F449851

General Info

Members Datasets Scaffolds Average Seq Length
467 243 467 165

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10128863|Ga0157373_101288632
Length 197
Sequence LSISGTVVRRHHERDSDAQFRRLCAAAREENRKMSDTKSSRKIAACLWFDGQAEEAANFYASTFPDSRVDAVHRSPGDYPAGRQGNVLTVEFTVLGMPFLGLNGGPQFRFDEAISFQVYTNDQAETDRLWNAIVGNGGAESECGWCKDKFGLSWQITPRALMEAIADPDPAAAKRAFEAMMTMQKIDIARIEAARRG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
211 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
212 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
229 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
230 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
237 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.29
Metatranscriptomes 4.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0
Rhizoplane 0.64
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001000 3300001979 Bacteria 12649
2 JGI24740J21852_10010053 3300001979 Bacteria 3665
3 JGI24739J22299_10096330 3300001989 Bacteria 896
4 JGI24737J22298_10006419 3300001990 Bacteria 4018
5 JGI24735J21928_10007377 3300002067 Bacteria 3588
6 JGI24735J21928_10011739 3300002067 Bacteria 2774
7 JGI24735J21928_10043238 3300002067 Bacteria 1311
8 JGI24735J21928_10120692 3300002067 Bacteria 754
9 JGI24738J21930_10017063 3300002075 Bacteria 1528
10 JGI24744J21845_10000104 3300002077 Bacteria 11338
11 JGI25165J46597_1000188 3300003214 Bacteria 92329
12 rootH2_10008309 3300003320 Bacteria 1265
13 rootL2_10034896 3300003322 Bacteria 1873
14 Ga0007429J51699_1082464 3300003579 Bacteria 905
15 Ga0058863_11547771 3300004799 Bacteria 618
16 Ga0058861_11766172 3300004800 Bacteria 675
17 Ga0065704_10432797 3300005289 Bacteria 721
18 Ga0065712_10000527 3300005290 Bacteria 10260
19 Ga0065715_10124680 3300005293 Bacteria 2139
20 Ga0070658_10013081 3300005327 Bacteria 6658
21 Ga0070658_10233129 3300005327 Bacteria 1559
22 Ga0070658_10311262 3300005327 Bacteria 1344
23 Ga0070658_10481869 3300005327 Bacteria 1071
24 Ga0070658_10712364 3300005327 Bacteria 871
25 Ga0070658_10781911 3300005327 Bacteria 829
26 Ga0070658_10979540 3300005327 Bacteria 735
27 Ga0070658_11024387 3300005327 Bacteria 718
28 Ga0070676_10705045 3300005328 Bacteria 737
29 Ga0070683_100018440 3300005329 Bacteria 6182
30 Ga0070683_100034374 3300005329 Bacteria 4630
31 Ga0070683_100062199 3300005329 Bacteria 3471
32 Ga0070683_100065304 3300005329 Bacteria 3388
33 Ga0070683_100121922 3300005329 Bacteria 2463
34 Ga0070670_100661835 3300005331 Bacteria 937
35 Ga0068869_101429901 3300005334 Bacteria 613
36 Ga0070680_100007355 3300005336 Bacteria 8403
37 Ga0070680_100008855 3300005336 Bacteria 7714
38 Ga0070680_100087119 3300005336 Bacteria 2582
39 Ga0070680_100886626 3300005336 Bacteria 769
40 Ga0070682_100094197 3300005337 Bacteria 1964
41 Ga0070682_100126730 3300005337 Bacteria 1722
42 Ga0070660_100085991 3300005339 Bacteria 2474
43 Ga0070660_100156370 3300005339 Bacteria 1835
44 Ga0070660_100414809 3300005339 Bacteria 1114
45 Ga0070660_100504219 3300005339 Bacteria 1007
46 Ga0070660_100605626 3300005339 Bacteria 916
47 Ga0070660_100665703 3300005339 Bacteria 872
48 Ga0070660_100793600 3300005339 Bacteria 796
49 Ga0070689_100403565 3300005340 Bacteria 1156
50 Ga0070691_10040329 3300005341 Bacteria 2206
51 Ga0070661_100003819 3300005344 Bacteria 10369
52 Ga0070661_100004727 3300005344 Bacteria 9370
53 Ga0070661_100010594 3300005344 Bacteria 6413
54 Ga0070661_100028578 3300005344 Bacteria 4022
55 Ga0070661_100028872 3300005344 Bacteria 4003
56 Ga0070692_10000966 3300005345 Bacteria 9816
57 Ga0070692_10008661 3300005345 Bacteria 4547
58 Ga0070692_10065987 3300005345 Bacteria 1917
59 Ga0070692_10129860 3300005345 Bacteria 1415
60 Ga0070668_100000820 3300005347 Bacteria 21417
61 Ga0070675_100030023 3300005354 Bacteria 4386
62 Ga0070675_100047742 3300005354 Bacteria 3509
63 Ga0070671_100068279 3300005355 Bacteria 2965
64 Ga0070673_100327665 3300005364 Bacteria 1354
65 Ga0070688_100084429 3300005365 Bacteria 2063
66 Ga0070688_100510996 3300005365 Bacteria 908
67 Ga0070659_100057669 3300005366 Bacteria 3063
68 Ga0070659_100076155 3300005366 Bacteria 2676
69 Ga0070659_100107139 3300005366 Bacteria 2253
70 Ga0070659_100109825 3300005366 Bacteria 2226
71 Ga0070659_100212792 3300005366 Bacteria 1593
72 Ga0070667_100006437 3300005367 Bacteria 9760
73 Ga0070714_100430512 3300005435 Bacteria 1251
74 Ga0070705_100149017 3300005440 Bacteria 1550
75 Ga0070700_100093330 3300005441 Bacteria 1968
76 Ga0070663_100001177 3300005455 Bacteria 14396
77 Ga0070663_100038384 3300005455 Bacteria 3341
78 Ga0070663_100105956 3300005455 Bacteria 2105
79 Ga0070663_101277973 3300005455 Bacteria 647
80 Ga0070663_101291640 3300005455 Bacteria 644
81 Ga0070678_100013956 3300005456 Bacteria 5053
82 Ga0070678_101551873 3300005456 Bacteria 621
83 Ga0070662_100182942 3300005457 Bacteria 1653
84 Ga0070662_100340481 3300005457 Bacteria 1227
85 Ga0070681_10000086 3300005458 Bacteria 70488
86 Ga0070681_10000367 3300005458 Bacteria 36431
87 Ga0070681_10004173 3300005458 Bacteria 13674
88 Ga0070681_11120662 3300005458 Bacteria 708
89 Ga0068867_100094567 3300005459 Bacteria 2273
90 Ga0070699_100102082 3300005518 Bacteria 2515
91 Ga0070679_100000042 3300005530 Bacteria 95394
92 Ga0070679_100003917 3300005530 Bacteria 13691
93 Ga0070679_100017474 3300005530 Bacteria 6943
94 Ga0070679_100314945 3300005530 Bacteria 1514
95 Ga0070684_100008251 3300005535 Bacteria 8141
96 Ga0070684_100054958 3300005535 Bacteria 3469
97 Ga0070684_100281579 3300005535 Bacteria 1523
98 Ga0070684_100583090 3300005535 Bacteria 1039
99 Ga0068853_100104881 3300005539 Bacteria 2503
100 Ga0068853_100466156 3300005539 Bacteria 1189
101 Ga0070672_100031388 3300005543 Bacteria 3998
102 Ga0070696_100029197 3300005546 Bacteria 3767
103 Ga0070696_100100009 3300005546 Bacteria 2076
104 Ga0070696_100312487 3300005546 Bacteria 1207
105 Ga0070665_100000300 3300005548 Bacteria 77545
106 Ga0070665_100895664 3300005548 Bacteria 900
107 Ga0068855_100026700 3300005563 Bacteria 6909
108 Ga0068855_100084281 3300005563 Bacteria 3680
109 Ga0068855_100292035 3300005563 Bacteria 1807
110 Ga0068855_100310917 3300005563 Bacteria 1743
111 Ga0068855_100598387 3300005563 Bacteria 1189
112 Ga0070664_100062410 3300005564 Bacteria 3177
113 Ga0070664_100091429 3300005564 Bacteria 2634
114 Ga0068857_100000273 3300005577 Bacteria 35218
115 Ga0068857_100065039 3300005577 Bacteria 3242
116 Ga0068857_101073514 3300005577 Bacteria 777
117 Ga0068854_100030324 3300005578 Bacteria 3751
118 Ga0068854_100049186 3300005578 Bacteria 3011
119 Ga0068854_100111931 3300005578 Bacteria 2060
120 Ga0068854_100124899 3300005578 Bacteria 1958
121 Ga0068854_100367061 3300005578 Bacteria 1182
122 Ga0068854_100966647 3300005578 Bacteria 752
123 Ga0068856_100002333 3300005614 Bacteria 19522
124 Ga0068856_100040462 3300005614 Bacteria 4579
125 Ga0068856_100043573 3300005614 Bacteria 4415
126 Ga0068852_100008791 3300005616 Bacteria 7473
127 Ga0068852_100165225 3300005616 Bacteria 2070
128 Ga0068852_100805601 3300005616 Bacteria 953
129 Ga0068864_100000233 3300005618 Bacteria 49794
130 Ga0068864_100198275 3300005618 Bacteria 1843
131 Ga0068861_100365652 3300005719 Bacteria 1270
132 Ga0068851_10542861 3300005834 Bacteria 702
133 Ga0068863_100764238 3300005841 Bacteria 963
134 Ga0068858_100002166 3300005842 Bacteria 19926
135 Ga0068862_100036084 3300005844 Bacteria 4188
136 Ga0070717_10003812 3300006028 Bacteria 10845
137 Ga0075366_10012836 3300006195 Bacteria 4762
138 Ga0097621_100224879 3300006237 Bacteria 1636
139 Ga0075370_10113635 3300006353 Bacteria 1573
140 Ga0068871_100544621 3300006358 Bacteria 1050
141 Ga0075430_100305892 3300006846 Bacteria 1315
142 Ga0075433_10188628 3300006852 Bacteria 1834
143 Ga0075434_100055168 3300006871 Bacteria 3949
144 Ga0068865_100147099 3300006881 Bacteria 1783
145 Ga0068865_100620725 3300006881 Bacteria 916
146 Ga0105251_10068737 3300009011 Bacteria 1653
147 Ga0105250_10118257 3300009092 Bacteria 1088
148 Ga0105240_10000364 3300009093 Bacteria 84889
149 Ga0105240_10016005 3300009093 Bacteria 10166
150 Ga0105240_10125497 3300009093 Bacteria 3085
151 Ga0105240_10320625 3300009093 Bacteria 1766
152 Ga0105240_10963063 3300009093 Bacteria 915
153 Ga0111539_10273999 3300009094 Bacteria 1964
154 Ga0111539_10494409 3300009094 Bacteria 1425
155 Ga0105245_10031278 3300009098 Bacteria 4709
156 Ga0114129_10328140 3300009147 Bacteria 2033
157 Ga0105243_10014770 3300009148 Bacteria 5908
158 Ga0105248_10004882 3300009177 Bacteria 14819
159 Ga0105237_10241991 3300009545 Bacteria 1805
160 Ga0105238_10006424 3300009551 Bacteria 11693
161 Ga0105238_10011163 3300009551 Bacteria 9035
162 Ga0105249_10068464 3300009553 Bacteria 3274
163 Ga0105249_10462513 3300009553 Bacteria 1309
164 Ga0105249_10913181 3300009553 Bacteria 945
165 Ga0105246_10037029 3300011119 Bacteria 3272
166 Ga0105246_11295321 3300011119 Bacteria 675
167 Ga0157373_10019934 3300013100 Bacteria 4878
168 Ga0157373_10021479 3300013100 Bacteria 4688
169 Ga0157373_10047652 3300013100 Bacteria 3056
170 Ga0157373_10128863 3300013100 Bacteria 1779
171 Ga0157371_10128316 3300013102 Bacteria 1804
172 Ga0157371_10576728 3300013102 Bacteria 835
173 Ga0157371_11031118 3300013102 Bacteria 629
174 Ga0157370_10000203 3300013104 Bacteria 75249
175 Ga0157370_10004632 3300013104 Bacteria 15728
176 Ga0157370_10006036 3300013104 Bacteria 13469
177 Ga0157370_10324346 3300013104 Bacteria 1420
178 Ga0157370_10506788 3300013104 Bacteria 1108
179 Ga0157370_10828000 3300013104 Bacteria 842
180 Ga0157369_10011504 3300013105 Bacteria 10051
181 Ga0157369_10694488 3300013105 Bacteria 1048
182 Ga0157374_10023048 3300013296 Bacteria 5563
183 Ga0157374_10668149 3300013296 Bacteria 1051
184 Ga0163162_10048683 3300013306 Bacteria 4248
185 Ga0157372_10007026 3300013307 Bacteria 11990
186 Ga0157372_10013070 3300013307 Bacteria 8856
187 Ga0157372_10053512 3300013307 Bacteria 4499
188 Ga0157372_10264173 3300013307 Bacteria 1999
189 Ga0157375_10649058 3300013308 Bacteria 1212
190 Ga0157375_10663418 3300013308 Bacteria 1198
191 Ga0163163_10011891 3300014325 Bacteria 7916
192 Ga0163163_10115426 3300014325 Bacteria 2716
193 Ga0163163_10255872 3300014325 Bacteria 1802
194 Ga0157377_10011785 3300014745 Bacteria 4374
195 Ga0157377_10140441 3300014745 Bacteria 1484
196 Ga0157379_11326623 3300014968 Bacteria 695
197 Ga0163161_10190176 3300017792 Bacteria 1578
198 Ga0197907_11150113 3300020069 Bacteria 953
199 Ga0206356_10135216 3300020070 Bacteria 2554
200 Ga0206356_10160926 3300020070 Bacteria 1960
201 Ga0206351_10334359 3300020077 Bacteria 2161
202 Ga0206352_10368699 3300020078 Bacteria 813
203 Ga0206352_11322884 3300020078 Bacteria 724
204 Ga0206350_11257343 3300020080 Bacteria 1153
205 Ga0206354_10180519 3300020081 Bacteria 2993
206 Ga0206354_10790502 3300020081 Bacteria 1452
207 Ga0206353_10024612 3300020082 Bacteria 1145
208 Ga0206353_10076734 3300020082 Bacteria 2058
209 Ga0206353_10869725 3300020082 Bacteria 1577
210 Ga0206353_10949658 3300020082 Bacteria 5922
211 Ga0154015_1114440 3300020610 Bacteria 4949
212 Ga0207427_100914 3300025231 Bacteria 12723
213 Ga0209026_1000692 3300025250 Bacteria 20096
214 Ga0209148_1002506 3300025254 Bacteria 6194
215 Ga0209233_1000120 3300025261 Bacteria 233311
216 Ga0209455_1001552 3300025272 Bacteria 10177
217 Ga0207697_10025017 3300025315 Bacteria 2442
218 Ga0207656_10036949 3300025321 Bacteria 2052
219 Ga0207656_10303620 3300025321 Bacteria 790
220 Ga0207688_10103304 3300025901 Bacteria 1648
221 Ga0207688_10224708 3300025901 Bacteria 1132
222 Ga0207688_10386113 3300025901 Bacteria 867
223 Ga0207647_10017703 3300025904 Bacteria 4839
224 Ga0207647_10019991 3300025904 Bacteria 4495
225 Ga0207647_10057050 3300025904 Bacteria 2395
226 Ga0207647_10101912 3300025904 Bacteria 1703
227 Ga0207647_10223691 3300025904 Bacteria 1084
228 Ga0207645_10378786 3300025907 Bacteria 949
229 Ga0207645_10501142 3300025907 Bacteria 822
230 Ga0207705_10004233 3300025909 Bacteria 10866
231 Ga0207705_10004292 3300025909 Bacteria 10792
232 Ga0207705_10018173 3300025909 Bacteria 5026
233 Ga0207705_10018772 3300025909 Bacteria 4947
234 Ga0207705_10020786 3300025909 Bacteria 4684
235 Ga0207705_10294957 3300025909 Bacteria 1243
236 Ga0207705_10636946 3300025909 Bacteria 829
237 Ga0207707_10000306 3300025912 Bacteria 51447
238 Ga0207707_10000364 3300025912 Bacteria 47458
239 Ga0207707_10000538 3300025912 Bacteria 38641
240 Ga0207707_10003720 3300025912 Bacteria 13505
241 Ga0207707_10013492 3300025912 Bacteria 7120
242 Ga0207707_10022731 3300025912 Bacteria 5483
243 Ga0207707_10114193 3300025912 Bacteria 2360
244 Ga0207695_10000369 3300025913 Bacteria 103133
245 Ga0207695_10005706 3300025913 Bacteria 16411
246 Ga0207695_10099938 3300025913 Bacteria 2898
247 Ga0207695_10161651 3300025913 Bacteria 2171
248 Ga0207695_10214026 3300025913 Bacteria 1837
249 Ga0207695_10866429 3300025913 Bacteria 783
250 Ga0207695_11093235 3300025913 Bacteria 677
251 Ga0207660_10001210 3300025917 Bacteria 17256
252 Ga0207660_10006274 3300025917 Bacteria 7714
253 Ga0207660_10023683 3300025917 Bacteria 4149
254 Ga0207660_10026198 3300025917 Bacteria 3969
255 Ga0207660_10122993 3300025917 Bacteria 1967
256 Ga0207657_10028002 3300025919 Bacteria 5150
257 Ga0207657_10067021 3300025919 Bacteria 3054
258 Ga0207657_10100166 3300025919 Bacteria 2406
259 Ga0207657_10217247 3300025919 Bacteria 1533
260 Ga0207657_10264457 3300025919 Bacteria 1368
261 Ga0207657_10579335 3300025919 Bacteria 876
262 Ga0207657_10669690 3300025919 Bacteria 807
263 Ga0207649_10012151 3300025920 Bacteria 4768
264 Ga0207649_10014937 3300025920 Bacteria 4358
265 Ga0207649_10045755 3300025920 Bacteria 2685
266 Ga0207649_10076142 3300025920 Bacteria 2158
267 Ga0207649_10080553 3300025920 Bacteria 2106
268 Ga0207652_10000048 3300025921 Bacteria 124452
269 Ga0207652_10001604 3300025921 Bacteria 19915
270 Ga0207652_10009969 3300025921 Bacteria 7649
271 Ga0207652_10015294 3300025921 Bacteria 6231
272 Ga0207652_10037946 3300025921 Bacteria 4080
273 Ga0207652_10043249 3300025921 Bacteria 3836
274 Ga0207694_10044239 3300025924 Bacteria 3439
275 Ga0207650_10910079 3300025925 Bacteria 747
276 Ga0207650_11105869 3300025925 Bacteria 674
277 Ga0207659_10005956 3300025926 Bacteria 7440
278 Ga0207659_10011485 3300025926 Bacteria 5596
279 Ga0207687_10033616 3300025927 Bacteria 3479
280 Ga0207700_10030459 3300025928 Bacteria 3822
281 Ga0207644_10046816 3300025931 Bacteria 3083
282 Ga0207690_10000656 3300025932 Bacteria 22129
283 Ga0207690_10006762 3300025932 Bacteria 6796
284 Ga0207690_10054178 3300025932 Bacteria 2695
285 Ga0207690_10129975 3300025932 Bacteria 1842
286 Ga0207690_10251563 3300025932 Bacteria 1365
287 Ga0207686_10017975 3300025934 Bacteria 3995
288 Ga0207686_10243795 3300025934 Bacteria 1309
289 Ga0207709_10013134 3300025935 Bacteria 4567
290 Ga0207670_10353135 3300025936 Bacteria 1165
291 Ga0207670_10551617 3300025936 Bacteria 942
292 Ga0207704_10264110 3300025938 Bacteria 1299
293 Ga0207665_10116452 3300025939 Bacteria 1883
294 Ga0207691_10033022 3300025940 Bacteria 4821
295 Ga0207711_10004240 3300025941 Bacteria 12267
296 Ga0207711_10852364 3300025941 Bacteria 848
297 Ga0207689_10696379 3300025942 Bacteria 857
298 Ga0207661_10003473 3300025944 Bacteria 10943
299 Ga0207661_10011210 3300025944 Bacteria 6485
300 Ga0207661_10106981 3300025944 Bacteria 2358
301 Ga0207661_10213068 3300025944 Bacteria 1703
302 Ga0207661_10478445 3300025944 Bacteria 1136
303 Ga0207679_10044348 3300025945 Bacteria 3208
304 Ga0207679_10075005 3300025945 Bacteria 2565
305 Ga0207679_10579142 3300025945 Bacteria 1009
306 Ga0207667_10003235 3300025949 Bacteria 20091
307 Ga0207667_10012888 3300025949 Bacteria 9606
308 Ga0207667_10015790 3300025949 Bacteria 8561
309 Ga0207667_10922384 3300025949 Bacteria 864
310 Ga0207651_10936700 3300025960 Bacteria 772
311 Ga0207712_10116197 3300025961 Bacteria 2015
312 Ga0207712_10392685 3300025961 Bacteria 1164
313 Ga0207712_10664903 3300025961 Bacteria 906
314 Ga0207668_10000288 3300025972 Bacteria 33102
315 Ga0207640_10012741 3300025981 Bacteria 4799
316 Ga0207640_10085239 3300025981 Bacteria 2172
317 Ga0207640_10208915 3300025981 Bacteria 1485
318 Ga0207640_10295410 3300025981 Bacteria 1279
319 Ga0207658_10006506 3300025986 Bacteria 7976
320 Ga0207658_10575997 3300025986 Bacteria 1009
321 Ga0207703_10000938 3300026035 Bacteria 28262
322 Ga0207703_10257094 3300026035 Bacteria 1577
323 Ga0207639_10001157 3300026041 Bacteria 17899
324 Ga0207639_10035163 3300026041 Bacteria 3707
325 Ga0207639_10042160 3300026041 Bacteria 3419
326 Ga0207678_10003947 3300026067 Bacteria 13350
327 Ga0207678_10036391 3300026067 Bacteria 4285
328 Ga0207678_10058970 3300026067 Bacteria 3303
329 Ga0207678_10080714 3300026067 Bacteria 2784
330 Ga0207678_10279521 3300026067 Bacteria 1433
331 Ga0207678_10366962 3300026067 Bacteria 1243
332 Ga0207708_10119741 3300026075 Bacteria 2051
333 Ga0207702_10003111 3300026078 Bacteria 15373
334 Ga0207702_10006273 3300026078 Bacteria 10274
335 Ga0207702_10054406 3300026078 Bacteria 3391
336 Ga0207702_10241986 3300026078 Bacteria 1691
337 Ga0207702_10460452 3300026078 Bacteria 1235
338 Ga0207641_10487752 3300026088 Bacteria 1195
339 Ga0207648_10146835 3300026089 Bacteria 2080
340 Ga0207676_10000150 3300026095 Bacteria 60517
341 Ga0207676_10106034 3300026095 Bacteria 2341
342 Ga0207674_10000635 3300026116 Bacteria 45675
343 Ga0207674_10028809 3300026116 Bacteria 5855
344 Ga0207674_10039509 3300026116 Bacteria 4891
345 Ga0207674_10121869 3300026116 Bacteria 2574
346 Ga0207683_10002831 3300026121 Bacteria 15159
347 Ga0207683_10165419 3300026121 Bacteria 2001
348 Ga0207698_10001785 3300026142 Bacteria 12567
349 Ga0207698_10157632 3300026142 Bacteria 1980
350 Ga0207698_10258055 3300026142 Bacteria 1599
351 Ga0207698_10269363 3300026142 Bacteria 1569
352 Ga0209981_1035012 3300027378 Bacteria 743
353 Ga0209996_1003947 3300027395 Bacteria 1879
354 Ga0209995_1005820 3300027471 Bacteria 1983
355 Ga0209968_1000079 3300027526 Bacteria 17281
356 Ga0209966_1000011 3300027695 Bacteria 83449
357 Ga0209998_10148583 3300027717 Bacteria 601
358 Ga0207428_10121196 3300027907 Bacteria 2005
359 Ga0207428_10360519 3300027907 Bacteria 1068
360 Ga0207428_10589531 3300027907 Bacteria 802
361 Ga0268266_10001512 3300028379 Bacteria 27338
362 Ga0268265_10309954 3300028380 Bacteria 1425
363 Ga0268265_10362483 3300028380 Bacteria 1327
364 Ga0307513_10111897 3300031456 Bacteria 2722
365 Ga0307409_100785854 3300031995 Bacteria 958
366 Ga0307510_10003958 3300033180 Bacteria 17370
367 Ga0395899_0000797 3300037312 Bacteria 30839
368 Ga0395899_0059977 3300037312 Bacteria 2803
369 Ga0395899_0105269 3300037312 Bacteria 2032
370 Ga0395900_0111658 3300037418 Bacteria 2807
371 Ga0395900_0133207 3300037418 Bacteria 2546
372 Ga0395900_0334538 3300037418 Bacteria 1491
373 Ga0395900_0366377 3300037418 Bacteria 1411
374 Ga0395900_0994217 3300037418 Bacteria 759
375 Ga0395898_0017013 3300037466 Bacteria 7425
376 Ga0395898_0510115 3300037466 Bacteria 1143
377 Ga0395905_0093270 3300037471 Bacteria 2823
378 Ga0436364_0287656 3300037853 Bacteria 693
379 Ga0395901_0170413 3300038443 Bacteria 2284
380 Ga0395901_0421964 3300038443 Bacteria 1368
381 Ga0395901_0575436 3300038443 Bacteria 1138
382 Ga0436363_1201331 3300039450 Bacteria 2014
383 Ga0439448_0000981 3300042005 Bacteria 7088
384 Ga0439448_0003297 3300042005 Bacteria 4461
385 Ga0439449_0061316 3300042007 Bacteria 1387
386 Ga0439452_017763 3300042010 Bacteria 1905
387 Ga0439455_0000361 3300042012 Bacteria 5911
388 Ga0439455_0003075 3300042012 Bacteria 3136
389 Ga0439458_0000415 3300042157 Bacteria 10732
390 Ga0439458_0000568 3300042157 Bacteria 9503
391 Ga0450916_052524 3300042530 Bacteria 646
392 Ga0466965_0220840 3300044683 Bacteria 1010
393 Ga0466971_0100899 3300044719 Bacteria 1326
394 Ga0466970_0104210 3300044765 Bacteria 1546
395 Ga0466957_0167761 3300044842 Bacteria 1428
396 Ga0466967_0019982 3300045976 Bacteria 5400
397 Ga0466967_0061254 3300045976 Bacteria 3338
398 Ga0466967_0258390 3300045976 Bacteria 1666
399 Ga0495583_0003757 3300046506 Bacteria 11291
400 Ga0495648_0025275 3300046524 Bacteria 4024
401 Ga0495625_0089521 3300046660 Bacteria 2130
402 Ga0495677_0003625 3300047445 Bacteria 5986
403 Ga0496108_0321880 3300048911 Bacteria 1348
404 Ga0496109_0633355 3300048912 Bacteria 1006
405 Ga0496113_0613124 3300048916 Bacteria 871
406 Ga0496116_0004586 3300048919 Bacteria 13100
407 Ga0496117_0408987 3300048920 Bacteria 682
408 Ga0496121_0104303 3300048924 Bacteria 2179
409 Ga0496122_0000261 3300048925 Bacteria 118793
410 Ga0496123_0000218 3300048926 Bacteria 116615
411 Ga0496125_0048864 3300048928 Bacteria 3522
412 Ga0501039_0294062 3300049575 Bacteria 1277
413 Ga0501042_0027618 3300049578 Bacteria 3992
414 Ga0501043_0367594 3300049579 Bacteria 1091
415 Ga0501047_0740230 3300049581 Bacteria 799
416 Ga0501048_0538116 3300049582 Bacteria 838
417 Ga0501069_0010840 3300049585 Bacteria 4830
418 Ga0501069_0033785 3300049585 Bacteria 2818
419 Ga0501070_0000426 3300049586 Bacteria 38386
420 Ga0501070_0014798 3300049586 Bacteria 6565
421 Ga0501070_0088794 3300049586 Bacteria 2558
422 Ga0501070_0177554 3300049586 Bacteria 1753
423 Ga0501071_0408869 3300049587 Bacteria 1036
424 Ga0501074_0006636 3300049590 Bacteria 8365
425 Ga0501075_0328485 3300049591 Bacteria 1165
426 Ga0501076_0017883 3300049592 Bacteria 5392
427 Ga0501077_0113830 3300049593 Bacteria 1715
428 Ga0501223_000072 3300049663 Bacteria 30438
429 Ga0501224_000004 3300049664 Bacteria 169090
430 Ga0501233_006413 3300049668 Bacteria 2209
431 Ga0501235_012914 3300049669 Bacteria 1838
432 Ga0501225_0000048 3300049705 Bacteria 40596
433 Ga0501080_0045331 3300049742 Bacteria 4093
434 Ga0501081_0059508 3300049743 Bacteria 2645
435 Ga0501035_0002475 3300049822 Bacteria 18046
436 Ga0501035_0140138 3300049822 Bacteria 2103
437 Ga0501044_0070794 3300049823 Bacteria 3547
438 Ga0501045_0047172 3300049824 Bacteria 3138
439 Ga0501226_000018 3300049853 Bacteria 147268
440 nmdc:mga0k408_83929_c1 3300050493 Bacteria 1868
441 nmdc:mga07m45_20988_c1 3300050496 Bacteria 3552
442 nmdc:mga05p37_683037_c1 3300050507 Bacteria 1144
443 nmdc:mga0qj67_752018_c1 3300050509 Bacteria 773
444 nmdc:mga08y16_100579_c1 3300050511 Bacteria 3010
445 nmdc:mga08y16_821849_c1 3300050511 Bacteria 921
446 nmdc:mga0n895_172170_c1 3300050512 Bacteria 2197
447 nmdc:mga0a205_318008_c1 3300050515 Bacteria 1428
448 Ga0500643_004924 3300053087 Bacteria 5878
449 Ga0500643_108602 3300053087 Bacteria 750
450 Ga0500556_0001205 3300053104 Bacteria 12155
451 Ga0500592_000251 3300053116 Bacteria 9687
452 Ga0500592_027078 3300053116 Bacteria 924
453 Ga0500652_023800 3300053131 Bacteria 2332
454 Ga0500559_0215381 3300053136 Bacteria 906
455 Ga0500604_0168524 3300053151 Bacteria 748
456 Ga0500616_0007402 3300053153 Bacteria 6987
457 Ga0500627_0010098 3300053158 Bacteria 3428
458 Ga0500627_0057847 3300053158 Bacteria 1701
459 Ga0500645_130569 3300053730 Bacteria 698
460 Ga0500599_041612 3300053736 Bacteria 709
461 Ga0587070_093311 3300059491 Bacteria 680
462 Ga0587083_0064245 3300059505 Bacteria 836
463 Ga0587088_028710 3300059508 Bacteria 980
464 Ga0587079_045124 3300059647 Bacteria 905
465 Ga0587071_041474 3300060344 Bacteria 923
466 Ga0501082_1068288 3300060353 Bacteria 706
467 Ga0466962_0110590 3300061719 Bacteria 1323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10366962 Ga0207678_103669621 151
2 3300020082 Ga0206353_10024612 Ga0206353_100246122 153
3 3300005329 Ga0070683_100018440 Ga0070683_1000184404 157
4 3300005331 Ga0070670_100661835 Ga0070670_1006618352 157
5 3300005334 Ga0068869_101429901 Ga0068869_1014299011 157
6 3300005337 Ga0070682_100126730 Ga0070682_1001267302 157
7 3300005340 Ga0070689_100403565 Ga0070689_1004035651 157
8 3300005345 Ga0070692_10129860 Ga0070692_101298602 157
9 3300005365 Ga0070688_100510996 Ga0070688_1005109962 157
10 3300005441 Ga0070700_100093330 Ga0070700_1000933303 157
11 3300005459 Ga0068867_100094567 Ga0068867_1000945672 157
12 3300005564 Ga0070664_100091429 Ga0070664_1000914293 157
13 3300005577 Ga0068857_100000273 Ga0068857_10000027335 157
14 3300005618 Ga0068864_100198275 Ga0068864_1001982752 157
15 3300006881 Ga0068865_100620725 Ga0068865_1006207252 157
16 3300009094 Ga0111539_10494409 Ga0111539_104944092 157
17 3300009098 Ga0105245_10031278 Ga0105245_100312783 157
18 3300009147 Ga0114129_10328140 Ga0114129_103281402 157
19 3300009148 Ga0105243_10014770 Ga0105243_100147703 157
20 3300009553 Ga0105249_10462513 Ga0105249_104625133 157
21 3300011119 Ga0105246_10037029 Ga0105246_100370292 157
22 3300013308 Ga0157375_10649058 Ga0157375_106490581 157
23 3300014745 Ga0157377_10140441 Ga0157377_101404413 157
24 3300025901 Ga0207688_10224708 Ga0207688_102247082 157
25 3300025925 Ga0207650_11105869 Ga0207650_111058691 157
26 3300025927 Ga0207687_10033616 Ga0207687_100336163 157
27 3300025935 Ga0207709_10013134 Ga0207709_100131343 157
28 3300025936 Ga0207670_10353135 Ga0207670_103531352 157
29 3300025942 Ga0207689_10696379 Ga0207689_106963791 157
30 3300025944 Ga0207661_10011210 Ga0207661_100112104 157
31 3300025945 Ga0207679_10075005 Ga0207679_100750053 157
32 3300025961 Ga0207712_10392685 Ga0207712_103926852 157
33 3300025981 Ga0207640_10085239 Ga0207640_100852393 157
34 3300026075 Ga0207708_10119741 Ga0207708_101197412 157
35 3300026089 Ga0207648_10146835 Ga0207648_101468353 157
36 3300026095 Ga0207676_10106034 Ga0207676_101060342 157
37 3300026116 Ga0207674_10000635 Ga0207674_1000063529 157
38 3300027907 Ga0207428_10360519 Ga0207428_103605192 157
39 3300031995 Ga0307409_100785854 Ga0307409_1007858542 157
40 3300050507 nmdc:mga05p37_683037_c1 nmdc:mga05p37_683037_c1_300_773 157
41 3300001989 JGI24739J22299_10096330 JGI24739J22299_100963302 159
42 3300001990 JGI24737J22298_10006419 JGI24737J22298_100064193 159
43 3300002067 JGI24735J21928_10007377 JGI24735J21928_100073775 159
44 3300002067 JGI24735J21928_10011739 JGI24735J21928_100117392 159
45 3300002067 JGI24735J21928_10043238 JGI24735J21928_100432382 159
46 3300002067 JGI24735J21928_10120692 JGI24735J21928_101206921 159
47 3300002075 JGI24738J21930_10017063 JGI24738J21930_100170633 159
48 3300002077 JGI24744J21845_10000104 JGI24744J21845_100001045 159
49 3300003214 JGI25165J46597_1000188 JGI25165J46597_100018879 159
50 3300003320 rootH2_10008309 rootH2_100083091 159
51 3300003322 rootL2_10034896 rootL2_100348963 159
52 3300003579 Ga0007429J51699_1082464 Ga0007429J51699_10824642 159
53 3300005327 Ga0070658_10013081 Ga0070658_100130817 159
54 3300005328 Ga0070676_10705045 Ga0070676_107050451 159
55 3300005339 Ga0070660_100085991 Ga0070660_1000859914 159
56 3300005339 Ga0070660_100665703 Ga0070660_1006657032 159
57 3300005354 Ga0070675_100047742 Ga0070675_1000477423 159
58 3300005355 Ga0070671_100068279 Ga0070671_1000682791 159
59 3300005366 Ga0070659_100109825 Ga0070659_1001098253 159
60 3300005456 Ga0070678_100013956 Ga0070678_1000139568 159
61 3300005456 Ga0070678_101551873 Ga0070678_1015518731 159
62 3300005543 Ga0070672_100031388 Ga0070672_1000313883 159
63 3300005563 Ga0068855_100292035 Ga0068855_1002920352 159
64 3300005578 Ga0068854_100966647 Ga0068854_1009666472 159
65 3300005614 Ga0068856_100002333 Ga0068856_10000233314 159
66 3300005841 Ga0068863_100764238 Ga0068863_1007642381 159
67 3300006195 Ga0075366_10012836 Ga0075366_100128362 159
68 3300006237 Ga0097621_100224879 Ga0097621_1002248791 159
69 3300006353 Ga0075370_10113635 Ga0075370_101136352 159
70 3300006358 Ga0068871_100544621 Ga0068871_1005446211 159
71 3300006881 Ga0068865_100147099 Ga0068865_1001470992 159
72 3300009011 Ga0105251_10068737 Ga0105251_100687372 159
73 3300009093 Ga0105240_10000364 Ga0105240_1000036481 159
74 3300009093 Ga0105240_10016005 Ga0105240_100160056 159
75 3300009551 Ga0105238_10011163 Ga0105238_100111634 159
76 3300011119 Ga0105246_11295321 Ga0105246_112953211 159
77 3300013100 Ga0157373_10021479 Ga0157373_100214792 159
78 3300013104 Ga0157370_10000203 Ga0157370_1000020322 159
79 3300013296 Ga0157374_10668149 Ga0157374_106681491 159
80 3300013306 Ga0163162_10048683 Ga0163162_100486833 159
81 3300013307 Ga0157372_10013070 Ga0157372_100130709 159
82 3300014968 Ga0157379_11326623 Ga0157379_113266231 159
83 3300017792 Ga0163161_10190176 Ga0163161_101901763 159
84 3300025231 Ga0207427_100914 Ga0207427_10091412 159
85 3300025250 Ga0209026_1000692 Ga0209026_10006928 159
86 3300025254 Ga0209148_1002506 Ga0209148_10025063 159
87 3300025261 Ga0209233_1000120 Ga0209233_1000120221 159
88 3300025272 Ga0209455_1001552 Ga0209455_10015523 159
89 3300025321 Ga0207656_10036949 Ga0207656_100369492 159
90 3300025901 Ga0207688_10103304 Ga0207688_101033042 159
91 3300025904 Ga0207647_10019991 Ga0207647_100199916 159
92 3300025904 Ga0207647_10057050 Ga0207647_100570504 159
93 3300025904 Ga0207647_10223691 Ga0207647_102236913 159
94 3300025907 Ga0207645_10378786 Ga0207645_103787861 159
95 3300025909 Ga0207705_10004233 Ga0207705_1000423310 159
96 3300025913 Ga0207695_10000369 Ga0207695_1000036960 159
97 3300025913 Ga0207695_10005706 Ga0207695_1000570613 159
98 3300025913 Ga0207695_11093235 Ga0207695_110932352 159
99 3300025919 Ga0207657_10028002 Ga0207657_100280024 159
100 3300025919 Ga0207657_10264457 Ga0207657_102644572 159
101 3300025924 Ga0207694_10044239 Ga0207694_100442395 159
102 3300025925 Ga0207650_10910079 Ga0207650_109100792 159
103 3300025926 Ga0207659_10011485 Ga0207659_100114858 159
104 3300025931 Ga0207644_10046816 Ga0207644_100468166 159
105 3300025932 Ga0207690_10054178 Ga0207690_100541784 159
106 3300025934 Ga0207686_10017975 Ga0207686_100179751 159
107 3300025934 Ga0207686_10243795 Ga0207686_102437951 159
108 3300025938 Ga0207704_10264110 Ga0207704_102641102 159
109 3300025940 Ga0207691_10033022 Ga0207691_100330224 159
110 3300025960 Ga0207651_10936700 Ga0207651_109367001 159
111 3300026035 Ga0207703_10257094 Ga0207703_102570941 159
112 3300026041 Ga0207639_10035163 Ga0207639_100351635 159
113 3300026078 Ga0207702_10003111 Ga0207702_1000311112 159
114 3300026088 Ga0207641_10487752 Ga0207641_104877522 159
115 3300026121 Ga0207683_10002831 Ga0207683_100028319 159
116 3300026121 Ga0207683_10165419 Ga0207683_101654193 159
117 3300027378 Ga0209981_1035012 Ga0209981_10350121 159
118 3300027395 Ga0209996_1003947 Ga0209996_10039471 159
119 3300027471 Ga0209995_1005820 Ga0209995_10058201 159
120 3300027526 Ga0209968_1000079 Ga0209968_100007912 159
121 3300027695 Ga0209966_1000011 Ga0209966_100001111 159
122 3300027717 Ga0209998_10148583 Ga0209998_101485831 159
123 3300027907 Ga0207428_10589531 Ga0207428_105895312 159
124 3300037312 Ga0395899_0000797 Ga0395899_0000797_10714_11205 159
125 3300037418 Ga0395900_0111658 Ga0395900_0111658_774_1265 159
126 3300038443 Ga0395901_0421964 Ga0395901_0421964_543_1034 159
127 3300042005 Ga0439448_0000981 Ga0439448_0000981_6519_7004 159
128 3300042005 Ga0439448_0003297 Ga0439448_0003297_2654_3139 159
129 3300042012 Ga0439455_0000361 Ga0439455_0000361_2418_2903 159
130 3300042012 Ga0439455_0003075 Ga0439455_0003075_1334_1819 159
131 3300042157 Ga0439458_0000415 Ga0439458_0000415_5173_5658 159
132 3300042157 Ga0439458_0000568 Ga0439458_0000568_7684_8169 159
133 3300042530 Ga0450916_052524 Ga0450916_052524_33_524 159
134 3300044683 Ga0466965_0220840 Ga0466965_0220840_199_690 159
135 3300044765 Ga0466970_0104210 Ga0466970_0104210_90_581 159
136 3300045976 Ga0466967_0061254 Ga0466967_0061254_1455_1946 159
137 3300045976 Ga0466967_0258390 Ga0466967_0258390_610_1101 159
138 3300048919 Ga0496116_0004586 Ga0496116_0004586_6978_7457 159
139 3300048920 Ga0496117_0408987 Ga0496117_0408987_185_664 159
140 3300048924 Ga0496121_0104303 Ga0496121_0104303_1658_2137 159
141 3300048925 Ga0496122_0000261 Ga0496122_0000261_22759_23238 159
142 3300048926 Ga0496123_0000218 Ga0496123_0000218_20320_20799 159
143 3300048928 Ga0496125_0048864 Ga0496125_0048864_223_702 159
144 3300049575 Ga0501039_0294062 Ga0501039_0294062_667_1146 159
145 3300049578 Ga0501042_0027618 Ga0501042_0027618_1815_2294 159
146 3300049579 Ga0501043_0367594 Ga0501043_0367594_486_965 159
147 3300049582 Ga0501048_0538116 Ga0501048_0538116_143_622 159
148 3300049587 Ga0501071_0408869 Ga0501071_0408869_159_638 159
149 3300049591 Ga0501075_0328485 Ga0501075_0328485_523_1002 159
150 3300049592 Ga0501076_0017883 Ga0501076_0017883_2581_3060 159
151 3300049743 Ga0501081_0059508 Ga0501081_0059508_1645_2124 159
152 3300049824 Ga0501045_0047172 Ga0501045_0047172_1749_2228 159
153 3300050493 nmdc:mga0k408_83929_c1 nmdc:mga0k408_83929_c1_645_1130 159
154 3300050496 nmdc:mga07m45_20988_c1 nmdc:mga07m45_20988_c1_1555_2040 159
155 3300050511 nmdc:mga08y16_821849_c1 nmdc:mga08y16_821849_c1_170_658 159
156 3300053104 Ga0500556_0001205 Ga0500556_0001205_5920_6402 159
157 3300053116 Ga0500592_000251 Ga0500592_000251_289_774 159
158 3300053116 Ga0500592_027078 Ga0500592_027078_156_641 159
159 3300053151 Ga0500604_0168524 Ga0500604_0168524_252_737 159
160 3300053153 Ga0500616_0007402 Ga0500616_0007402_6342_6824 159
161 3300053158 Ga0500627_0010098 Ga0500627_0010098_2707_3192 159
162 3300053158 Ga0500627_0057847 Ga0500627_0057847_985_1470 159
163 3300053736 Ga0500599_041612 Ga0500599_041612_69_551 159
164 3300060353 Ga0501082_1068288 Ga0501082_1068288_182_670 159
165 3300005327 Ga0070658_10979540 Ga0070658_109795401 160
166 3300005344 Ga0070661_100010594 Ga0070661_1000105945 160
167 3300005367 Ga0070667_100006437 Ga0070667_1000064375 160
168 3300005435 Ga0070714_100430512 Ga0070714_1004305122 160
169 3300005548 Ga0070665_100000300 Ga0070665_10000030022 160
170 3300005548 Ga0070665_100895664 Ga0070665_1008956642 160
171 3300005719 Ga0068861_100365652 Ga0068861_1003656522 160
172 3300005844 Ga0068862_100036084 Ga0068862_1000360842 160
173 3300006028 Ga0070717_10003812 Ga0070717_100038129 160
174 3300006846 Ga0075430_100305892 Ga0075430_1003058922 160
175 3300013102 Ga0157371_10128316 Ga0157371_101283163 160
176 3300013104 Ga0157370_10828000 Ga0157370_108280002 160
177 3300013296 Ga0157374_10023048 Ga0157374_100230484 160
178 3300014325 Ga0163163_10011891 Ga0163163_100118912 160
179 3300025907 Ga0207645_10501142 Ga0207645_105011422 160
180 3300025909 Ga0207705_10020786 Ga0207705_100207863 160
181 3300025919 Ga0207657_10217247 Ga0207657_102172473 160
182 3300025928 Ga0207700_10030459 Ga0207700_100304592 160
183 3300025939 Ga0207665_10116452 Ga0207665_101164522 160
184 3300025986 Ga0207658_10006506 Ga0207658_1000650611 160
185 3300026067 Ga0207678_10080714 Ga0207678_100807144 160
186 3300026078 Ga0207702_10241986 Ga0207702_102419861 160
187 3300028379 Ga0268266_10001512 Ga0268266_100015129 160
188 3300028380 Ga0268265_10362483 Ga0268265_103624832 160
189 3300037312 Ga0395899_0059977 Ga0395899_0059977_1283_1777 160
190 3300037418 Ga0395900_0334538 Ga0395900_0334538_345_839 160
191 3300037418 Ga0395900_0366377 Ga0395900_0366377_842_1336 160
192 3300037418 Ga0395900_0994217 Ga0395900_0994217_64_558 160
193 3300037466 Ga0395898_0510115 Ga0395898_0510115_160_654 160
194 3300037471 Ga0395905_0093270 Ga0395905_0093270_1753_2247 160
195 3300037853 Ga0436364_0287656 Ga0436364_0287656_74_568 160
196 3300038443 Ga0395901_0575436 Ga0395901_0575436_204_698 160
197 3300044719 Ga0466971_0100899 Ga0466971_0100899_66_560 160
198 3300044842 Ga0466957_0167761 Ga0466957_0167761_797_1291 160
199 3300045976 Ga0466967_0019982 Ga0466967_0019982_1706_2200 160
200 3300050509 nmdc:mga0qj67_752018_c1 nmdc:mga0qj67_752018_c1_33_524 160
201 3300053087 Ga0500643_108602 Ga0500643_108602_142_630 160
202 3300059491 Ga0587070_093311 Ga0587070_093311_38_532 160
203 3300059505 Ga0587083_0064245 Ga0587083_0064245_113_607 160
204 3300059508 Ga0587088_028710 Ga0587088_028710_206_700 160
205 3300059647 Ga0587079_045124 Ga0587079_045124_69_563 160
206 3300060344 Ga0587071_041474 Ga0587071_041474_282_776 160
207 3300061719 Ga0466962_0110590 Ga0466962_0110590_695_1189 160
208 3300005289 Ga0065704_10432797 Ga0065704_104327971 161
209 3300005327 Ga0070658_10781911 Ga0070658_107819112 161
210 3300005329 Ga0070683_100121922 Ga0070683_1001219224 161
211 3300005339 Ga0070660_100793600 Ga0070660_1007936001 161
212 3300005344 Ga0070661_100028872 Ga0070661_1000288726 161
213 3300005455 Ga0070663_101277973 Ga0070663_1012779731 161
214 3300005518 Ga0070699_100102082 Ga0070699_1001020824 161
215 3300005530 Ga0070679_100017474 Ga0070679_1000174744 161
216 3300005535 Ga0070684_100281579 Ga0070684_1002815792 161
217 3300005578 Ga0068854_100124899 Ga0068854_1001248994 161
218 3300005578 Ga0068854_100367061 Ga0068854_1003670612 161
219 3300005618 Ga0068864_100000233 Ga0068864_10000023355 161
220 3300005842 Ga0068858_100002166 Ga0068858_1000021665 161
221 3300009092 Ga0105250_10118257 Ga0105250_101182572 161
222 3300009177 Ga0105248_10004882 Ga0105248_100048825 161
223 3300009553 Ga0105249_10913181 Ga0105249_109131811 161
224 3300014325 Ga0163163_10255872 Ga0163163_102558723 161
225 3300025315 Ga0207697_10025017 Ga0207697_100250173 161
226 3300025909 Ga0207705_10636946 Ga0207705_106369461 161
227 3300025919 Ga0207657_10669690 Ga0207657_106696901 161
228 3300025920 Ga0207649_10045755 Ga0207649_100457554 161
229 3300025921 Ga0207652_10015294 Ga0207652_100152949 161
230 3300025921 Ga0207652_10037946 Ga0207652_100379464 161
231 3300025941 Ga0207711_10004240 Ga0207711_1000424014 161
232 3300025944 Ga0207661_10106981 Ga0207661_101069813 161
233 3300025961 Ga0207712_10664903 Ga0207712_106649031 161
234 3300025986 Ga0207658_10575997 Ga0207658_105759972 161
235 3300026035 Ga0207703_10000938 Ga0207703_100009385 161
236 3300026095 Ga0207676_10000150 Ga0207676_1000015069 161
237 3300031456 Ga0307513_10111897 Ga0307513_101118974 161
238 3300033180 Ga0307510_10003958 Ga0307510_100039586 161
239 3300046506 Ga0495583_0003757 Ga0495583_0003757_10524_11018 161
240 3300046524 Ga0495648_0025275 Ga0495648_0025275_2374_2868 161
241 3300046660 Ga0495625_0089521 Ga0495625_0089521_99_593 161
242 3300047445 Ga0495677_0003625 Ga0495677_0003625_595_1089 161
243 3300053087 Ga0500643_004924 Ga0500643_004924_3974_4468 161
244 3300053131 Ga0500652_023800 Ga0500652_023800_294_782 161
245 3300053136 Ga0500559_0215381 Ga0500559_0215381_242_736 161
246 3300053730 Ga0500645_130569 Ga0500645_130569_33_527 161
247 3300005290 Ga0065712_10000527 Ga0065712_1000052711 162
248 3300005293 Ga0065715_10124680 Ga0065715_101246802 162
249 3300005327 Ga0070658_11024387 Ga0070658_110243871 162
250 3300005339 Ga0070660_100605626 Ga0070660_1006056262 162
251 3300005354 Ga0070675_100030023 Ga0070675_1000300231 162
252 3300005364 Ga0070673_100327665 Ga0070673_1003276652 162
253 3300005365 Ga0070688_100084429 Ga0070688_1000844294 162
254 3300005366 Ga0070659_100057669 Ga0070659_1000576692 162
255 3300005440 Ga0070705_100149017 Ga0070705_1001490174 162
256 3300005457 Ga0070662_100340481 Ga0070662_1003404811 162
257 3300005458 Ga0070681_11120662 Ga0070681_111206621 162
258 3300005535 Ga0070684_100583090 Ga0070684_1005830901 162
259 3300006852 Ga0075433_10188628 Ga0075433_101886283 162
260 3300006871 Ga0075434_100055168 Ga0075434_1000551684 162
261 3300009094 Ga0111539_10273999 Ga0111539_102739992 162
262 3300013308 Ga0157375_10663418 Ga0157375_106634181 162
263 3300014325 Ga0163163_10115426 Ga0163163_101154262 162
264 3300014745 Ga0157377_10011785 Ga0157377_100117854 162
265 3300020078 Ga0206352_11322884 Ga0206352_113228841 162
266 3300020081 Ga0206354_10790502 Ga0206354_107905022 162
267 3300020082 Ga0206353_10869725 Ga0206353_108697253 162
268 3300025901 Ga0207688_10386113 Ga0207688_103861131 162
269 3300025912 Ga0207707_10114193 Ga0207707_101141932 162
270 3300025926 Ga0207659_10005956 Ga0207659_100059566 162
271 3300025932 Ga0207690_10129975 Ga0207690_101299753 162
272 3300025936 Ga0207670_10551617 Ga0207670_105516171 162
273 3300026116 Ga0207674_10121869 Ga0207674_101218692 162
274 3300027907 Ga0207428_10121196 Ga0207428_101211962 162
275 3300028380 Ga0268265_10309954 Ga0268265_103099543 162
276 3300048911 Ga0496108_0321880 Ga0496108_0321880_817_1320 162
277 3300048912 Ga0496109_0633355 Ga0496109_0633355_211_714 162
278 3300048916 Ga0496113_0613124 Ga0496113_0613124_186_689 162
279 3300050511 nmdc:mga08y16_100579_c1 nmdc:mga08y16_100579_c1_1378_1881 162
280 3300050512 nmdc:mga0n895_172170_c1 nmdc:mga0n895_172170_c1_497_1000 162
281 3300050515 nmdc:mga0a205_318008_c1 nmdc:mga0a205_318008_c1_772_1275 162
282 3300005327 Ga0070658_10481869 Ga0070658_104818691 163
283 3300039450 Ga0436363_1201331 Ga0436363_1201331_68_571 163
284 3300049585 Ga0501069_0033785 Ga0501069_0033785_195_725 163
285 3300049586 Ga0501070_0014798 Ga0501070_0014798_4588_5118 163
286 3300001979 JGI24740J21852_10010053 JGI24740J21852_100100533 164
287 3300005327 Ga0070658_10311262 Ga0070658_103112622 164
288 3300005327 Ga0070658_10712364 Ga0070658_107123642 164
289 3300005329 Ga0070683_100062199 Ga0070683_1000621993 164
290 3300005329 Ga0070683_100065304 Ga0070683_1000653042 164
291 3300005336 Ga0070680_100007355 Ga0070680_10000735511 164
292 3300005336 Ga0070680_100087119 Ga0070680_1000871192 164
293 3300005336 Ga0070680_100886626 Ga0070680_1008866261 164
294 3300005339 Ga0070660_100156370 Ga0070660_1001563701 164
295 3300005341 Ga0070691_10040329 Ga0070691_100403292 164
296 3300005344 Ga0070661_100003819 Ga0070661_1000038197 164
297 3300005344 Ga0070661_100028578 Ga0070661_1000285783 164
298 3300005345 Ga0070692_10000966 Ga0070692_100009668 164
299 3300005345 Ga0070692_10008661 Ga0070692_100086613 164
300 3300005347 Ga0070668_100000820 Ga0070668_1000008209 164
301 3300005366 Ga0070659_100076155 Ga0070659_1000761552 164
302 3300005366 Ga0070659_100107139 Ga0070659_1001071392 164
303 3300005455 Ga0070663_100105956 Ga0070663_1001059561 164
304 3300005455 Ga0070663_101291640 Ga0070663_1012916401 164
305 3300005458 Ga0070681_10000086 Ga0070681_1000008611 164
306 3300005458 Ga0070681_10004173 Ga0070681_1000417311 164
307 3300005530 Ga0070679_100003917 Ga0070679_10000391711 164
308 3300005530 Ga0070679_100314945 Ga0070679_1003149451 164
309 3300005535 Ga0070684_100008251 Ga0070684_1000082517 164
310 3300005535 Ga0070684_100054958 Ga0070684_1000549582 164
311 3300005539 Ga0068853_100104881 Ga0068853_1001048811 164
312 3300005546 Ga0070696_100029197 Ga0070696_1000291973 164
313 3300005546 Ga0070696_100312487 Ga0070696_1003124872 164
314 3300005563 Ga0068855_100084281 Ga0068855_1000842815 164
315 3300005563 Ga0068855_100310917 Ga0068855_1003109171 164
316 3300005564 Ga0070664_100062410 Ga0070664_1000624103 164
317 3300005577 Ga0068857_100065039 Ga0068857_1000650392 164
318 3300005577 Ga0068857_101073514 Ga0068857_1010735141 164
319 3300005578 Ga0068854_100111931 Ga0068854_1001119312 164
320 3300005614 Ga0068856_100043573 Ga0068856_1000435732 164
321 3300005616 Ga0068852_100008791 Ga0068852_1000087916 164
322 3300005616 Ga0068852_100165225 Ga0068852_1001652251 164
323 3300009545 Ga0105237_10241991 Ga0105237_102419912 164
324 3300009553 Ga0105249_10068464 Ga0105249_100684643 164
325 3300013100 Ga0157373_10047652 Ga0157373_100476522 164
326 3300013100 Ga0157373_10128863 Ga0157373_101288632 164
327 3300013104 Ga0157370_10506788 Ga0157370_105067882 164
328 3300020070 Ga0206356_10135216 Ga0206356_101352162 164
329 3300020077 Ga0206351_10334359 Ga0206351_103343592 164
330 3300020078 Ga0206352_10368699 Ga0206352_103686992 164
331 3300020080 Ga0206350_11257343 Ga0206350_112573432 164
332 3300020081 Ga0206354_10180519 Ga0206354_101805192 164
333 3300020082 Ga0206353_10076734 Ga0206353_100767343 164
334 3300020082 Ga0206353_10949658 Ga0206353_109496585 164
335 3300020610 Ga0154015_1114440 Ga0154015_11144404 164
336 3300025904 Ga0207647_10017703 Ga0207647_100177032 164
337 3300025904 Ga0207647_10101912 Ga0207647_101019122 164
338 3300025909 Ga0207705_10018173 Ga0207705_100181733 164
339 3300025909 Ga0207705_10018772 Ga0207705_100187724 164
340 3300025912 Ga0207707_10000364 Ga0207707_1000036438 164
341 3300025912 Ga0207707_10000538 Ga0207707_1000053825 164
342 3300025912 Ga0207707_10003720 Ga0207707_1000372010 164
343 3300025912 Ga0207707_10013492 Ga0207707_100134922 164
344 3300025913 Ga0207695_10214026 Ga0207695_102140262 164
345 3300025917 Ga0207660_10023683 Ga0207660_100236834 164
346 3300025917 Ga0207660_10026198 Ga0207660_100261983 164
347 3300025917 Ga0207660_10122993 Ga0207660_101229932 164
348 3300025919 Ga0207657_10067021 Ga0207657_100670212 164
349 3300025919 Ga0207657_10100166 Ga0207657_101001662 164
350 3300025920 Ga0207649_10014937 Ga0207649_100149374 164
351 3300025920 Ga0207649_10076142 Ga0207649_100761422 164
352 3300025921 Ga0207652_10001604 Ga0207652_1000160412 164
353 3300025921 Ga0207652_10009969 Ga0207652_100099696 164
354 3300025921 Ga0207652_10043249 Ga0207652_100432492 164
355 3300025932 Ga0207690_10251563 Ga0207690_102515631 164
356 3300025944 Ga0207661_10213068 Ga0207661_102130681 164
357 3300025944 Ga0207661_10478445 Ga0207661_104784452 164
358 3300025945 Ga0207679_10579142 Ga0207679_105791421 164
359 3300025949 Ga0207667_10015790 Ga0207667_100157901 164
360 3300025949 Ga0207667_10922384 Ga0207667_109223842 164
361 3300025961 Ga0207712_10116197 Ga0207712_101161972 164
362 3300025972 Ga0207668_10000288 Ga0207668_1000028815 164
363 3300026067 Ga0207678_10036391 Ga0207678_100363912 164
364 3300026067 Ga0207678_10058970 Ga0207678_100589702 164
365 3300026078 Ga0207702_10006273 Ga0207702_100062734 164
366 3300026078 Ga0207702_10460452 Ga0207702_104604522 164
367 3300026116 Ga0207674_10028809 Ga0207674_100288096 164
368 3300026116 Ga0207674_10039509 Ga0207674_100395092 164
369 3300026142 Ga0207698_10001785 Ga0207698_1000178510 164
370 3300026142 Ga0207698_10258055 Ga0207698_102580551 164
371 3300042007 Ga0439449_0061316 Ga0439449_0061316_618_1193 164
372 3300042010 Ga0439452_017763 Ga0439452_017763_686_1261 164
373 3300049581 Ga0501047_0740230 Ga0501047_0740230_231_725 164
374 3300049585 Ga0501069_0010840 Ga0501069_0010840_190_765 164
375 3300049586 Ga0501070_0000426 Ga0501070_0000426_32616_33191 164
376 3300049586 Ga0501070_0088794 Ga0501070_0088794_1716_2210 164
377 3300049586 Ga0501070_0177554 Ga0501070_0177554_253_747 164
378 3300049590 Ga0501074_0006636 Ga0501074_0006636_6272_6766 164
379 3300049593 Ga0501077_0113830 Ga0501077_0113830_134_628 164
380 3300049742 Ga0501080_0045331 Ga0501080_0045331_3000_3494 164
381 3300049822 Ga0501035_0002475 Ga0501035_0002475_8828_9487 164
382 3300049822 Ga0501035_0140138 Ga0501035_0140138_418_912 164
383 3300049823 Ga0501044_0070794 Ga0501044_0070794_2811_3305 164
384 3300001979 JGI24740J21852_10001000 JGI24740J21852_1000100012 165
385 3300004799 Ga0058863_11547771 Ga0058863_115477711 165
386 3300004800 Ga0058861_11766172 Ga0058861_117661721 165
387 3300005327 Ga0070658_10233129 Ga0070658_102331291 165
388 3300005329 Ga0070683_100034374 Ga0070683_1000343742 165
389 3300005336 Ga0070680_100008855 Ga0070680_1000088558 165
390 3300005337 Ga0070682_100094197 Ga0070682_1000941971 165
391 3300005339 Ga0070660_100414809 Ga0070660_1004148092 165
392 3300005339 Ga0070660_100504219 Ga0070660_1005042191 165
393 3300005344 Ga0070661_100004727 Ga0070661_1000047272 165
394 3300005345 Ga0070692_10065987 Ga0070692_100659872 165
395 3300005366 Ga0070659_100212792 Ga0070659_1002127922 165
396 3300005455 Ga0070663_100001177 Ga0070663_1000011774 165
397 3300005455 Ga0070663_100038384 Ga0070663_1000383845 165
398 3300005457 Ga0070662_100182942 Ga0070662_1001829421 165
399 3300005458 Ga0070681_10000367 Ga0070681_1000036729 165
400 3300005530 Ga0070679_100000042 Ga0070679_10000004262 165
401 3300005539 Ga0068853_100466156 Ga0068853_1004661562 165
402 3300005546 Ga0070696_100100009 Ga0070696_1001000091 165
403 3300005563 Ga0068855_100026700 Ga0068855_1000267006 165
404 3300005563 Ga0068855_100598387 Ga0068855_1005983872 165
405 3300005578 Ga0068854_100030324 Ga0068854_1000303242 165
406 3300005578 Ga0068854_100049186 Ga0068854_1000491863 165
407 3300005614 Ga0068856_100040462 Ga0068856_1000404623 165
408 3300005616 Ga0068852_100805601 Ga0068852_1008056011 165
409 3300005834 Ga0068851_10542861 Ga0068851_105428611 165
410 3300009093 Ga0105240_10125497 Ga0105240_101254973 165
411 3300009093 Ga0105240_10320625 Ga0105240_103206252 165
412 3300009093 Ga0105240_10963063 Ga0105240_109630631 165
413 3300009551 Ga0105238_10006424 Ga0105238_100064249 165
414 3300013100 Ga0157373_10019934 Ga0157373_100199343 165
415 3300013102 Ga0157371_10576728 Ga0157371_105767281 165
416 3300013102 Ga0157371_11031118 Ga0157371_110311181 165
417 3300013104 Ga0157370_10004632 Ga0157370_1000463215 165
418 3300013104 Ga0157370_10006036 Ga0157370_1000603615 165
419 3300013104 Ga0157370_10324346 Ga0157370_103243462 165
420 3300013105 Ga0157369_10011504 Ga0157369_100115044 165
421 3300013105 Ga0157369_10694488 Ga0157369_106944881 165
422 3300013307 Ga0157372_10007026 Ga0157372_100070269 165
423 3300013307 Ga0157372_10053512 Ga0157372_100535122 165
424 3300013307 Ga0157372_10264173 Ga0157372_102641732 165
425 3300020069 Ga0197907_11150113 Ga0197907_111501131 165
426 3300020070 Ga0206356_10160926 Ga0206356_101609263 165
427 3300025321 Ga0207656_10303620 Ga0207656_103036202 165
428 3300025909 Ga0207705_10004292 Ga0207705_100042923 165
429 3300025909 Ga0207705_10294957 Ga0207705_102949571 165
430 3300025912 Ga0207707_10000306 Ga0207707_1000030625 165
431 3300025912 Ga0207707_10022731 Ga0207707_100227313 165
432 3300025913 Ga0207695_10099938 Ga0207695_100999382 165
433 3300025913 Ga0207695_10161651 Ga0207695_101616512 165
434 3300025913 Ga0207695_10866429 Ga0207695_108664291 165
435 3300025917 Ga0207660_10001210 Ga0207660_1000121012 165
436 3300025917 Ga0207660_10006274 Ga0207660_100062749 165
437 3300025919 Ga0207657_10579335 Ga0207657_105793351 165
438 3300025920 Ga0207649_10012151 Ga0207649_100121512 165
439 3300025920 Ga0207649_10080553 Ga0207649_100805533 165
440 3300025921 Ga0207652_10000048 Ga0207652_1000004887 165
441 3300025932 Ga0207690_10000656 Ga0207690_1000065615 165
442 3300025932 Ga0207690_10006762 Ga0207690_100067625 165
443 3300025941 Ga0207711_10852364 Ga0207711_108523641 165
444 3300025944 Ga0207661_10003473 Ga0207661_100034732 165
445 3300025945 Ga0207679_10044348 Ga0207679_100443484 165
446 3300025949 Ga0207667_10003235 Ga0207667_100032357 165
447 3300025949 Ga0207667_10012888 Ga0207667_1001288810 165
448 3300025981 Ga0207640_10012741 Ga0207640_100127413 165
449 3300025981 Ga0207640_10208915 Ga0207640_102089152 165
450 3300025981 Ga0207640_10295410 Ga0207640_102954102 165
451 3300026041 Ga0207639_10001157 Ga0207639_1000115715 165
452 3300026041 Ga0207639_10042160 Ga0207639_100421603 165
453 3300026067 Ga0207678_10003947 Ga0207678_1000394716 165
454 3300026067 Ga0207678_10279521 Ga0207678_102795212 165
455 3300026078 Ga0207702_10054406 Ga0207702_100544063 165
456 3300026142 Ga0207698_10157632 Ga0207698_101576322 165
457 3300026142 Ga0207698_10269363 Ga0207698_102693631 165
458 3300037312 Ga0395899_0105269 Ga0395899_0105269_882_1379 165
459 3300037418 Ga0395900_0133207 Ga0395900_0133207_986_1483 165
460 3300037466 Ga0395898_0017013 Ga0395898_0017013_689_1186 165
461 3300038443 Ga0395901_0170413 Ga0395901_0170413_1049_1546 165
462 3300049663 Ga0501223_000072 Ga0501223_000072_10448_10966 165
463 3300049664 Ga0501224_000004 Ga0501224_000004_108436_108954 165
464 3300049668 Ga0501233_006413 Ga0501233_006413_1427_1945 165
465 3300049669 Ga0501235_012914 Ga0501235_012914_775_1293 165
466 3300049705 Ga0501225_0000048 Ga0501225_0000048_30596_31114 165
467 3300049853 Ga0501226_000018 Ga0501226_000018_60116_60634 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

41

157

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9793 10 162
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.971 10 162
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9566 10 162
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9532 10 162
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9452 10 162
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9755 10 162 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9488 10 162 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8335 15 71 3.30.720.100
af_Q558Z3_90_214_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7496 78 101 3.40.50.2300
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7388 14 121 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A534H6Z1-F1-model_v4 VOC family protein 1.003 84 164
AF-A0A4Q6GFM2-F1-model_v4 deleted 1.003 87 164
AF-A0A4Q3P670-F1-model_v4 deleted 1.002 89 163
AF-A0A7W0WRQ8-F1-model_v4 VOC family protein 0.9944 89 163
AF-A0A2M8V7D6-F1-model_v4 deleted 0.9924 57 163

Feature Viewer

pLDDT pTM Quality
91.94 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map