F449833

General Info

Members Datasets Scaffolds Average Seq Length
467 220 934 99

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100394742|Ga0075434_1003947422
Length 108
Sequence VKITEEEVRYVADLANLKLTEAEIHKFQADLDEILAHMDKLNEIDTSSVPPMAQVLYRSYDGAAAVTSPETATLREDCERPPLGNDRALANAPLAGAGYFKVPKVIER

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 98.72
Stem 0
Stem Tuber 0
Unclassified 23.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100394742 3300006871 Bacteria 1404
2 Ga0070658_10049175 3300005327 Unclassified 3415
3 Ga0070658_10409536 3300005327 Bacteria 1165
4 Ga0070683_100000008 3300005329 Bacteria 329206
5 Ga0070683_100005005 3300005329 Bacteria 10998
6 Ga0070683_100067051 3300005329 Bacteria 3342
7 Ga0070683_100116171 3300005329 Bacteria 2526
8 Ga0070683_100714823 3300005329 Bacteria 959
9 Ga0068869_100008580 3300005334 Bacteria 6597
10 Ga0068869_100485760 3300005334 Bacteria 1029
11 Ga0068869_100547652 3300005334 Bacteria 971
12 Ga0068869_101418768 3300005334 Bacteria 615
13 Ga0070680_100141871 3300005336 Bacteria 2015
14 Ga0068868_100631229 3300005338 Bacteria 952
15 Ga0068868_101545545 3300005338 Unclassified 622
16 Ga0070660_100102320 3300005339 Bacteria 2271
17 Ga0070660_100118733 3300005339 Bacteria 2109
18 Ga0070660_101358846 3300005339 Unclassified 603
19 Ga0070689_101206792 3300005340 Bacteria 679
20 Ga0070691_10007006 3300005341 Bacteria 5165
21 Ga0070661_100309383 3300005344 Bacteria 1231
22 Ga0070661_100767009 3300005344 Archaea 790
23 Ga0070692_10127526 3300005345 Bacteria 1426
24 Ga0070692_10396142 3300005345 Unclassified 870
25 Ga0070675_100459933 3300005354 Bacteria 1142
26 Ga0070673_100047582 3300005364 Bacteria 3338
27 Ga0070659_100015755 3300005366 Bacteria 5665
28 Ga0070714_100057665 3300005435 Bacteria 3325
29 Ga0070714_100322409 3300005435 Bacteria 1445
30 Ga0070713_100159791 3300005436 Bacteria 2010
31 Ga0070713_100506888 3300005436 Bacteria 1139
32 Ga0070713_100550816 3300005436 Bacteria 1092
33 Ga0070713_100688452 3300005436 Bacteria 975
34 Ga0070713_102266220 3300005436 Unclassified 526
35 Ga0070710_10156454 3300005437 Bacteria 1410
36 Ga0070710_10542695 3300005437 Bacteria 802
37 Ga0070711_100021659 3300005439 Bacteria 4159
38 Ga0070705_101011427 3300005440 Bacteria 675
39 Ga0070663_100054411 3300005455 Bacteria 2860
40 Ga0070678_100587346 3300005456 Bacteria 993
41 Ga0070681_10030695 3300005458 Bacteria 5393
42 Ga0068867_100933093 3300005459 Bacteria 783
43 Ga0068867_101417423 3300005459 Unclassified 645
44 Ga0070698_101927205 3300005471 Unclassified 544
45 Ga0070699_100537940 3300005518 Bacteria 1063
46 Ga0070699_101837864 3300005518 Unclassified 554
47 Ga0070679_100051934 3300005530 Bacteria 4084
48 Ga0070684_100000002 3300005535 Bacteria 257669
49 Ga0070684_100026851 3300005535 Bacteria 4854
50 Ga0070684_100034112 3300005535 Bacteria 4349
51 Ga0070684_100131227 3300005535 Bacteria 2260
52 Ga0070684_100918191 3300005535 Archaea 820
53 Ga0070684_101862755 3300005535 Unclassified 568
54 Ga0070684_102228340 3300005535 Unclassified 517
55 Ga0068853_100006591 3300005539 Bacteria 9246
56 Ga0068853_100211190 3300005539 Bacteria 1769
57 Ga0068853_100698998 3300005539 Bacteria 967
58 Ga0070672_100841798 3300005543 Bacteria 808
59 Ga0070686_100325048 3300005544 Bacteria 1148
60 Ga0070686_101358258 3300005544 Unclassified 595
61 Ga0070695_100369098 3300005545 Bacteria 1080
62 Ga0070696_100005475 3300005546 Bacteria 8470
63 Ga0070693_100012211 3300005547 Bacteria 4343
64 Ga0070665_100122470 3300005548 Bacteria 2603
65 Ga0070665_100280822 3300005548 Bacteria 1667
66 Ga0070665_100592997 3300005548 Bacteria 1121
67 Ga0068855_100010536 3300005563 Bacteria 11150
68 Ga0068855_100013188 3300005563 Bacteria 9970
69 Ga0068855_100024985 3300005563 Bacteria 7151
70 Ga0068855_100264023 3300005563 Bacteria 1917
71 Ga0068855_100363040 3300005563 Bacteria 1593
72 Ga0068855_100812576 3300005563 Bacteria 993
73 Ga0068855_100816771 3300005563 Unclassified 990
74 Ga0068855_102252019 3300005563 Unclassified 546
75 Ga0070664_100345799 3300005564 Unclassified 1352
76 Ga0070664_101251814 3300005564 Bacteria 700
77 Ga0068857_100045413 3300005577 Bacteria 3897
78 Ga0068857_100247096 3300005577 Bacteria 1635
79 Ga0068857_101260716 3300005577 Unclassified 717
80 Ga0068856_100090403 3300005614 Bacteria 3045
81 Ga0068856_100290670 3300005614 Bacteria 1651
82 Ga0068856_100366145 3300005614 Bacteria 1460
83 Ga0068856_100423154 3300005614 Unclassified 1352
84 Ga0068852_100144512 3300005616 Bacteria 2205
85 Ga0068852_100501171 3300005616 Bacteria 1209
86 Ga0068852_100585202 3300005616 Bacteria 1119
87 Ga0068852_102699305 3300005616 Bacteria 516
88 Ga0068859_100009488 3300005617 Bacteria 9828
89 Ga0068859_101164240 3300005617 Unclassified 849
90 Ga0068864_101820116 3300005618 Unclassified 614
91 Ga0068863_101012049 3300005841 Unclassified 834
92 Ga0068858_100009249 3300005842 Bacteria 9409
93 Ga0068860_100082326 3300005843 Bacteria 3061
94 Ga0068860_100936306 3300005843 Unclassified 883
95 Ga0068860_100987846 3300005843 Unclassified 859
96 Ga0068860_101835961 3300005843 Unclassified 628
97 Ga0070717_10025032 3300006028 Bacteria 4741
98 Ga0070717_10195545 3300006028 Unclassified 1769
99 Ga0070712_100087910 3300006175 Unclassified 2269
100 Ga0097621_100058199 3300006237 Bacteria 3162
101 Ga0097621_100295311 3300006237 Bacteria 1430
102 Ga0097621_101988814 3300006237 Unclassified 555
103 Ga0068871_100023074 3300006358 Bacteria 4806
104 Ga0068871_100222589 3300006358 Bacteria 1635
105 Ga0068871_100311665 3300006358 Unclassified 1384
106 Ga0068871_100655346 3300006358 Bacteria 959
107 Ga0068871_100781262 3300006358 Unclassified 879
108 Ga0075430_100025550 3300006846 Bacteria 5026
109 Ga0075431_100074140 3300006847 Bacteria 3512
110 Ga0068865_101525168 3300006881 Unclassified 599
111 Ga0097620_100009488 3300006931 Bacteria 9828
112 Ga0097620_101164469 3300006931 Unclassified 849
113 Ga0099795_10198016 3300007788 Bacteria 846
114 Ga0105240_10001518 3300009093 Bacteria 39483
115 Ga0105240_10605040 3300009093 Bacteria 1206
116 Ga0105240_10731760 3300009093 Bacteria 1077
117 Ga0105240_11349785 3300009093 Unclassified 751
118 Ga0105240_11721866 3300009093 Unclassified 654
119 Ga0105245_10074481 3300009098 Bacteria 3089
120 Ga0105245_10115750 3300009098 Bacteria 2499
121 Ga0105245_10186520 3300009098 Bacteria 1984
122 Ga0105245_10386736 3300009098 Bacteria 1394
123 Ga0105245_11182777 3300009098 Bacteria 812
124 Ga0105245_11426437 3300009098 Bacteria 743
125 Ga0105245_11542079 3300009098 Unclassified 716
126 Ga0105245_11986125 3300009098 Bacteria 635
127 Ga0105247_10211927 3300009101 Unclassified 1307
128 Ga0114129_10202087 3300009147 Bacteria 2691
129 Ga0105243_10328727 3300009148 Bacteria 1396
130 Ga0105243_10451244 3300009148 Bacteria 1206
131 Ga0105243_10546398 3300009148 Bacteria 1106
132 Ga0105243_12084842 3300009148 Unclassified 602
133 Ga0105241_10005139 3300009174 Bacteria 9651
134 Ga0105241_10030729 3300009174 Bacteria 4017
135 Ga0105241_10762489 3300009174 Unclassified 888
136 Ga0105241_10869320 3300009174 Unclassified 835
137 Ga0105241_11501407 3300009174 Bacteria 648
138 Ga0105242_10005448 3300009176 Bacteria 9831
139 Ga0105242_10112738 3300009176 Unclassified 2321
140 Ga0105242_10135283 3300009176 Bacteria 2132
141 Ga0105242_10151454 3300009176 Bacteria 2022
142 Ga0105242_10349781 3300009176 Bacteria 1365
143 Ga0105242_10465982 3300009176 Bacteria 1194
144 Ga0105242_11662013 3300009176 Unclassified 674
145 Ga0105242_12716863 3300009176 Bacteria 545
146 Ga0105248_10040966 3300009177 Bacteria 5193
147 Ga0105248_10412492 3300009177 Bacteria 1521
148 Ga0105248_10677939 3300009177 Unclassified 1163
149 Ga0105248_10693098 3300009177 Bacteria 1149
150 Ga0105248_11517360 3300009177 Unclassified 759
151 Ga0105237_10013901 3300009545 Bacteria 8423
152 Ga0105237_10017078 3300009545 Bacteria 7530
153 Ga0105237_10051514 3300009545 Bacteria 4135
154 Ga0105237_10155892 3300009545 Bacteria 2280
155 Ga0105238_10009991 3300009551 Bacteria 9517
156 Ga0105238_10010270 3300009551 Bacteria 9390
157 Ga0105238_10145382 3300009551 Bacteria 2347
158 Ga0105238_10227622 3300009551 Bacteria 1841
159 Ga0105238_10641599 3300009551 Bacteria 1072
160 Ga0105238_10837116 3300009551 Unclassified 937
161 Ga0105238_10838106 3300009551 Bacteria 936
162 Ga0105249_10017964 3300009553 Bacteria 6286
163 Ga0105249_10543092 3300009553 Bacteria 1212
164 Ga0105249_10631952 3300009553 Unclassified 1127
165 Ga0105249_11236963 3300009553 Bacteria 818
166 Ga0105239_10005343 3300010375 Bacteria 15070
167 Ga0105239_10037319 3300010375 Bacteria 5328
168 Ga0105239_10059063 3300010375 Bacteria 4209
169 Ga0105239_10098780 3300010375 Bacteria 3227
170 Ga0105239_10443092 3300010375 Bacteria 1473
171 Ga0105239_11384619 3300010375 Unclassified 812
172 Ga0105246_10016619 3300011119 Bacteria 4661
173 Ga0105246_10043701 3300011119 Bacteria 3041
174 Ga0105246_10349409 3300011119 Bacteria 1211
175 Ga0105246_10695368 3300011119 Bacteria 890
176 Ga0105246_11365129 3300011119 Bacteria 660
177 Ga0105246_12317433 3300011119 Unclassified 525
178 Ga0157370_10011788 3300013104 Bacteria 9123
179 Ga0157370_10064603 3300013104 Bacteria 3464
180 Ga0157369_10009266 3300013105 Bacteria 11264
181 Ga0157369_10066367 3300013105 Bacteria 3882
182 Ga0157369_10100685 3300013105 Bacteria 3080
183 Ga0157369_10105312 3300013105 Bacteria 3003
184 Ga0157369_10180545 3300013105 Bacteria 2221
185 Ga0157374_10054112 3300013296 Bacteria 3743
186 Ga0157374_10495270 3300013296 Bacteria 1226
187 Ga0157374_10561521 3300013296 Bacteria 1150
188 Ga0157374_10838886 3300013296 Bacteria 936
189 Ga0157374_11518898 3300013296 Unclassified 693
190 Ga0157378_10006420 3300013297 Bacteria 10281
191 Ga0157378_10584154 3300013297 Bacteria 1126
192 Ga0157378_11834369 3300013297 Bacteria 655
193 Ga0163162_10320413 3300013306 Bacteria 1683
194 Ga0157372_10010322 3300013307 Bacteria 9923
195 Ga0157372_10024038 3300013307 Bacteria 6611
196 Ga0157372_10025941 3300013307 Bacteria 6375
197 Ga0157372_10035388 3300013307 Bacteria 5497
198 Ga0157372_10259252 3300013307 Unclassified 2019
199 Ga0157375_10005851 3300013308 Bacteria 10701
200 Ga0157375_12114482 3300013308 Unclassified 670
201 Ga0163163_10020413 3300014325 Bacteria 6238
202 Ga0163163_10021818 3300014325 Bacteria 6050
203 Ga0163163_10330517 3300014325 Bacteria 1579
204 Ga0163163_10406562 3300014325 Bacteria 1420
205 Ga0157377_10826403 3300014745 Unclassified 686
206 Ga0157379_10569385 3300014968 Bacteria 1055
207 Ga0157379_12053139 3300014968 Unclassified 566
208 Ga0157376_10375882 3300014969 Bacteria 1367
209 Ga0157376_10418982 3300014969 Bacteria 1299
210 Ga0157376_10848653 3300014969 Bacteria 929
211 Ga0182007_10193881 3300015262 Unclassified 708
212 Ga0206356_11092160 3300020070 Unclassified 1482
213 Ga0213875_10158869 3300021388 Bacteria 1060
214 Ga0207685_10110232 3300025905 Unclassified 1192
215 Ga0207699_10158971 3300025906 Unclassified 1502
216 Ga0207705_10764016 3300025909 Unclassified 751
217 Ga0207654_10012220 3300025911 Bacteria 4395
218 Ga0207654_10040881 3300025911 Bacteria 2615
219 Ga0207654_10585363 3300025911 Bacteria 795
220 Ga0207654_10640930 3300025911 Unclassified 760
221 Ga0207707_10074683 3300025912 Bacteria 2957
222 Ga0207695_10000264 3300025913 Bacteria 132624
223 Ga0207695_10004694 3300025913 Bacteria 18502
224 Ga0207695_10268039 3300025913 Bacteria 1604
225 Ga0207695_11109694 3300025913 Unclassified 671
226 Ga0207671_10016639 3300025914 Bacteria 5710
227 Ga0207671_10051601 3300025914 Bacteria 3048
228 Ga0207671_10730076 3300025914 Bacteria 787
229 Ga0207663_10133514 3300025916 Bacteria 1719
230 Ga0207663_10485156 3300025916 Bacteria 958
231 Ga0207663_11253384 3300025916 Bacteria 597
232 Ga0207660_10053048 3300025917 Bacteria 2889
233 Ga0207660_11554585 3300025917 Unclassified 534
234 Ga0207657_10876271 3300025919 Bacteria 692
235 Ga0207649_10072699 3300025920 Bacteria 2201
236 Ga0207649_10085172 3300025920 Bacteria 2056
237 Ga0207652_10101240 3300025921 Bacteria 2544
238 Ga0207694_10011980 3300025924 Bacteria 6538
239 Ga0207694_10019312 3300025924 Bacteria 5152
240 Ga0207694_10041658 3300025924 Bacteria 3539
241 Ga0207694_10085823 3300025924 Unclassified 2478
242 Ga0207694_10578251 3300025924 Bacteria 944
243 Ga0207687_10003817 3300025927 Bacteria 10127
244 Ga0207687_10031205 3300025927 Bacteria 3600
245 Ga0207687_10068661 3300025927 Bacteria 2525
246 Ga0207687_10213172 3300025927 Bacteria 1516
247 Ga0207687_11056950 3300025927 Unclassified 697
248 Ga0207687_11260611 3300025927 Bacteria 635
249 Ga0207700_10001021 3300025928 Bacteria 16157
250 Ga0207700_10377006 3300025928 Bacteria 1240
251 Ga0207700_11107325 3300025928 Unclassified 708
252 Ga0207664_10246133 3300025929 Bacteria 1558
253 Ga0207664_10253526 3300025929 Bacteria 1536
254 Ga0207664_11209041 3300025929 Unclassified 674
255 Ga0207690_10070046 3300025932 Bacteria 2414
256 Ga0207686_10002100 3300025934 Bacteria 10988
257 Ga0207686_10090023 3300025934 Bacteria 2024
258 Ga0207686_10183058 3300025934 Bacteria 1487
259 Ga0207686_10487431 3300025934 Bacteria 954
260 Ga0207686_10873995 3300025934 Unclassified 724
261 Ga0207709_10357501 3300025935 Unclassified 1104
262 Ga0207709_10479141 3300025935 Bacteria 967
263 Ga0207670_10557277 3300025936 Bacteria 937
264 Ga0207670_10701645 3300025936 Bacteria 838
265 Ga0207704_10007915 3300025938 Bacteria 5050
266 Ga0207704_10029592 3300025938 Bacteria 3057
267 Ga0207704_11197867 3300025938 Unclassified 647
268 Ga0207711_10023096 3300025941 Bacteria 5208
269 Ga0207711_10188779 3300025941 Bacteria 1877
270 Ga0207711_10505073 3300025941 Unclassified 1127
271 Ga0207689_10353318 3300025942 Bacteria 1222
272 Ga0207689_10561750 3300025942 Bacteria 959
273 Ga0207689_10856175 3300025942 Bacteria 767
274 Ga0207661_10000008 3300025944 Bacteria 451211
275 Ga0207661_10022215 3300025944 Bacteria 4773
276 Ga0207661_10044832 3300025944 Bacteria 3498
277 Ga0207661_10055760 3300025944 Bacteria 3171
278 Ga0207661_10084489 3300025944 Bacteria 2629
279 Ga0207661_10095678 3300025944 Bacteria 2483
280 Ga0207661_10139265 3300025944 Unclassified 2087
281 Ga0207661_10288337 3300025944 Bacteria 1469
282 Ga0207661_10512922 3300025944 Bacteria 1096
283 Ga0207661_10873838 3300025944 Unclassified 828
284 Ga0207661_11012271 3300025944 Bacteria 765
285 Ga0207679_10541817 3300025945 Bacteria 1043
286 Ga0207667_10010458 3300025949 Bacteria 10843
287 Ga0207667_10013209 3300025949 Bacteria 9468
288 Ga0207667_10017287 3300025949 Bacteria 8124
289 Ga0207667_10105511 3300025949 Bacteria 2907
290 Ga0207667_10137402 3300025949 Bacteria 2517
291 Ga0207651_11808024 3300025960 Unclassified 550
292 Ga0207712_10003052 3300025961 Bacteria 10682
293 Ga0207712_10100217 3300025961 Unclassified 2152
294 Ga0207677_11639119 3300026023 Unclassified 596
295 Ga0207703_10012970 3300026035 Bacteria 6495
296 Ga0207639_10057572 3300026041 Bacteria 2985
297 Ga0207639_10176953 3300026041 Bacteria 1812
298 Ga0207639_10209816 3300026041 Bacteria 1676
299 Ga0207639_11131461 3300026041 Unclassified 734
300 Ga0207639_11481938 3300026041 Unclassified 637
301 Ga0207678_10080668 3300026067 Bacteria 2785
302 Ga0207678_10102722 3300026067 Unclassified 2440
303 Ga0207702_10071455 3300026078 Bacteria 2988
304 Ga0207702_10245555 3300026078 Bacteria 1679
305 Ga0207702_10375461 3300026078 Unclassified 1366
306 Ga0207641_11172917 3300026088 Unclassified 767
307 Ga0207648_10625478 3300026089 Bacteria 994
308 Ga0207676_11788219 3300026095 Unclassified 613
309 Ga0207674_10001580 3300026116 Bacteria 29324
310 Ga0207674_10002827 3300026116 Bacteria 21583
311 Ga0207674_10422529 3300026116 Bacteria 1288
312 Ga0207675_102133062 3300026118 Unclassified 576
313 Ga0207683_11310162 3300026121 Unclassified 670
314 Ga0207698_10149121 3300026142 Bacteria 2027
315 Ga0207698_10431625 3300026142 Bacteria 1267
316 Ga0207698_11507610 3300026142 Unclassified 688
317 Ga0207698_11762971 3300026142 Bacteria 634
318 Ga0268266_10076884 3300028379 Bacteria 2902
319 Ga0268266_10518862 3300028379 Unclassified 1139
320 Ga0268264_10091344 3300028381 Bacteria 2626
321 Ga0268264_11208017 3300028381 Unclassified 766
322 Ga0268264_11716048 3300028381 Unclassified 638
323 Ga0265760_10190282 3300031090 Bacteria 689
324 Ga0265331_10089544 3300031250 Bacteria 1423
325 Ga0265331_10339092 3300031250 Unclassified 673
326 Ga0265316_11123021 3300031344 Unclassified 545
327 Ga0265313_10001995 3300031595 Bacteria 18399
328 Ga0265314_10002506 3300031711 Bacteria 18730
329 Ga0373934_0002377 3300035086 Bacteria 6922
330 Ga0373934_0462610 3300035086 Unclassified 532
331 Ga0373949_0248087 3300035090 Unclassified 550
332 Ga0373923_0084292 3300035111 Bacteria 1382
333 Ga0373923_0100896 3300035111 Unclassified 1272
334 Ga0373923_0126722 3300035111 Bacteria 1145
335 Ga0373953_0003082 3300035117 Bacteria 5125
336 Ga0373953_0046688 3300035117 Bacteria 1740
337 Ga0373953_0071775 3300035117 Bacteria 1429
338 Ga0373953_0576808 3300035117 Bacteria 501
339 Ga0373954_0005071 3300035118 Bacteria 5682
340 Ga0373954_0081513 3300035118 Bacteria 1546
341 Ga0373954_0261959 3300035118 Unclassified 851
342 Ga0373956_0354243 3300035119 Bacteria 700
343 Ga0373957_0008643 3300035120 Bacteria 3309
344 Ga0373943_0144133 3300035170 Bacteria 1286
345 Ga0373943_0378067 3300035170 Bacteria 815
346 Ga0373946_0403346 3300035171 Bacteria 690
347 Ga0373955_0006035 3300035172 Bacteria 5496
348 Ga0373955_0020897 3300035172 Bacteria 3296
349 Ga0373955_0348637 3300035172 Unclassified 896
350 Ga0373955_0725450 3300035172 Bacteria 610
351 Ga0373935_1051914 3300035692 Unclassified 605
352 Ga0373927_0062677 3300035695 Bacteria 2405
353 Ga0373927_0509778 3300035695 Bacteria 795
354 Ga0373927_1162499 3300035695 Bacteria 509
355 Ga0373933_0214669 3300035724 Bacteria 1233
356 Ga0373933_0354018 3300035724 Bacteria 954
357 Ga0373933_0411387 3300035724 Bacteria 883
358 Ga0373947_0197615 3300035725 Bacteria 1315
359 Ga0373947_0325760 3300035725 Bacteria 1028
360 Ga0373947_0375203 3300035725 Bacteria 957
361 Ga0373937_0001967 3300036401 Bacteria 17189
362 Ga0373937_0005056 3300036401 Bacteria 11230
363 Ga0373937_0044343 3300036401 Bacteria 4061
364 Ga0373937_0227400 3300036401 Bacteria 1756
365 Ga0373937_0286817 3300036401 Bacteria 1555
366 Ga0373937_0300959 3300036401 Bacteria 1516
367 Ga0373937_0802886 3300036401 Bacteria 889
368 Ga0373937_0867466 3300036401 Bacteria 851
369 Ga0373937_1493061 3300036401 Unclassified 623
370 Ga0373925_0134237 3300037068 Bacteria 1932
371 Ga0373925_0182419 3300037068 Unclassified 1662
372 Ga0373925_0780337 3300037068 Bacteria 788
373 Ga0373925_1142781 3300037068 Bacteria 640
374 Ga0373925_1587568 3300037068 Unclassified 535
375 Ga0395900_0777389 3300037418 Bacteria 886
376 Ga0395898_0964070 3300037466 Bacteria 790
377 Ga0395905_0826543 3300037471 Bacteria 829
378 Ga0436364_1368618 3300037853 Bacteria 5136
379 Ga0436360_1004746 3300039438 Unclassified 829
380 Ga0436361_1113725 3300039447 Bacteria 1448
381 Ga0436363_0439567 3300039450 Unclassified 590
382 Ga0436362_0774422 3300039453 Bacteria 2555
383 Ga0436362_1137194 3300039453 Unclassified 590
384 Ga0451798_0099841 3300041458 Unclassified 580
385 Ga0439448_0295867 3300042005 Unclassified 574
386 Ga0451577_0194603 3300042876 Bacteria 1830
387 Ga0451577_1859460 3300042876 Bacteria 528
388 Ga0453683_0430144 3300044673 Bacteria 853
389 Ga0466961_0512121 3300044693 Bacteria 724
390 Ga0453684_0110924 3300044712 Bacteria 3333
391 Ga0453684_0447548 3300044712 Bacteria 1438
392 Ga0453684_1317195 3300044712 Bacteria 753
393 Ga0453684_1509698 3300044712 Bacteria 693
394 Ga0466959_0537311 3300045049 Unclassified 789
395 Ga0451576_1294174 3300045051 Bacteria 760
396 Ga0451576_1535233 3300045051 Bacteria 691
397 Ga0466958_0503772 3300045836 Unclassified 786
398 Ga0466967_0424678 3300045976 Bacteria 1296
399 Ga0495651_0054709 3300046462 Bacteria 3068
400 Ga0495580_0081990 3300046472 Bacteria 2248
401 Ga0495580_0197207 3300046472 Bacteria 1388
402 Ga0495580_0421913 3300046472 Bacteria 897
403 Ga0495582_0345178 3300046473 Bacteria 857
404 Ga0495582_0711838 3300046473 Bacteria 581
405 Ga0495639_0156044 3300046475 Bacteria 1103
406 Ga0495618_0584822 3300046514 Unclassified 666
407 Ga0495652_0066348 3300046529 Bacteria 3029
408 Ga0495652_0302412 3300046529 Unclassified 1162
409 Ga0495587_0064079 3300046536 Bacteria 2148
410 Ga0495645_0155341 3300046543 Bacteria 1586
411 Ga0495667_0080599 3300046559 Bacteria 2116
412 Ga0495599_0003255 3300046678 Bacteria 9459
413 Ga0495623_0251205 3300046679 Bacteria 994
414 Ga0495623_0382081 3300046679 Bacteria 761
415 Ga0495669_0262239 3300046684 Bacteria 830
416 Ga0495600_0517623 3300046809 Bacteria 732
417 Ga0495604_0087408 3300047317 Bacteria 2322
418 Ga0495684_0012249 3300047471 Bacteria 6616
419 Ga0495684_0439868 3300047471 Bacteria 908
420 Ga0495684_0809337 3300047471 Bacteria 611
421 Ga0495593_0696128 3300047673 Unclassified 510
422 Ga0495602_0332708 3300048088 Bacteria 1101
423 Ga0496112_0891154 3300048915 Bacteria 812
424 Ga0496115_0532172 3300048918 Bacteria 941
425 Ga0501031_0001527 3300049568 Bacteria 14387
426 Ga0501032_0001793 3300049569 Bacteria 16954
427 Ga0501033_0056950 3300049570 Bacteria 2888
428 Ga0501034_0019531 3300049571 Bacteria 6930
429 Ga0501034_0048074 3300049571 Bacteria 4306
430 Ga0501037_0004387 3300049573 Bacteria 10245
431 Ga0501038_0047041 3300049574 Bacteria 3738
432 Ga0501039_0004550 3300049575 Bacteria 10472
433 Ga0501040_0630840 3300049576 Unclassified 774
434 Ga0501041_0921898 3300049577 Unclassified 561
435 Ga0501042_0780884 3300049578 Bacteria 695
436 Ga0501043_0010441 3300049579 Bacteria 7274
437 Ga0501046_0000835 3300049580 Bacteria 30000
438 Ga0501047_0017675 3300049581 Bacteria 6832
439 Ga0501048_0028592 3300049582 Bacteria 4047
440 Ga0501067_0002051 3300049583 Bacteria 11112
441 Ga0501068_0005564 3300049584 Bacteria 6900
442 Ga0501069_0002179 3300049585 Bacteria 9863
443 Ga0501070_0006188 3300049586 Bacteria 10194
444 Ga0501072_0002071 3300049588 Bacteria 14913
445 Ga0501073_0004886 3300049589 Bacteria 10064
446 Ga0501074_0033404 3300049590 Bacteria 3727
447 Ga0501074_0851306 3300049590 Bacteria 642
448 Ga0501076_0246868 3300049592 Bacteria 1460
449 Ga0501077_0033909 3300049593 Bacteria 3249
450 Ga0501249_128983 3300049679 Unclassified 622
451 Ga0501079_0004888 3300049741 Bacteria 9936
452 Ga0501080_0000129 3300049742 Bacteria 53483
453 Ga0501081_1076979 3300049743 Bacteria 608
454 Ga0501083_0017984 3300049744 Bacteria 4929
455 Ga0501035_0118174 3300049822 Bacteria 2319
456 Ga0501044_0011445 3300049823 Bacteria 9610
457 Ga0501045_0176299 3300049824 Bacteria 1592
458 nmdc:mga05p37_220458_c1 3300050507 Bacteria 2289
459 nmdc:mga09592_1291599_c1 3300050508 Unclassified 600
460 nmdc:mga0qj67_77765_c1 3300050509 Bacteria 2655
461 nmdc:mga06r32_36587_c1 3300050510 Bacteria 4640
462 nmdc:mga0n895_1504785_c1 3300050512 Bacteria 639
463 Ga0495619_0426086 3300053085 Bacteria 915
464 Ga0501084_0000429 3300054114 Bacteria 32256
465 Ga0501084_0542509 3300054114 Bacteria 983
466 Ga0501082_0033860 3300060353 Bacteria 4406
467 Ga0530510_0636301 3300061734 Unclassified 812
468 Ga0075434_100394742
469 Ga0070658_10049175
470 Ga0070658_10409536
471 Ga0070683_100000008
472 Ga0070683_100005005
473 Ga0070683_100067051
474 Ga0070683_100116171
475 Ga0070683_100714823
476 Ga0068869_100008580
477 Ga0068869_100485760
478 Ga0068869_100547652
479 Ga0068869_101418768
480 Ga0070680_100141871
481 Ga0068868_100631229
482 Ga0068868_101545545
483 Ga0070660_100102320
484 Ga0070660_100118733
485 Ga0070660_101358846
486 Ga0070689_101206792
487 Ga0070691_10007006
488 Ga0070661_100309383
489 Ga0070661_100767009
490 Ga0070692_10127526
491 Ga0070692_10396142
492 Ga0070675_100459933
493 Ga0070673_100047582
494 Ga0070659_100015755
495 Ga0070714_100057665
496 Ga0070714_100322409
497 Ga0070713_100159791
498 Ga0070713_100506888
499 Ga0070713_100550816
500 Ga0070713_100688452
501 Ga0070713_102266220
502 Ga0070710_10156454
503 Ga0070710_10542695
504 Ga0070711_100021659
505 Ga0070705_101011427
506 Ga0070663_100054411
507 Ga0070678_100587346
508 Ga0070681_10030695
509 Ga0068867_100933093
510 Ga0068867_101417423
511 Ga0070698_101927205
512 Ga0070699_100537940
513 Ga0070699_101837864
514 Ga0070679_100051934
515 Ga0070684_100000002
516 Ga0070684_100026851
517 Ga0070684_100034112
518 Ga0070684_100131227
519 Ga0070684_100918191
520 Ga0070684_101862755
521 Ga0070684_102228340
522 Ga0068853_100006591
523 Ga0068853_100211190
524 Ga0068853_100698998
525 Ga0070672_100841798
526 Ga0070686_100325048
527 Ga0070686_101358258
528 Ga0070695_100369098
529 Ga0070696_100005475
530 Ga0070693_100012211
531 Ga0070665_100122470
532 Ga0070665_100280822
533 Ga0070665_100592997
534 Ga0068855_100010536
535 Ga0068855_100013188
536 Ga0068855_100024985
537 Ga0068855_100264023
538 Ga0068855_100363040
539 Ga0068855_100812576
540 Ga0068855_100816771
541 Ga0068855_102252019
542 Ga0070664_100345799
543 Ga0070664_101251814
544 Ga0068857_100045413
545 Ga0068857_100247096
546 Ga0068857_101260716
547 Ga0068856_100090403
548 Ga0068856_100290670
549 Ga0068856_100366145
550 Ga0068856_100423154
551 Ga0068852_100144512
552 Ga0068852_100501171
553 Ga0068852_100585202
554 Ga0068852_102699305
555 Ga0068859_100009488
556 Ga0068859_101164240
557 Ga0068864_101820116
558 Ga0068863_101012049
559 Ga0068858_100009249
560 Ga0068860_100082326
561 Ga0068860_100936306
562 Ga0068860_100987846
563 Ga0068860_101835961
564 Ga0070717_10025032
565 Ga0070717_10195545
566 Ga0070712_100087910
567 Ga0097621_100058199
568 Ga0097621_100295311
569 Ga0097621_101988814
570 Ga0068871_100023074
571 Ga0068871_100222589
572 Ga0068871_100311665
573 Ga0068871_100655346
574 Ga0068871_100781262
575 Ga0075430_100025550
576 Ga0075431_100074140
577 Ga0068865_101525168
578 Ga0097620_100009488
579 Ga0097620_101164469
580 Ga0099795_10198016
581 Ga0105240_10001518
582 Ga0105240_10605040
583 Ga0105240_10731760
584 Ga0105240_11349785
585 Ga0105240_11721866
586 Ga0105245_10074481
587 Ga0105245_10115750
588 Ga0105245_10186520
589 Ga0105245_10386736
590 Ga0105245_11182777
591 Ga0105245_11426437
592 Ga0105245_11542079
593 Ga0105245_11986125
594 Ga0105247_10211927
595 Ga0114129_10202087
596 Ga0105243_10328727
597 Ga0105243_10451244
598 Ga0105243_10546398
599 Ga0105243_12084842
600 Ga0105241_10005139
601 Ga0105241_10030729
602 Ga0105241_10762489
603 Ga0105241_10869320
604 Ga0105241_11501407
605 Ga0105242_10005448
606 Ga0105242_10112738
607 Ga0105242_10135283
608 Ga0105242_10151454
609 Ga0105242_10349781
610 Ga0105242_10465982
611 Ga0105242_11662013
612 Ga0105242_12716863
613 Ga0105248_10040966
614 Ga0105248_10412492
615 Ga0105248_10677939
616 Ga0105248_10693098
617 Ga0105248_11517360
618 Ga0105237_10013901
619 Ga0105237_10017078
620 Ga0105237_10051514
621 Ga0105237_10155892
622 Ga0105238_10009991
623 Ga0105238_10010270
624 Ga0105238_10145382
625 Ga0105238_10227622
626 Ga0105238_10641599
627 Ga0105238_10837116
628 Ga0105238_10838106
629 Ga0105249_10017964
630 Ga0105249_10543092
631 Ga0105249_10631952
632 Ga0105249_11236963
633 Ga0105239_10005343
634 Ga0105239_10037319
635 Ga0105239_10059063
636 Ga0105239_10098780
637 Ga0105239_10443092
638 Ga0105239_11384619
639 Ga0105246_10016619
640 Ga0105246_10043701
641 Ga0105246_10349409
642 Ga0105246_10695368
643 Ga0105246_11365129
644 Ga0105246_12317433
645 Ga0157370_10011788
646 Ga0157370_10064603
647 Ga0157369_10009266
648 Ga0157369_10066367
649 Ga0157369_10100685
650 Ga0157369_10105312
651 Ga0157369_10180545
652 Ga0157374_10054112
653 Ga0157374_10495270
654 Ga0157374_10561521
655 Ga0157374_10838886
656 Ga0157374_11518898
657 Ga0157378_10006420
658 Ga0157378_10584154
659 Ga0157378_11834369
660 Ga0163162_10320413
661 Ga0157372_10010322
662 Ga0157372_10024038
663 Ga0157372_10025941
664 Ga0157372_10035388
665 Ga0157372_10259252
666 Ga0157375_10005851
667 Ga0157375_12114482
668 Ga0163163_10020413
669 Ga0163163_10021818
670 Ga0163163_10330517
671 Ga0163163_10406562
672 Ga0157377_10826403
673 Ga0157379_10569385
674 Ga0157379_12053139
675 Ga0157376_10375882
676 Ga0157376_10418982
677 Ga0157376_10848653
678 Ga0182007_10193881
679 Ga0206356_11092160
680 Ga0213875_10158869
681 Ga0207685_10110232
682 Ga0207699_10158971
683 Ga0207705_10764016
684 Ga0207654_10012220
685 Ga0207654_10040881
686 Ga0207654_10585363
687 Ga0207654_10640930
688 Ga0207707_10074683
689 Ga0207695_10000264
690 Ga0207695_10004694
691 Ga0207695_10268039
692 Ga0207695_11109694
693 Ga0207671_10016639
694 Ga0207671_10051601
695 Ga0207671_10730076
696 Ga0207663_10133514
697 Ga0207663_10485156
698 Ga0207663_11253384
699 Ga0207660_10053048
700 Ga0207660_11554585
701 Ga0207657_10876271
702 Ga0207649_10072699
703 Ga0207649_10085172
704 Ga0207652_10101240
705 Ga0207694_10011980
706 Ga0207694_10019312
707 Ga0207694_10041658
708 Ga0207694_10085823
709 Ga0207694_10578251
710 Ga0207687_10003817
711 Ga0207687_10031205
712 Ga0207687_10068661
713 Ga0207687_10213172
714 Ga0207687_11056950
715 Ga0207687_11260611
716 Ga0207700_10001021
717 Ga0207700_10377006
718 Ga0207700_11107325
719 Ga0207664_10246133
720 Ga0207664_10253526
721 Ga0207664_11209041
722 Ga0207690_10070046
723 Ga0207686_10002100
724 Ga0207686_10090023
725 Ga0207686_10183058
726 Ga0207686_10487431
727 Ga0207686_10873995
728 Ga0207709_10357501
729 Ga0207709_10479141
730 Ga0207670_10557277
731 Ga0207670_10701645
732 Ga0207704_10007915
733 Ga0207704_10029592
734 Ga0207704_11197867
735 Ga0207711_10023096
736 Ga0207711_10188779
737 Ga0207711_10505073
738 Ga0207689_10353318
739 Ga0207689_10561750
740 Ga0207689_10856175
741 Ga0207661_10000008
742 Ga0207661_10022215
743 Ga0207661_10044832
744 Ga0207661_10055760
745 Ga0207661_10084489
746 Ga0207661_10095678
747 Ga0207661_10139265
748 Ga0207661_10288337
749 Ga0207661_10512922
750 Ga0207661_10873838
751 Ga0207661_11012271
752 Ga0207679_10541817
753 Ga0207667_10010458
754 Ga0207667_10013209
755 Ga0207667_10017287
756 Ga0207667_10105511
757 Ga0207667_10137402
758 Ga0207651_11808024
759 Ga0207712_10003052
760 Ga0207712_10100217
761 Ga0207677_11639119
762 Ga0207703_10012970
763 Ga0207639_10057572
764 Ga0207639_10176953
765 Ga0207639_10209816
766 Ga0207639_11131461
767 Ga0207639_11481938
768 Ga0207678_10080668
769 Ga0207678_10102722
770 Ga0207702_10071455
771 Ga0207702_10245555
772 Ga0207702_10375461
773 Ga0207641_11172917
774 Ga0207648_10625478
775 Ga0207676_11788219
776 Ga0207674_10001580
777 Ga0207674_10002827
778 Ga0207674_10422529
779 Ga0207675_102133062
780 Ga0207683_11310162
781 Ga0207698_10149121
782 Ga0207698_10431625
783 Ga0207698_11507610
784 Ga0207698_11762971
785 Ga0268266_10076884
786 Ga0268266_10518862
787 Ga0268264_10091344
788 Ga0268264_11208017
789 Ga0268264_11716048
790 Ga0265760_10190282
791 Ga0265331_10089544
792 Ga0265331_10339092
793 Ga0265316_11123021
794 Ga0265313_10001995
795 Ga0265314_10002506
796 Ga0373934_0002377
797 Ga0373934_0462610
798 Ga0373949_0248087
799 Ga0373923_0084292
800 Ga0373923_0100896
801 Ga0373923_0126722
802 Ga0373953_0003082
803 Ga0373953_0046688
804 Ga0373953_0071775
805 Ga0373953_0576808
806 Ga0373954_0005071
807 Ga0373954_0081513
808 Ga0373954_0261959
809 Ga0373956_0354243
810 Ga0373957_0008643
811 Ga0373943_0144133
812 Ga0373943_0378067
813 Ga0373946_0403346
814 Ga0373955_0006035
815 Ga0373955_0020897
816 Ga0373955_0348637
817 Ga0373955_0725450
818 Ga0373935_1051914
819 Ga0373927_0062677
820 Ga0373927_0509778
821 Ga0373927_1162499
822 Ga0373933_0214669
823 Ga0373933_0354018
824 Ga0373933_0411387
825 Ga0373947_0197615
826 Ga0373947_0325760
827 Ga0373947_0375203
828 Ga0373937_0001967
829 Ga0373937_0005056
830 Ga0373937_0044343
831 Ga0373937_0227400
832 Ga0373937_0286817
833 Ga0373937_0300959
834 Ga0373937_0802886
835 Ga0373937_0867466
836 Ga0373937_1493061
837 Ga0373925_0134237
838 Ga0373925_0182419
839 Ga0373925_0780337
840 Ga0373925_1142781
841 Ga0373925_1587568
842 Ga0395900_0777389
843 Ga0395898_0964070
844 Ga0395905_0826543
845 Ga0436364_1368618
846 Ga0436360_1004746
847 Ga0436361_1113725
848 Ga0436363_0439567
849 Ga0436362_0774422
850 Ga0436362_1137194
851 Ga0451798_0099841
852 Ga0439448_0295867
853 Ga0451577_0194603
854 Ga0451577_1859460
855 Ga0453683_0430144
856 Ga0466961_0512121
857 Ga0453684_0110924
858 Ga0453684_0447548
859 Ga0453684_1317195
860 Ga0453684_1509698
861 Ga0466959_0537311
862 Ga0451576_1294174
863 Ga0451576_1535233
864 Ga0466958_0503772
865 Ga0466967_0424678
866 Ga0495651_0054709
867 Ga0495580_0081990
868 Ga0495580_0197207
869 Ga0495580_0421913
870 Ga0495582_0345178
871 Ga0495582_0711838
872 Ga0495639_0156044
873 Ga0495618_0584822
874 Ga0495652_0066348
875 Ga0495652_0302412
876 Ga0495587_0064079
877 Ga0495645_0155341
878 Ga0495667_0080599
879 Ga0495599_0003255
880 Ga0495623_0251205
881 Ga0495623_0382081
882 Ga0495669_0262239
883 Ga0495600_0517623
884 Ga0495604_0087408
885 Ga0495684_0012249
886 Ga0495684_0439868
887 Ga0495684_0809337
888 Ga0495593_0696128
889 Ga0495602_0332708
890 Ga0496112_0891154
891 Ga0496115_0532172
892 Ga0501031_0001527
893 Ga0501032_0001793
894 Ga0501033_0056950
895 Ga0501034_0019531
896 Ga0501034_0048074
897 Ga0501037_0004387
898 Ga0501038_0047041
899 Ga0501039_0004550
900 Ga0501040_0630840
901 Ga0501041_0921898
902 Ga0501042_0780884
903 Ga0501043_0010441
904 Ga0501046_0000835
905 Ga0501047_0017675
906 Ga0501048_0028592
907 Ga0501067_0002051
908 Ga0501068_0005564
909 Ga0501069_0002179
910 Ga0501070_0006188
911 Ga0501072_0002071
912 Ga0501073_0004886
913 Ga0501074_0033404
914 Ga0501074_0851306
915 Ga0501076_0246868
916 Ga0501077_0033909
917 Ga0501249_128983
918 Ga0501079_0004888
919 Ga0501080_0000129
920 Ga0501081_1076979
921 Ga0501083_0017984
922 Ga0501035_0118174
923 Ga0501044_0011445
924 Ga0501045_0176299
925 nmdc:mga05p37_220458_c1
926 nmdc:mga09592_1291599_c1
927 nmdc:mga0qj67_77765_c1
928 nmdc:mga06r32_36587_c1
929 nmdc:mga0n895_1504785_c1
930 Ga0495619_0426086
931 Ga0501084_0000429
932 Ga0501084_0542509
933 Ga0501082_0033860
934 Ga0530510_0636301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02686

GatC

Glu-tRNAGln amidotransferase C subunit

19

102

0.86

Map