bacteria 2640
420 Ga0501075_0101395 3300049591 Bacteria 2186
421 Ga0501075_0110256 3300049591 Bacteria 2092
422 Ga0501076_0062745 3300049592 Bacteria 2960
423 Ga0501076_0184457 3300049592 Bacteria 1701
424 Ga0501079_0359803 3300049741 Bacteria 1140
425 Ga0501079_0655427 3300049741 Bacteria 826
426 Ga0501080_0225269 3300049742 Bacteria 1715
427 Ga0501081_0316398 3300049743 Bacteria 1147
428 Ga0501081_0465080 3300049743 Bacteria 940
429 Ga0501035_0196383 3300049822 Bacteria 1733
430 Ga0501035_0457760 3300049822 Bacteria 1055
431 Ga0501045_0040263 3300049824 Unclassified 3401
432 Ga0501045_0073090 3300049824 Bacteria 2525
433 nmdc:mga05p37_46687_c1 3300050507 Bacteria 5324
434 nmdc:mga09592_278746_c1 3300050508 Bacteria 1450
435 nmdc:mga0qj67_10738_c1 3300050509 Bacteria 6847
436 nmdc:mga0qj67_26802_c1 3300050509 Bacteria 4463
437 nmdc:mga0qj67_634494_c1 3300050509 Bacteria 853
438 nmdc:mga06r32_3426_c1 3300050510 Bacteria 14192
439 nmdc:mga06r32_430205_c1 3300050510 Bacteria 1301
440 nmdc:mga06r32_7099_c1 3300050510 Bacteria 10087
441 nmdc:mga08y16_128418_c1 3300050511 Bacteria 2637
442 nmdc:mga08y16_16025_c1 3300050511 Bacteria 7879
443 nmdc:mga08y16_21880_c1 3300050511 Bacteria 6749
444 nmdc:mga08y16_876366_c1 3300050511 Bacteria 885
445 nmdc:mga0n895_327449_c1 3300050512 Unclassified 1552
446 nmdc:mga0n895_42912_c1 3300050512 Bacteria 4404
447 nmdc:mga0n895_90826_c1 3300050512 Bacteria 3056
448 nmdc:mga0rr50_60881_c1 3300050513 Bacteria 2842
449 nmdc:mga08x19_156014_c1 3300050514 Bacteria 1548
450 nmdc:mga0a205_142859_c1 3300050515 Bacteria 2293
451 nmdc:mga0a205_38033_c1 3300050515 Bacteria 4628
452 nmdc:mga0a205_760_c1 3300050515 Bacteria 23463
453 Ga0495612_0014955 3300053078 Bacteria 3113
454 Ga0495655_0000004 3300053083 Bacteria 293683
455 Ga0495619_0000001 3300053085 Bacteria 586054
456 Ga0500641_0006324 3300053096 Bacteria 4206
457 Ga0500628_000004 3300053129 Bacteria 202098
458 Ga0501084_0015521 3300054114 Bacteria 6317
459 Ga0501084_0056383 3300054114 Bacteria 3287
460 Ga0501084_0228326 3300054114 Bacteria 1571
461 Ga0501084_0439912 3300054114 Unclassified 1102
462 Ga0501082_0204202 3300060353 Bacteria 1719
463 Ga0501082_0281821 3300060353 Bacteria 1446
464 Ga0466962_0183729 3300061719 Bacteria 1020
465 Ga0530510_0008086 3300061734 Bacteria 7335
466 Ga0530510_0014140 3300061734 Bacteria 5627
467 Ga0530510_0123464 3300061734 Unclassified 1902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0000001 Ga0496104_0000001_227567_228097 157
2 3300048913 Ga0496110_0003273 Ga0496110_0003273_2208_2738 157
3 3300050511 nmdc:mga08y16_876366_c1 nmdc:mga08y16_876366_c1_189_668 159
4 3300046675 Ga0495657_0000008 Ga0495657_0000008_104529_105104 162
5 3300006852 Ga0075433_10108774 Ga0075433_101087742 172
6 3300006871 Ga0075434_100006009 Ga0075434_1000060094 172
7 3300009094 Ga0111539_10011166 Ga0111539_100111664 172
8 3300027907 Ga0207428_10041398 Ga0207428_100413983 172
9 3300050510 nmdc:mga06r32_7099_c1 nmdc:mga06r32_7099_c1_6292_6867 172
10 3300050511 nmdc:mga08y16_16025_c1 nmdc:mga08y16_16025_c1_3721_4296 172
11 3300050512 nmdc:mga0n895_90826_c1 nmdc:mga0n895_90826_c1_2239_2814 172
12 3300050515 nmdc:mga0a205_38033_c1 nmdc:mga0a205_38033_c1_3219_3794 172
13 3300039437 Ga0436365_0829771 Ga0436365_0829771_1484_2014 176
14 3300045976 Ga0466967_0909864 Ga0466967_0909864_27_557 176
15 3300049585 Ga0501069_0021326 Ga0501069_0021326_2403_2933 176
16 3300049592 Ga0501076_0062745 Ga0501076_0062745_1518_2048 176
17 3300005616 Ga0068852_100140930 Ga0068852_1001409302 179
18 3300026142 Ga0207698_10079130 Ga0207698_100791303 179
19 3300044694 Ga0466963_0005849 Ga0466963_0005849_181_747 179
20 3300046517 Ga0495630_0255739 Ga0495630_0255739_344_883 179
21 3300046517 Ga0495630_0791701 Ga0495630_0791701_47_586 179
22 3300048907 Ga0496104_0263262 Ga0496104_0263262_933_1472 179
23 3300028563 Ga0265319_1000447 Ga0265319_100044716 180
24 3300031235 Ga0265330_10237595 Ga0265330_102375952 180
25 3300045976 Ga0466967_0702453 Ga0466967_0702453_18_584 180
26 3300045976 Ga0466967_1282575 Ga0466967_1282575_126_668 180
27 3300005441 Ga0070700_100624752 Ga0070700_1006247522 181
28 3300032002 Ga0307416_100729485 Ga0307416_1007294852 181
29 3300039437 Ga0436365_0205123 Ga0436365_0205123_313_906 181
30 3300050512 nmdc:mga0n895_327449_c1 nmdc:mga0n895_327449_c1_793_1344 181
31 3300050515 nmdc:mga0a205_142859_c1 nmdc:mga0a205_142859_c1_914_1465 181
32 3300037418 Ga0395900_0073891 Ga0395900_0073891_273_836 182
33 3300037853 Ga0436364_1198736 Ga0436364_1198736_48_596 182
34 3300038443 Ga0395901_0070259 Ga0395901_0070259_665_1228 182
35 3300039437 Ga0436365_1579775 Ga0436365_1579775_1461_2009 182
36 3300044735 Ga0466968_0039067 Ga0466968_0039067_358_906 182
37 3300044765 Ga0466970_0355921 Ga0466970_0355921_95_643 182
38 3300045049 Ga0466959_0098023 Ga0466959_0098023_343_891 182
39 3300046455 Ga0495603_0002398 Ga0495603_0002398_10068_10619 182
40 3300054114 Ga0501084_0228326 Ga0501084_0228326_941_1495 182
41 3300005327 Ga0070658_10431601 Ga0070658_104316013 183
42 3300005329 Ga0070683_100246658 Ga0070683_1002466582 183
43 3300005335 Ga0070666_10098263 Ga0070666_100982632 183
44 3300005338 Ga0068868_100033641 Ga0068868_1000336411 183
45 3300005338 Ga0068868_100883106 Ga0068868_1008831061 183
46 3300005340 Ga0070689_100014689 Ga0070689_1000146896 183
47 3300005343 Ga0070687_100096434 Ga0070687_1000964342 183
48 3300005347 Ga0070668_100211491 Ga0070668_1002114911 183
49 3300005356 Ga0070674_100623943 Ga0070674_1006239432 183
50 3300005365 Ga0070688_100074933 Ga0070688_1000749333 183
51 3300005366 Ga0070659_100869450 Ga0070659_1008694501 183
52 3300005367 Ga0070667_100738916 Ga0070667_1007389161 183
53 3300005438 Ga0070701_10019432 Ga0070701_100194322 183
54 3300005440 Ga0070705_100020717 Ga0070705_1000207175 183
55 3300005456 Ga0070678_100169557 Ga0070678_1001695572 183
56 3300005459 Ga0068867_100060011 Ga0068867_1000600112 183
57 3300005466 Ga0070685_10097892 Ga0070685_100978923 183
58 3300005549 Ga0070704_100204423 Ga0070704_1002044233 183
59 3300005564 Ga0070664_100660952 Ga0070664_1006609522 183
60 3300005578 Ga0068854_100142089 Ga0068854_1001420892 183
61 3300005615 Ga0070702_100094131 Ga0070702_1000941312 183
62 3300005615 Ga0070702_100447126 Ga0070702_1004471262 183
63 3300005616 Ga0068852_100064570 Ga0068852_1000645703 183
64 3300005616 Ga0068852_100720257 Ga0068852_1007202573 183
65 3300005718 Ga0068866_10496814 Ga0068866_104968142 183
66 3300005719 Ga0068861_101215032 Ga0068861_1012150322 183
67 3300005840 Ga0068870_10098316 Ga0068870_100983161 183
68 3300005842 Ga0068858_100525418 Ga0068858_1005254182 183
69 3300006175 Ga0070712_100206448 Ga0070712_1002064482 183
70 3300006237 Ga0097621_101292177 Ga0097621_1012921771 183
71 3300006871 Ga0075434_100115285 Ga0075434_1001152853 183
72 3300009094 Ga0111539_10200197 Ga0111539_102001974 183
73 3300009094 Ga0111539_10712234 Ga0111539_107122341 183
74 3300009098 Ga0105245_10115534 Ga0105245_101155344 183
75 3300009098 Ga0105245_10897655 Ga0105245_108976552 183
76 3300009101 Ga0105247_10111991 Ga0105247_101119912 183
77 3300009148 Ga0105243_10076823 Ga0105243_100768233 183
78 3300009174 Ga0105241_11740199 Ga0105241_117401991 183
79 3300009177 Ga0105248_10091872 Ga0105248_100918722 183
80 3300009545 Ga0105237_11299751 Ga0105237_112997511 183
81 3300009551 Ga0105238_10911268 Ga0105238_109112681 183
82 3300009553 Ga0105249_10169380 Ga0105249_101693801 183
83 3300009553 Ga0105249_11012306 Ga0105249_110123061 183
84 3300010375 Ga0105239_10248735 Ga0105239_102487354 183
85 3300011119 Ga0105246_10110237 Ga0105246_101102373 183
86 3300013296 Ga0157374_10236817 Ga0157374_102368172 183
87 3300013308 Ga0157375_10167908 Ga0157375_101679085 183
88 3300017792 Ga0163161_10218001 Ga0163161_102180013 183
89 3300025899 Ga0207642_10384226 Ga0207642_103842261 183
90 3300025900 Ga0207710_10025994 Ga0207710_100259943 183
91 3300025907 Ga0207645_10069129 Ga0207645_100691292 183
92 3300025908 Ga0207643_10007490 Ga0207643_100074903 183
93 3300025918 Ga0207662_10009659 Ga0207662_100096593 183
94 3300025919 Ga0207657_10039790 Ga0207657_100397903 183
95 3300025927 Ga0207687_10716775 Ga0207687_107167751 183
96 3300025932 Ga0207690_10787893 Ga0207690_107878932 183
97 3300025933 Ga0207706_10146148 Ga0207706_101461483 183
98 3300025934 Ga0207686_10045785 Ga0207686_100457854 183
99 3300025935 Ga0207709_10141645 Ga0207709_101416452 183
100 3300025936 Ga0207670_10122321 Ga0207670_101223213 183
101 3300025937 Ga0207669_10146394 Ga0207669_101463942 183
102 3300025938 Ga0207704_10875163 Ga0207704_108751631 183
103 3300025939 Ga0207665_10319585 Ga0207665_103195852 183
104 3300025941 Ga0207711_10193245 Ga0207711_101932453 183
105 3300025961 Ga0207712_10109218 Ga0207712_101092181 183
106 3300025972 Ga0207668_10571991 Ga0207668_105719912 183
107 3300025981 Ga0207640_10118532 Ga0207640_101185324 183
108 3300026023 Ga0207677_10161770 Ga0207677_101617703 183
109 3300026035 Ga0207703_10210443 Ga0207703_102104433 183
110 3300026067 Ga0207678_10137348 Ga0207678_101373482 183
111 3300026075 Ga0207708_10011319 Ga0207708_100113196 183
112 3300026089 Ga0207648_10028732 Ga0207648_100287325 183
113 3300026116 Ga0207674_10199146 Ga0207674_101991464 183
114 3300026121 Ga0207683_10026273 Ga0207683_100262733 183
115 3300044658 Ga0466972_0386647 Ga0466972_0386647_49_600 183
116 3300044901 Ga0466960_0040265 Ga0466960_0040265_1647_2198 183
117 3300046681 Ga0495647_0126991 Ga0495647_0126991_382_936 183
118 3300048904 Ga0496101_0782626 Ga0496101_0782626_53_604 183
119 3300048905 Ga0496102_0216807 Ga0496102_0216807_728_1279 183
120 3300048906 Ga0496103_0023650 Ga0496103_0023650_2110_2661 183
121 3300048909 Ga0496106_0099029 Ga0496106_0099029_79_630 183
122 3300048909 Ga0496106_0102763 Ga0496106_0102763_145_696 183
123 3300048910 Ga0496107_0058571 Ga0496107_0058571_147_698 183
124 3300048914 Ga0496111_0477665 Ga0496111_0477665_308_859 183
125 3300048918 Ga0496115_0023083 Ga0496115_0023083_2162_2713 183
126 3300049568 Ga0501031_0090650 Ga0501031_0090650_983_1534 183
127 3300049572 Ga0501036_0160565 Ga0501036_0160565_571_1122 183
128 3300049576 Ga0501040_0020788 Ga0501040_0020788_239_790 183
129 3300049577 Ga0501041_0103638 Ga0501041_0103638_939_1490 183
130 3300049578 Ga0501042_0111557 Ga0501042_0111557_177_728 183
131 3300049582 Ga0501048_0050956 Ga0501048_0050956_26_577 183
132 3300049588 Ga0501072_0109996 Ga0501072_0109996_1401_1952 183
133 3300049591 Ga0501075_0110256 Ga0501075_0110256_1051_1602 183
134 3300049824 Ga0501045_0073090 Ga0501045_0073090_1808_2359 183
135 3300050511 nmdc:mga08y16_128418_c1 nmdc:mga08y16_128418_c1_935_1486 183
136 3300054114 Ga0501084_0056383 Ga0501084_0056383_587_1138 183
137 3300060353 Ga0501082_0281821 Ga0501082_0281821_571_1122 183
138 3300061734 Ga0530510_0008086 Ga0530510_0008086_1118_1669 183
139 3300005335 Ga0070666_10017109 Ga0070666_100171094 184
140 3300005337 Ga0070682_100026035 Ga0070682_1000260353 184
141 3300005340 Ga0070689_100226808 Ga0070689_1002268082 184
142 3300005354 Ga0070675_100505517 Ga0070675_1005055171 184
143 3300005356 Ga0070674_100107566 Ga0070674_1001075661 184
144 3300005356 Ga0070674_100820224 Ga0070674_1008202241 184
145 3300005437 Ga0070710_10060278 Ga0070710_100602782 184
146 3300005438 Ga0070701_10089681 Ga0070701_100896812 184
147 3300005456 Ga0070678_100129869 Ga0070678_1001298692 184
148 3300005544 Ga0070686_100018716 Ga0070686_1000187163 184
149 3300005549 Ga0070704_100121029 Ga0070704_1001210292 184
150 3300005937 Ga0081455_10100614 Ga0081455_101006143 184
151 3300025937 Ga0207669_10032843 Ga0207669_100328433 184
152 3300035170 Ga0373943_0446914 Ga0373943_0446914_137_712 184
153 3300048911 Ga0496108_0085566 Ga0496108_0085566_2077_2652 184
154 3300048915 Ga0496112_1093667 Ga0496112_1093667_25_600 184
155 3300049575 Ga0501039_0689807 Ga0501039_0689807_30_590 184
156 3300049741 Ga0501079_0655427 Ga0501079_0655427_52_612 184
157 3300005981 Ga0081538_10006776 Ga0081538_100067763 185
158 3300021384 Ga0213876_10281659 Ga0213876_102816592 185
159 3300039437 Ga0436365_1197388 Ga0436365_1197388_633_1190 185
160 3300045049 Ga0466959_0004861 Ga0466959_0004861_1801_2358 185
161 3300048909 Ga0496106_0878315 Ga0496106_0878315_92_655 185
162 3300049742 Ga0501080_0225269 Ga0501080_0225269_201_818 185
163 3300005328 Ga0070676_10083870 Ga0070676_100838703 186
164 3300005329 Ga0070683_100203492 Ga0070683_1002034922 186
165 3300005331 Ga0070670_100457039 Ga0070670_1004570392 186
166 3300005334 Ga0068869_100052790 Ga0068869_1000527903 186
167 3300005337 Ga0070682_100015792 Ga0070682_1000157923 186
168 3300005341 Ga0070691_10187394 Ga0070691_101873942 186
169 3300005355 Ga0070671_100111880 Ga0070671_1001118802 186
170 3300005365 Ga0070688_100118535 Ga0070688_1001185351 186
171 3300005439 Ga0070711_100118478 Ga0070711_1001184783 186
172 3300005441 Ga0070700_100102560 Ga0070700_1001025603 186
173 3300005444 Ga0070694_100079025 Ga0070694_1000790253 186
174 3300005445 Ga0070708_100661328 Ga0070708_1006613282 186
175 3300005456 Ga0070678_100043627 Ga0070678_1000436272 186
176 3300005466 Ga0070685_10112571 Ga0070685_101125713 186
177 3300005535 Ga0070684_100007982 Ga0070684_10000798210 186
178 3300005539 Ga0068853_100192799 Ga0068853_1001927992 186
179 3300005545 Ga0070695_100316628 Ga0070695_1003166281 186
180 3300005546 Ga0070696_100642383 Ga0070696_1006423831 186
181 3300005547 Ga0070693_100045893 Ga0070693_1000458934 186
182 3300005549 Ga0070704_100115218 Ga0070704_1001152182 186
183 3300005563 Ga0068855_100942233 Ga0068855_1009422332 186
184 3300005564 Ga0070664_100199688 Ga0070664_1001996882 186
185 3300005577 Ga0068857_100136223 Ga0068857_1001362234 186
186 3300005614 Ga0068856_100016998 Ga0068856_1000169984 186
187 3300005615 Ga0070702_100089143 Ga0070702_1000891432 186
188 3300005616 Ga0068852_100107248 Ga0068852_1001072483 186
189 3300005618 Ga0068864_100013710 Ga0068864_1000137104 186
190 3300005718 Ga0068866_10383032 Ga0068866_103830322 186
191 3300005844 Ga0068862_100302546 Ga0068862_1003025462 186
192 3300005981 Ga0081538_10003696 Ga0081538_100036965 186
193 3300006175 Ga0070712_100053854 Ga0070712_1000538544 186
194 3300006881 Ga0068865_100060073 Ga0068865_1000600734 186
195 3300009174 Ga0105241_11037078 Ga0105241_110370782 186
196 3300009177 Ga0105248_10313541 Ga0105248_103135413 186
197 3300010375 Ga0105239_10038563 Ga0105239_100385634 186
198 3300011119 Ga0105246_10033197 Ga0105246_100331972 186
199 3300013105 Ga0157369_10199500 Ga0157369_101995003 186
200 3300013296 Ga0157374_10016918 Ga0157374_100169183 186
201 3300013307 Ga0157372_10032843 Ga0157372_100328433 186
202 3300013308 Ga0157375_10045039 Ga0157375_100450393 186
203 3300014325 Ga0163163_10006540 Ga0163163_100065406 186
204 3300014326 Ga0157380_10072478 Ga0157380_100724783 186
205 3300014745 Ga0157377_10004548 Ga0157377_100045483 186
206 3300025901 Ga0207688_10000561 Ga0207688_1000056112 186
207 3300025907 Ga0207645_10381108 Ga0207645_103811082 186
208 3300025914 Ga0207671_10625507 Ga0207671_106255072 186
209 3300025915 Ga0207693_10036788 Ga0207693_100367882 186
210 3300025933 Ga0207706_10104153 Ga0207706_101041532 186
211 3300025936 Ga0207670_10640400 Ga0207670_106404001 186
212 3300025937 Ga0207669_10362286 Ga0207669_103622862 186
213 3300025938 Ga0207704_10080604 Ga0207704_100806042 186
214 3300025941 Ga0207711_10210304 Ga0207711_102103042 186
215 3300025944 Ga0207661_10372429 Ga0207661_103724292 186
216 3300025945 Ga0207679_10025351 Ga0207679_100253513 186
217 3300025949 Ga0207667_10846177 Ga0207667_108461772 186
218 3300025960 Ga0207651_10276316 Ga0207651_102763162 186
219 3300025972 Ga0207668_10059249 Ga0207668_100592493 186
220 3300026041 Ga0207639_11237828 Ga0207639_112378282 186
221 3300026075 Ga0207708_10000234 Ga0207708_1000023417 186
222 3300026095 Ga0207676_10213274 Ga0207676_102132742 186
223 3300026142 Ga0207698_10316424 Ga0207698_103164243 186
224 3300037853 Ga0436364_0862120 Ga0436364_0862120_1843_2409 186
225 3300044658 Ga0466972_0319000 Ga0466972_0319000_143_709 186
226 3300045976 Ga0466967_0689817 Ga0466967_0689817_194_760 186
227 3300046473 Ga0495582_0383962 Ga0495582_0383962_203_772 186
228 3300048904 Ga0496101_0087714 Ga0496101_0087714_1112_1672 186
229 3300048905 Ga0496102_0053184 Ga0496102_0053184_2956_3516 186
230 3300048907 Ga0496104_0006038 Ga0496104_0006038_9586_10146 186
231 3300048910 Ga0496107_0010876 Ga0496107_0010876_1461_2021 186
232 3300048911 Ga0496108_0440964 Ga0496108_0440964_484_1044 186
233 3300048912 Ga0496109_0183933 Ga0496109_0183933_1099_1659 186
234 3300048913 Ga0496110_0152796 Ga0496110_0152796_18_578 186
235 3300048914 Ga0496111_0216329 Ga0496111_0216329_132_692 186
236 3300048915 Ga0496112_0131324 Ga0496112_0131324_633_1193 186
237 3300048916 Ga0496113_0013805 Ga0496113_0013805_4808_5368 186
238 3300050507 nmdc:mga05p37_46687_c1 nmdc:mga05p37_46687_c1_248_808 186
239 3300050509 nmdc:mga0qj67_634494_c1 nmdc:mga0qj67_634494_c1_103_663 186
240 3300005329 Ga0070683_100033499 Ga0070683_1000334993 187
241 3300005535 Ga0070684_100029673 Ga0070684_1000296733 187
242 3300025944 Ga0207661_10025244 Ga0207661_100252443 187
243 3300048911 Ga0496108_0987278 Ga0496108_0987278_38_601 187
244 3300005937 Ga0081455_10015444 Ga0081455_100154446 188
245 3300005985 Ga0081539_10050419 Ga0081539_100504192 188
246 3300037466 Ga0395898_0144017 Ga0395898_0144017_248_814 188
247 3300044694 Ga0466963_0003791 Ga0466963_0003791_8094_8660 188
248 3300044735 Ga0466968_0225269 Ga0466968_0225269_302_868 188
249 3300044765 Ga0466970_0273339 Ga0466970_0273339_364_930 188
250 3300045049 Ga0466959_0051771 Ga0466959_0051771_2133_2699 188
251 3300045836 Ga0466958_0104253 Ga0466958_0104253_1175_1741 188
252 3300005435 Ga0070714_100190981 Ga0070714_1001909812 189
253 3300005535 Ga0070684_100420835 Ga0070684_1004208352 189
254 3300006175 Ga0070712_100000009 Ga0070712_10000000965 189
255 3300021377 Ga0213874_10077175 Ga0213874_100771752 189
256 3300025915 Ga0207693_10000036 Ga0207693_10000036102 189
257 3300025929 Ga0207664_10003062 Ga0207664_100030622 189
258 3300039438 Ga0436360_0129696 Ga0436360_0129696_497_1066 189
259 3300039450 Ga0436363_1714030 Ga0436363_1714030_390_965 189
260 3300039453 Ga0436362_0408945 Ga0436362_0408945_23_598 189
261 3300048903 Ga0496100_0017626 Ga0496100_0017626_3548_4129 189
262 3300048904 Ga0496101_0005401 Ga0496101_0005401_177_758 189
263 3300048915 Ga0496112_0000280 Ga0496112_0000280_1487_2062 189
264 3300049568 Ga0501031_0130757 Ga0501031_0130757_909_1499 189
265 3300049575 Ga0501039_0033261 Ga0501039_0033261_1766_2356 189
266 3300049590 Ga0501074_0022175 Ga0501074_0022175_1398_1988 189
267 3300049590 Ga0501074_0064369 Ga0501074_0064369_302_871 189
268 3300049822 Ga0501035_0457760 Ga0501035_0457760_201_791 189
269 3300049824 Ga0501045_0040263 Ga0501045_0040263_1044_1634 189
270 3300054114 Ga0501084_0439912 Ga0501084_0439912_41_631 189
271 3300061734 Ga0530510_0123464 Ga0530510_0123464_58_648 189
272 3300005457 Ga0070662_100273435 Ga0070662_1002734352 190
273 3300013306 Ga0163162_10090995 Ga0163162_100909952 190
274 3300025933 Ga0207706_10332898 Ga0207706_103328982 190
275 3300026118 Ga0207675_100051794 Ga0207675_1000517942 190
276 3300039450 Ga0436363_1596394 Ga0436363_1596394_1770_2342 190
277 3300044719 Ga0466971_0010962 Ga0466971_0010962_2685_3263 190
278 3300049572 Ga0501036_0136696 Ga0501036_0136696_1261_1845 190
279 3300049575 Ga0501039_0109334 Ga0501039_0109334_273_857 190
280 3300049578 Ga0501042_0295932 Ga0501042_0295932_83_667 190
281 3300049582 Ga0501048_0151167 Ga0501048_0151167_210_794 190
282 3300049587 Ga0501071_0536159 Ga0501071_0536159_232_816 190
283 3300049588 Ga0501072_0063833 Ga0501072_0063833_1291_1875 190
284 3300049591 Ga0501075_0101395 Ga0501075_0101395_354_938 190
285 3300049592 Ga0501076_0184457 Ga0501076_0184457_710_1294 190
286 3300049741 Ga0501079_0359803 Ga0501079_0359803_83_667 190
287 3300049743 Ga0501081_0465080 Ga0501081_0465080_246_830 190
288 3300053078 Ga0495612_0014955 Ga0495612_0014955_2111_2683 190
289 3300054114 Ga0501084_0015521 Ga0501084_0015521_4761_5345 190
290 3300060353 Ga0501082_0204202 Ga0501082_0204202_1073_1657 190
291 3300061734 Ga0530510_0014140 Ga0530510_0014140_1050_1634 190
292 3300005327 Ga0070658_10135455 Ga0070658_101354553 191
293 3300005336 Ga0070680_100950612 Ga0070680_1009506121 191
294 3300006847 Ga0075431_100089606 Ga0075431_1000896062 191
295 3300006852 Ga0075433_10013755 Ga0075433_100137553 191
296 3300006871 Ga0075434_100011004 Ga0075434_1000110049 191
297 3300006914 Ga0075436_100535926 Ga0075436_1005359261 191
298 3300007076 Ga0075435_100006731 Ga0075435_1000067314 191
299 3300009094 Ga0111539_10057839 Ga0111539_100578392 191
300 3300009147 Ga0114129_10057077 Ga0114129_100570773 191
301 3300027907 Ga0207428_10012694 Ga0207428_100126942 191
302 3300039450 Ga0436363_0625571 Ga0436363_0625571_211_786 191
303 3300050510 nmdc:mga06r32_430205_c1 nmdc:mga06r32_430205_c1_402_977 191
304 3300050511 nmdc:mga08y16_21880_c1 nmdc:mga08y16_21880_c1_5216_5791 191
305 3300050512 nmdc:mga0n895_42912_c1 nmdc:mga0n895_42912_c1_2798_3373 191
306 3300050513 nmdc:mga0rr50_60881_c1 nmdc:mga0rr50_60881_c1_1226_1801 191
307 3300050514 nmdc:mga08x19_156014_c1 nmdc:mga08x19_156014_c1_210_785 191
308 3300005548 Ga0070665_100006869 Ga0070665_1000068693 192
309 3300005614 Ga0068856_100654076 Ga0068856_1006540761 192
310 3300005841 Ga0068863_100375858 Ga0068863_1003758582 192
311 3300005985 Ga0081539_10006689 Ga0081539_100066894 192
312 3300013307 Ga0157372_10412823 Ga0157372_104128232 192
313 3300021384 Ga0213876_10266556 Ga0213876_102665562 192
314 3300025915 Ga0207693_10530117 Ga0207693_105301172 192
315 3300025939 Ga0207665_10384417 Ga0207665_103844172 192
316 3300026088 Ga0207641_10352626 Ga0207641_103526262 192
317 3300035171 Ga0373946_0046393 Ga0373946_0046393_64_648 192
318 3300035692 Ga0373935_0071956 Ga0373935_0071956_1081_1665 192
319 3300035725 Ga0373947_0052191 Ga0373947_0052191_1399_1983 192
320 3300037312 Ga0395899_0232217 Ga0395899_0232217_630_1208 192
321 3300037853 Ga0436364_0121607 Ga0436364_0121607_4534_5112 192
322 3300039437 Ga0436365_0458644 Ga0436365_0458644_931_1509 192
323 3300039437 Ga0436365_1529058 Ga0436365_1529058_294_878 192
324 3300045836 Ga0466958_0064999 Ga0466958_0064999_158_742 192
325 3300046455 Ga0495603_0016459 Ga0495603_0016459_1180_1764 192
326 3300046457 Ga0495590_0065293 Ga0495590_0065293_304_891 192
327 3300046461 Ga0495641_0101448 Ga0495641_0101448_650_1234 192
328 3300046473 Ga0495582_0053867 Ga0495582_0053867_468_1052 192
329 3300048903 Ga0496100_0031314 Ga0496100_0031314_1614_2198 192
330 3300048904 Ga0496101_0185279 Ga0496101_0185279_163_747 192
331 3300048905 Ga0496102_0041690 Ga0496102_0041690_183_767 192
332 3300048909 Ga0496106_0286403 Ga0496106_0286403_496_1080 192
333 3300048910 Ga0496107_0079821 Ga0496107_0079821_1759_2343 192
334 3300048912 Ga0496109_0026666 Ga0496109_0026666_864_1448 192
335 3300048913 Ga0496110_1183632 Ga0496110_1183632_73_657 192
336 3300048915 Ga0496112_1409493 Ga0496112_1409493_14_598 192
337 3300048916 Ga0496113_0109984 Ga0496113_0109984_1498_2082 192
338 3300048918 Ga0496115_0003871 Ga0496115_0003871_9438_10022 192
339 3300049581 Ga0501047_0008438 Ga0501047_0008438_4039_4620 192
340 3300049588 Ga0501072_0275343 Ga0501072_0275343_675_1292 192
341 3300049590 Ga0501074_0048104 Ga0501074_0048104_619_1200 192
342 3300049822 Ga0501035_0196383 Ga0501035_0196383_946_1527 192
343 3300039437 Ga0436365_1641005 Ga0436365_1641005_89_688 193
344 3300044684 Ga0466966_0648420 Ga0466966_0648420_32_613 193
345 3300046678 Ga0495599_0160689 Ga0495599_0160689_335_922 193
346 3300053085 Ga0495619_0000001 Ga0495619_0000001_67296_67919 193
347 3300061719 Ga0466962_0183729 Ga0466962_0183729_349_930 193
348 3300005842 Ga0068858_100000033 Ga0068858_100000033129 194
349 3300006847 Ga0075431_100002773 Ga0075431_1000027736 194
350 3300006880 Ga0075429_100503321 Ga0075429_1005033212 194
351 3300009147 Ga0114129_11306713 Ga0114129_113067132 194
352 3300026035 Ga0207703_10000126 Ga0207703_1000012664 194
353 3300037853 Ga0436364_0600268 Ga0436364_0600268_773_1357 194
354 3300039450 Ga0436363_0274208 Ga0436363_0274208_560_1144 194
355 3300050508 nmdc:mga09592_278746_c1 nmdc:mga09592_278746_c1_665_1249 194
356 3300050509 nmdc:mga0qj67_10738_c1 nmdc:mga0qj67_10738_c1_1844_2428 194
357 3300050510 nmdc:mga06r32_3426_c1 nmdc:mga06r32_3426_c1_10686_11270 194
358 3300005338 Ga0068868_100177412 Ga0068868_1001774123 195
359 3300005614 Ga0068856_100101676 Ga0068856_1001016763 195
360 3300005617 Ga0068859_100516892 Ga0068859_1005168921 195
361 3300005841 Ga0068863_100622809 Ga0068863_1006228092 195
362 3300005843 Ga0068860_100911582 Ga0068860_1009115822 195
363 3300006175 Ga0070712_100005927 Ga0070712_1000059272 195
364 3300006881 Ga0068865_100093180 Ga0068865_1000931802 195
365 3300006931 Ga0097620_100516803 Ga0097620_1005168031 195
366 3300009098 Ga0105245_10022774 Ga0105245_100227743 195
367 3300009148 Ga0105243_10545204 Ga0105243_105452041 195
368 3300009176 Ga0105242_10036173 Ga0105242_100361733 195
369 3300011119 Ga0105246_10108585 Ga0105246_101085853 195
370 3300013306 Ga0163162_10462771 Ga0163162_104627712 195
371 3300013307 Ga0157372_10923456 Ga0157372_109234562 195
372 3300013308 Ga0157375_10069504 Ga0157375_100695043 195
373 3300014968 Ga0157379_10469855 Ga0157379_104698551 195
374 3300014969 Ga0157376_10349945 Ga0157376_103499452 195
375 3300021384 Ga0213876_10001692 Ga0213876_1000169211 195
376 3300025885 Ga0207653_10015735 Ga0207653_100157352 195
377 3300025926 Ga0207659_10745965 Ga0207659_107459652 195
378 3300025934 Ga0207686_10306419 Ga0207686_103064192 195
379 3300025949 Ga0207667_11348227 Ga0207667_113482271 195
380 3300025981 Ga0207640_10091768 Ga0207640_100917683 195
381 3300026023 Ga0207677_10137194 Ga0207677_101371941 195
382 3300026023 Ga0207677_10178403 Ga0207677_101784032 195
383 3300026075 Ga0207708_10081973 Ga0207708_100819732 195
384 3300026089 Ga0207648_10235284 Ga0207648_102352842 195
385 3300026142 Ga0207698_10379178 Ga0207698_103791782 195
386 3300028381 Ga0268264_10159978 Ga0268264_101599782 195
387 3300035691 Ga0373931_0188323 Ga0373931_0188323_500_1108 195
388 3300039437 Ga0436365_1326776 Ga0436365_1326776_4485_5072 195
389 3300039453 Ga0436362_0818206 Ga0436362_0818206_49_636 195
390 3300039453 Ga0436362_1117690 Ga0436362_1117690_199_786 195
391 3300046463 Ga0495653_0425943 Ga0495653_0425943_193_780 195
392 3300046511 Ga0495608_0431739 Ga0495608_0431739_165_752 195
393 3300048089 Ga0495614_0149664 Ga0495614_0149664_80_688 195
394 3300048903 Ga0496100_0053694 Ga0496100_0053694_822_1430 195
395 3300048904 Ga0496101_0025466 Ga0496101_0025466_3476_4072 195
396 3300048904 Ga0496101_0184080 Ga0496101_0184080_165_773 195
397 3300048905 Ga0496102_0008106 Ga0496102_0008106_6358_6966 195
398 3300048905 Ga0496102_0024794 Ga0496102_0024794_3826_4422 195
399 3300048906 Ga0496103_0019175 Ga0496103_0019175_832_1440 195
400 3300048906 Ga0496103_0094111 Ga0496103_0094111_602_1198 195
401 3300048907 Ga0496104_0038267 Ga0496104_0038267_869_1477 195
402 3300048908 Ga0496105_0020740 Ga0496105_0020740_3014_3622 195
403 3300048908 Ga0496105_0067371 Ga0496105_0067371_1017_1613 195
404 3300048909 Ga0496106_0053599 Ga0496106_0053599_1358_1966 195
405 3300048910 Ga0496107_0001376 Ga0496107_0001376_6480_7088 195
406 3300048910 Ga0496107_0062529 Ga0496107_0062529_1892_2488 195
407 3300048911 Ga0496108_0066973 Ga0496108_0066973_1681_2277 195
408 3300048912 Ga0496109_0000682 Ga0496109_0000682_11480_12076 195
409 3300048912 Ga0496109_0071347 Ga0496109_0071347_457_1065 195
410 3300048913 Ga0496110_0009173 Ga0496110_0009173_1035_1631 195
411 3300048913 Ga0496110_0010612 Ga0496110_0010612_6322_6930 195
412 3300048914 Ga0496111_0009605 Ga0496111_0009605_5081_5677 195
413 3300048914 Ga0496111_0072293 Ga0496111_0072293_1846_2454 195
414 3300048915 Ga0496112_0282299 Ga0496112_0282299_259_855 195
415 3300048916 Ga0496113_0002300 Ga0496113_0002300_868_1464 195
416 3300048916 Ga0496113_0210272 Ga0496113_0210272_206_814 195
417 3300048917 Ga0496114_0085321 Ga0496114_0085321_1191_1799 195
418 3300048918 Ga0496115_0031050 Ga0496115_0031050_3014_3622 195
419 3300026035 Ga0207703_10501526 Ga0207703_105015262 196
420 3300044694 Ga0466963_0506035 Ga0466963_0506035_184_777 196
421 3300047320 Ga0495672_0034878 Ga0495672_0034878_1601_2203 196
422 3300048907 Ga0496104_0044869 Ga0496104_0044869_1073_1672 197
423 3300048908 Ga0496105_0043552 Ga0496105_0043552_2232_2831 197
424 3300048912 Ga0496109_0263147 Ga0496109_0263147_277_876 197
425 3300048914 Ga0496111_0095622 Ga0496111_0095622_64_663 197
426 3300048922 Ga0496119_0009607 Ga0496119_0009607_3009_3608 197
427 3300048924 Ga0496121_0015041 Ga0496121_0015041_3925_4524 197
428 3300048928 Ga0496125_0080295 Ga0496125_0080295_1345_1944 197
429 3300002239 JGI24034J26672_10000084 JGI24034J26672_1000008414 198
430 3300002244 JGI24742J22300_10003839 JGI24742J22300_100038393 198
431 3300009176 Ga0105242_10000331 Ga0105242_1000033112 198
432 3300013308 Ga0157375_10000153 Ga0157375_1000015326 198
433 3300025899 Ga0207642_10021915 Ga0207642_100219153 198
434 3300025934 Ga0207686_10000032 Ga0207686_10000032109 198
435 3300046459 Ga0495629_0004008 Ga0495629_0004008_8556_9155 198
436 3300046517 Ga0495630_0297916 Ga0495630_0297916_14_613 198
437 3300047319 Ga0495674_0000020 Ga0495674_0000020_46621_47217 198
438 3300047321 Ga0495676_0010921 Ga0495676_0010921_4395_4994 198
439 3300047444 Ga0495675_0015544 Ga0495675_0015544_53_649 198
440 3300048905 Ga0496102_0000045 Ga0496102_0000045_118229_118828 198
441 3300048906 Ga0496103_0000050 Ga0496103_0000050_33205_33804 198
442 3300049588 Ga0501072_0711728 Ga0501072_0711728_16_621 198
443 3300049743 Ga0501081_0316398 Ga0501081_0316398_352_948 198
444 3300053083 Ga0495655_0000004 Ga0495655_0000004_109917_110516 198
445 3300053096 Ga0500641_0006324 Ga0500641_0006324_163_759 198
446 3300053129 Ga0500628_000004 Ga0500628_000004_18332_18931 198
447 3300005985 Ga0081539_10001198 Ga0081539_1000119841 199
448 3300006846 Ga0075430_100042081 Ga0075430_1000420813 199
449 3300046499 Ga0495594_0000007 Ga0495594_0000007_30252_30854 199
450 3300046535 Ga0495586_0000501 Ga0495586_0000501_12482_13126 199
451 3300046557 Ga0495622_0000050 Ga0495622_0000050_77790_78392 199
452 3300048088 Ga0495602_0057072 Ga0495602_0057072_369_968 199
453 3300050509 nmdc:mga0qj67_26802_c1 nmdc:mga0qj67_26802_c1_1369_1968 199
454 3300005983 Ga0081540_1000106 Ga0081540_100010675 200
455 3300046460 Ga0495638_0016581 Ga0495638_0016581_405_1007 200
456 3300046529 Ga0495652_0000003 Ga0495652_0000003_163625_164227 200
457 3300005544 Ga0070686_100832532 Ga0070686_1008325321 201
458 3300046516 Ga0495628_0461664 Ga0495628_0461664_57_665 201
459 3300046615 Ga0495656_0000182 Ga0495656_0000182_19328_19933 201
460 3300050515 nmdc:mga0a205_760_c1 nmdc:mga0a205_760_c1_9295_9906 202
461 3300005457 Ga0070662_100000038 Ga0070662_10000003825 203
462 3300009176 Ga0105242_10087133 Ga0105242_100871332 203
463 3300025933 Ga0207706_10000026 Ga0207706_10000026130 203
464 3300025934 Ga0207686_10194323 Ga0207686_101943232 203
465 3300048911 Ga0496108_0007220 Ga0496108_0007220_5497_6114 204
466 3300048912 Ga0496109_0000286 Ga0496109_0000286_9819_10436 204
467 3300001977 JGI24746J21847_1000014 JGI24746J21847_100001413 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

12

189

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9292 21 197
5gvz-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from vibrio cholerae in space group c2221 at resolution 1.75a. 0.9282 20 195
3nea-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from francisella tularensis 0.9223 22 196
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9212 21 197
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9178 21 198
ID Description Score Start End Superfamily
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9223 22 196 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9167 21 198 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9137 21 196 3.40.50.1470
5zx8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9059 21 196 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.902 22 197 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A7K0RA82-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9945 91 196 GO:0004045
AF-A0A519GXZ6-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.963 21 150 GO:0004045
AF-A0A7C1P4V1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.962 22 177 GO:0004045
GO:0005737
GO:0006412
AF-A0A538GP38-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9616 22 158 GO:0004045
AF-A0A0W8FRU4-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9594 21 196 GO:0004045

Feature Viewer

pLDDT pTM Quality
90.18 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map