F449816

General Info

Members Datasets Scaffolds Average Seq Length
467 226 934 270

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100186042|Ga0070698_1001860422
Length 303
Sequence VRGKNSSPRLNAQARVDGVMISQSTSFQYSKTQPLLFSDYHTHPQAHHVQPYTQSLLQPWIEIARQRGLRDVAFTDHDRFHTGIDFDQIDLLREKNIDLKIRAGIELDNDPQTSAAGRKWIERNWGKLDFVLGSVHYLDDPAQMFDSVPAGAAQFVGRDIDILYADYFRHVREIATSGLVDCLAHLDLIKIHGHRPNSDIRQLVDETLEFIRARDLAIELSTAGWRKPVNELYPSDEIIRLALEKGIPFTTASDAHSHVQLGENYDRLTEKMLMLGVGEVCVYEKHQRTVKKLGKVNVKKLNR

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
170 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
171 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 0
Rhizoplane 6.85
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 9.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100186042 3300005471 Bacteria 2015
2 SwRhRL2b_contig_1128823 2162886007 Unclassified 4398
3 SwRhRL2b_contig_134233 2162886007 Bacteria 2487
4 SwRhRL2b_contig_3313225 2162886007 Unclassified 1683
5 MRS1b_contig_4125990 2162886011 Unclassified 1009
6 JGI24035J26624_1001468 3300002126 Unclassified 2224
7 JGI24035J26624_1005702 3300002126 Unclassified 1193
8 rootH2_10036831 3300003320 Bacteria 12151
9 rootH2_10053997 3300003320 Bacteria 12685
10 Ga0065703_1020215 3300005272 Bacteria 1961
11 Ga0065704_10001791 3300005289 Bacteria 7315
12 Ga0065704_10003111 3300005289 Bacteria 5000
13 Ga0065704_10010344 3300005289 Bacteria 4934
14 Ga0065704_10099209 3300005289 Bacteria 2321
15 Ga0065704_10174390 3300005289 Bacteria 1258
16 Ga0065712_10021633 3300005290 Bacteria 1150
17 Ga0065712_10099690 3300005290 Bacteria 2084
18 Ga0065712_10231884 3300005290 Unclassified 1009
19 Ga0065715_10000530 3300005293 Bacteria 13318
20 Ga0065715_10002587 3300005293 Bacteria 7483
21 Ga0065715_10005448 3300005293 Bacteria 3999
22 Ga0065715_10006690 3300005293 Bacteria 6630
23 Ga0065715_10097687 3300005293 Bacteria 3666
24 Ga0065715_10177148 3300005293 Bacteria 1503
25 Ga0065707_10004267 3300005295 Bacteria 3742
26 Ga0065707_10088718 3300005295 Bacteria 4572
27 Ga0065707_10127493 3300005295 Bacteria 1983
28 Ga0070683_100052188 3300005329 Bacteria 3788
29 Ga0070690_100308620 3300005330 Bacteria 1137
30 Ga0070670_100338486 3300005331 Unclassified 1320
31 Ga0068869_100066285 3300005334 Bacteria 2660
32 Ga0070680_100106579 3300005336 Bacteria 2330
33 Ga0068868_100019289 3300005338 Bacteria 5109
34 Ga0068868_100036155 3300005338 Unclassified 3821
35 Ga0070660_100104296 3300005339 Bacteria 2249
36 Ga0070689_100000681 3300005340 Bacteria 20637
37 Ga0070689_100044297 3300005340 Bacteria 3423
38 Ga0070689_100510366 3300005340 Bacteria 1031
39 Ga0070687_100038424 3300005343 Bacteria 2399
40 Ga0070661_100242686 3300005344 Bacteria 1388
41 Ga0070668_100003664 3300005347 Bacteria 11334
42 Ga0070668_100017199 3300005347 Bacteria 5412
43 Ga0070668_100095722 3300005347 Bacteria 2346
44 Ga0070669_100011206 3300005353 Bacteria 6363
45 Ga0070675_100000641 3300005354 Bacteria 24149
46 Ga0070675_100001807 3300005354 Bacteria 15816
47 Ga0070675_100017121 3300005354 Bacteria 5759
48 Ga0070673_100005164 3300005364 Bacteria 8334
49 Ga0070673_100093189 3300005364 Bacteria 2466
50 Ga0070673_100261296 3300005364 Bacteria 1512
51 Ga0070688_100009073 3300005365 Bacteria 5423
52 Ga0070688_100011465 3300005365 Bacteria 4925
53 Ga0070659_100000778 3300005366 Bacteria 23158
54 Ga0070659_100299537 3300005366 Bacteria 1340
55 Ga0070667_100001723 3300005367 Bacteria 19547
56 Ga0070667_100139818 3300005367 Bacteria 2119
57 Ga0070667_100336867 3300005367 Bacteria 1364
58 Ga0070667_100500464 3300005367 Bacteria 1114
59 Ga0070703_10013359 3300005406 Bacteria 2332
60 Ga0070709_10392367 3300005434 Bacteria 1035
61 Ga0070714_100025901 3300005435 Bacteria 4843
62 Ga0070714_100102570 3300005435 Bacteria 2522
63 Ga0070714_100143095 3300005435 Bacteria 2148
64 Ga0070713_100011425 3300005436 Bacteria 6468
65 Ga0070713_100704336 3300005436 Bacteria 964
66 Ga0070711_100205466 3300005439 Bacteria 1522
67 Ga0070711_100250981 3300005439 Unclassified 1388
68 Ga0070705_100005733 3300005440 Bacteria 6065
69 Ga0070705_100009881 3300005440 Bacteria 4759
70 Ga0070700_100014411 3300005441 Bacteria 4464
71 Ga0070708_100025640 3300005445 Bacteria 5042
72 Ga0070708_100051896 3300005445 Bacteria 3635
73 Ga0070708_100081326 3300005445 Unclassified 2933
74 Ga0070708_100431346 3300005445 Bacteria 1243
75 Ga0070678_100020081 3300005456 Bacteria 4376
76 Ga0070662_100005856 3300005457 Bacteria 7890
77 Ga0070662_100180442 3300005457 Bacteria 1664
78 Ga0070681_10028964 3300005458 Bacteria 5562
79 Ga0070706_100001704 3300005467 Bacteria 22883
80 Ga0070706_100004134 3300005467 Bacteria 14116
81 Ga0070706_100007749 3300005467 Bacteria 10040
82 Ga0070706_100021217 3300005467 Bacteria 5982
83 Ga0070706_100030629 3300005467 Bacteria 4959
84 Ga0070706_100067466 3300005467 Bacteria 3309
85 Ga0070706_100078876 3300005467 Bacteria 3048
86 Ga0070706_100088433 3300005467 Bacteria 2872
87 Ga0070706_100114732 3300005467 Bacteria 2508
88 Ga0070706_100204303 3300005467 Bacteria 1845
89 Ga0070706_100228359 3300005467 Unclassified 1738
90 Ga0070706_100370325 3300005467 Unclassified 1334
91 Ga0070706_100508225 3300005467 Bacteria 1121
92 Ga0070707_100002533 3300005468 Bacteria 17381
93 Ga0070707_100003024 3300005468 Bacteria 15945
94 Ga0070707_100029606 3300005468 Bacteria 5213
95 Ga0070707_100070657 3300005468 Bacteria 3363
96 Ga0070707_100073510 3300005468 Bacteria 3296
97 Ga0070707_100244402 3300005468 Bacteria 1746
98 Ga0070707_100267507 3300005468 Unclassified 1662
99 Ga0070707_100295564 3300005468 Bacteria 1574
100 Ga0070707_100434692 3300005468 Bacteria 1273
101 Ga0070698_100006241 3300005471 Bacteria 12968
102 Ga0070698_100008773 3300005471 Bacteria 10883
103 Ga0070698_100023003 3300005471 Bacteria 6515
104 Ga0070698_100039545 3300005471 Bacteria 4853
105 Ga0070698_100706625 3300005471 Unclassified 950
106 Ga0070699_100004803 3300005518 Bacteria 11942
107 Ga0070699_100020178 3300005518 Bacteria 5744
108 Ga0070699_100083054 3300005518 Bacteria 2793
109 Ga0070684_100000434 3300005535 Bacteria 28740
110 Ga0070697_100001517 3300005536 Bacteria 17644
111 Ga0070697_100003694 3300005536 Bacteria 11764
112 Ga0070697_100006076 3300005536 Bacteria 9340
113 Ga0070697_100017097 3300005536 Bacteria 5705
114 Ga0070697_100041260 3300005536 Unclassified 3734
115 Ga0070697_100215243 3300005536 Bacteria 1636
116 Ga0070697_100235833 3300005536 Bacteria 1561
117 Ga0070697_100368411 3300005536 Bacteria 1243
118 Ga0070672_100150038 3300005543 Bacteria 1928
119 Ga0070695_100382196 3300005545 Unclassified 1063
120 Ga0070696_100431389 3300005546 Unclassified 1037
121 Ga0070693_100091796 3300005547 Bacteria 1832
122 Ga0070665_100021671 3300005548 Bacteria 6462
123 Ga0070665_100029142 3300005548 Bacteria 5556
124 Ga0070664_100060335 3300005564 Bacteria 3229
125 Ga0070664_100073280 3300005564 Bacteria 2938
126 Ga0068856_100014369 3300005614 Bacteria 7653
127 Ga0068859_100023527 3300005617 Bacteria 6181
128 Ga0068864_100064371 3300005618 Bacteria 3180
129 Ga0068861_100186104 3300005719 Bacteria 1732
130 Ga0068858_100003405 3300005842 Bacteria 15815
131 Ga0068860_100005020 3300005843 Bacteria 13468
132 Ga0068860_100006681 3300005843 Bacteria 11583
133 Ga0081455_10003329 3300005937 Bacteria 18535
134 Ga0081455_10008790 3300005937 Bacteria 10453
135 Ga0081455_10013286 3300005937 Bacteria 8154
136 Ga0081455_10052892 3300005937 Bacteria 3473
137 Ga0081455_10065282 3300005937 Bacteria 3045
138 Ga0081455_10076623 3300005937 Bacteria 2754
139 Ga0081539_10001276 3300005985 Bacteria 44329
140 Ga0081539_10160302 3300005985 Bacteria 1073
141 Ga0070717_10015335 3300006028 Bacteria 5917
142 Ga0070717_10020822 3300006028 Bacteria 5162
143 Ga0070717_10021484 3300006028 Bacteria 5086
144 Ga0070717_10075013 3300006028 Bacteria 2828
145 Ga0070717_10149022 3300006028 Bacteria 2023
146 Ga0070717_10293125 3300006028 Unclassified 1445
147 Ga0070717_10427581 3300006028 Bacteria 1192
148 Ga0075363_100006420 3300006048 Bacteria 5339
149 Ga0070715_10048532 3300006163 Bacteria 1815
150 Ga0070716_100002802 3300006173 Bacteria 8114
151 Ga0070716_100215783 3300006173 Bacteria 1285
152 Ga0070712_100006716 3300006175 Bacteria 7150
153 Ga0070712_100015234 3300006175 Bacteria 4946
154 Ga0070712_100190868 3300006175 Bacteria 1603
155 Ga0070712_100269376 3300006175 Bacteria 1367
156 Ga0075362_10002611 3300006177 Bacteria 6100
157 Ga0075366_10021555 3300006195 Bacteria 3746
158 Ga0075370_10017486 3300006353 Bacteria 3875
159 Ga0068871_100083481 3300006358 Bacteria 2650
160 Ga0068871_100249756 3300006358 Bacteria 1545
161 Ga0075433_10225912 3300006852 Unclassified 1663
162 Ga0075433_10264130 3300006852 Bacteria 1526
163 Ga0075436_100221608 3300006914 Bacteria 1342
164 Ga0097620_100023527 3300006931 Bacteria 6181
165 Ga0075435_100396167 3300007076 Bacteria 1187
166 Ga0099794_10111132 3300007265 Unclassified 1373
167 Ga0099795_10108062 3300007788 Bacteria 1099
168 Ga0111539_10124086 3300009094 Bacteria 3026
169 Ga0105247_10124580 3300009101 Bacteria 1673
170 Ga0114129_10025094 3300009147 Bacteria 8448
171 Ga0105243_10268882 3300009148 Bacteria 1530
172 Ga0105242_10009628 3300009176 Bacteria 7406
173 Ga0105242_10327970 3300009176 Bacteria 1406
174 Ga0105248_10441934 3300009177 Bacteria 1465
175 Ga0105237_10019235 3300009545 Bacteria 7056
176 Ga0105238_10293794 3300009551 Bacteria 1608
177 Ga0105249_10004358 3300009553 Bacteria 12241
178 Ga0105239_10124323 3300010375 Bacteria 2866
179 Ga0157371_10026798 3300013102 Bacteria 4186
180 Ga0157369_10484515 3300013105 Bacteria 1280
181 Ga0157374_10021971 3300013296 Bacteria 5685
182 Ga0157374_10063848 3300013296 Bacteria 3454
183 Ga0157374_10254336 3300013296 Bacteria 1729
184 Ga0157374_10591465 3300013296 Bacteria 1119
185 Ga0157378_10010548 3300013297 Bacteria 8074
186 Ga0157378_10106764 3300013297 Bacteria 2562
187 Ga0157378_10414765 3300013297 Bacteria 1330
188 Ga0163162_10032991 3300013306 Bacteria 5143
189 Ga0163162_10056997 3300013306 Bacteria 3935
190 Ga0163162_10319118 3300013306 Bacteria 1686
191 Ga0157372_10026892 3300013307 Bacteria 6263
192 Ga0157372_10049902 3300013307 Bacteria 4655
193 Ga0157372_10165261 3300013307 Bacteria 2559
194 Ga0157375_10095802 3300013308 Bacteria 3039
195 Ga0157375_10163343 3300013308 Bacteria 2370
196 Ga0157375_10400448 3300013308 Unclassified 1539
197 Ga0157375_10776886 3300013308 Bacteria 1108
198 Ga0182008_10017768 3300014497 Bacteria 3686
199 Ga0182008_10071589 3300014497 Bacteria 1706
200 Ga0157377_10032199 3300014745 Bacteria 2854
201 Ga0157376_10023774 3300014969 Bacteria 4802
202 Ga0157376_10036037 3300014969 Bacteria 4005
203 Ga0157376_10104159 3300014969 Bacteria 2486
204 Ga0157376_10141686 3300014969 Unclassified 2158
205 Ga0157376_10274202 3300014969 Bacteria 1586
206 Ga0182005_1024920 3300015265 Bacteria 1633
207 Ga0213872_10000675 3300021361 Bacteria 25843
208 Ga0213872_10005614 3300021361 Bacteria 6403
209 Ga0213872_10024928 3300021361 Bacteria 2750
210 Ga0213876_10019303 3300021384 Bacteria 3601
211 Ga0213876_10043616 3300021384 Bacteria 2370
212 Ga0213876_10237466 3300021384 Unclassified 969
213 Ga0213871_10014562 3300021441 Bacteria 1868
214 Ga0207666_1000389 3300025271 Bacteria 5818
215 Ga0207697_10000080 3300025315 Bacteria 42127
216 Ga0207697_10000288 3300025315 Bacteria 28021
217 Ga0207697_10001924 3300025315 Bacteria 11047
218 Ga0207697_10001993 3300025315 Bacteria 10829
219 Ga0207697_10003754 3300025315 Bacteria 7429
220 Ga0207697_10005966 3300025315 Bacteria 5585
221 Ga0207653_10016798 3300025885 Bacteria 2300
222 Ga0207680_10052385 3300025903 Bacteria 2445
223 Ga0207647_10002631 3300025904 Bacteria 13582
224 Ga0207685_10007571 3300025905 Bacteria 3035
225 Ga0207685_10009941 3300025905 Bacteria 2786
226 Ga0207699_10052502 3300025906 Bacteria 2413
227 Ga0207699_10151064 3300025906 Bacteria 1537
228 Ga0207699_10163438 3300025906 Bacteria 1484
229 Ga0207645_10000462 3300025907 Bacteria 33661
230 Ga0207645_10001108 3300025907 Bacteria 22246
231 Ga0207684_10000052 3300025910 Bacteria 228510
232 Ga0207684_10005370 3300025910 Bacteria 11834
233 Ga0207684_10014877 3300025910 Bacteria 6695
234 Ga0207684_10032237 3300025910 Bacteria 4456
235 Ga0207684_10040143 3300025910 Bacteria 3968
236 Ga0207684_10094397 3300025910 Bacteria 2551
237 Ga0207684_10105203 3300025910 Bacteria 2414
238 Ga0207684_10210534 3300025910 Bacteria 1677
239 Ga0207684_10272014 3300025910 Bacteria 1462
240 Ga0207684_10371313 3300025910 Unclassified 1231
241 Ga0207684_10649243 3300025910 Unclassified 899
242 Ga0207707_10186098 3300025912 Bacteria 1812
243 Ga0207693_10000682 3300025915 Bacteria 30507
244 Ga0207693_10011592 3300025915 Bacteria 7131
245 Ga0207693_10132621 3300025915 Bacteria 1958
246 Ga0207693_10167372 3300025915 Bacteria 1731
247 Ga0207693_10175365 3300025915 Bacteria 1687
248 Ga0207693_10208365 3300025915 Bacteria 1537
249 Ga0207693_10290031 3300025915 Bacteria 1282
250 Ga0207693_10388629 3300025915 Bacteria 1091
251 Ga0207663_10023549 3300025916 Unclassified 3535
252 Ga0207663_10135662 3300025916 Unclassified 1707
253 Ga0207663_10193551 3300025916 Bacteria 1462
254 Ga0207662_10000089 3300025918 Bacteria 43194
255 Ga0207657_10066982 3300025919 Bacteria 3055
256 Ga0207652_10116350 3300025921 Bacteria 2375
257 Ga0207646_10000794 3300025922 Bacteria 41086
258 Ga0207646_10004076 3300025922 Bacteria 16102
259 Ga0207646_10015930 3300025922 Bacteria 7069
260 Ga0207646_10022446 3300025922 Bacteria 5813
261 Ga0207646_10090949 3300025922 Bacteria 2731
262 Ga0207646_10132634 3300025922 Unclassified 2243
263 Ga0207646_10158967 3300025922 Unclassified 2039
264 Ga0207646_10171868 3300025922 Bacteria 1957
265 Ga0207646_10240330 3300025922 Bacteria 1636
266 Ga0207681_10001719 3300025923 Bacteria 14074
267 Ga0207650_10275006 3300025925 Unclassified 1370
268 Ga0207659_10001123 3300025926 Bacteria 15863
269 Ga0207659_10004283 3300025926 Bacteria 8627
270 Ga0207659_10091573 3300025926 Bacteria 2272
271 Ga0207659_10256375 3300025926 Bacteria 1421
272 Ga0207687_10078185 3300025927 Bacteria 2381
273 Ga0207687_10100453 3300025927 Unclassified 2128
274 Ga0207700_10009760 3300025928 Bacteria 6017
275 Ga0207700_10034600 3300025928 Bacteria 3629
276 Ga0207700_10219901 3300025928 Bacteria 1610
277 Ga0207664_10056342 3300025929 Bacteria 3122
278 Ga0207664_10204892 3300025929 Unclassified 1704
279 Ga0207664_10336234 3300025929 Bacteria 1334
280 Ga0207644_10055970 3300025931 Bacteria 2845
281 Ga0207644_10130290 3300025931 Bacteria 1925
282 Ga0207644_10279292 3300025931 Unclassified 1341
283 Ga0207690_10000727 3300025932 Bacteria 21241
284 Ga0207690_10074827 3300025932 Bacteria 2347
285 Ga0207706_10000188 3300025933 Bacteria 68890
286 Ga0207706_10016518 3300025933 Bacteria 6661
287 Ga0207706_10047158 3300025933 Bacteria 3813
288 Ga0207706_10050871 3300025933 Bacteria 3660
289 Ga0207686_10042118 3300025934 Unclassified 2789
290 Ga0207670_10009030 3300025936 Bacteria 5659
291 Ga0207670_10029956 3300025936 Bacteria 3472
292 Ga0207669_10106658 3300025937 Bacteria 1866
293 Ga0207704_10392440 3300025938 Bacteria 1093
294 Ga0207665_10002886 3300025939 Bacteria 11532
295 Ga0207665_10032030 3300025939 Bacteria 3480
296 Ga0207665_10208733 3300025939 Bacteria 1426
297 Ga0207691_10381749 3300025940 Bacteria 1203
298 Ga0207711_10160222 3300025941 Bacteria 2036
299 Ga0207711_10178673 3300025941 Bacteria 1929
300 Ga0207661_10037100 3300025944 Bacteria 3809
301 Ga0207651_10022400 3300025960 Bacteria 3862
302 Ga0207651_10314825 3300025960 Bacteria 1306
303 Ga0207712_10013248 3300025961 Bacteria 5285
304 Ga0207712_10017171 3300025961 Bacteria 4696
305 Ga0207668_10006380 3300025972 Bacteria 6969
306 Ga0207668_10046956 3300025972 Bacteria 2954
307 Ga0207668_10083100 3300025972 Bacteria 2329
308 Ga0207668_10735801 3300025972 Bacteria 869
309 Ga0207658_10029652 3300025986 Bacteria 3867
310 Ga0207677_10064157 3300026023 Bacteria 2557
311 Ga0207677_10162520 3300026023 Bacteria 1736
312 Ga0207677_10318051 3300026023 Bacteria 1292
313 Ga0207703_10005840 3300026035 Bacteria 9858
314 Ga0207678_10001478 3300026067 Bacteria 21558
315 Ga0207708_10023984 3300026075 Bacteria 4614
316 Ga0207702_10074883 3300026078 Bacteria 2923
317 Ga0207676_10052688 3300026095 Bacteria 3182
318 Ga0207675_100154496 3300026118 Bacteria 2186
319 Ga0207675_100264389 3300026118 Bacteria 1668
320 Ga0207683_10035086 3300026121 Bacteria 4362
321 Ga0207683_10409128 3300026121 Unclassified 1248
322 Ga0209179_1016039 3300027512 Bacteria 1400
323 Ga0209998_10023249 3300027717 Bacteria 1340
324 Ga0268266_10122794 3300028379 Bacteria 2313
325 Ga0268266_10168840 3300028379 Bacteria 1985
326 Ga0268265_10024904 3300028380 Unclassified 4241
327 Ga0268264_10005163 3300028381 Bacteria 11065
328 Ga0268264_10022135 3300028381 Bacteria 5188
329 Ga0307513_10010334 3300031456 Bacteria 11705
330 Ga0307416_100144065 3300032002 Bacteria 2172
331 Ga0373953_0105469 3300035117 Bacteria 1189
332 Ga0373943_0191031 3300035170 Bacteria 1129
333 Ga0373943_0323748 3300035170 Bacteria 879
334 Ga0373955_0124120 3300035172 Bacteria 1503
335 Ga0373931_0117207 3300035691 Unclassified 1518
336 Ga0373935_0028551 3300035692 Bacteria 3448
337 Ga0373935_0076583 3300035692 Bacteria 2166
338 Ga0373935_0123123 3300035692 Bacteria 1734
339 Ga0373927_0032790 3300035695 Bacteria 3383
340 Ga0373927_0127840 3300035695 Bacteria 1659
341 Ga0373933_0314676 3300035724 Bacteria 1014
342 Ga0373947_0075273 3300035725 Bacteria 2078
343 Ga0373947_0104572 3300035725 Bacteria 1783
344 Ga0373937_0165156 3300036401 Bacteria 2076
345 Ga0373937_0177222 3300036401 Bacteria 2001
346 Ga0373937_0281796 3300036401 Bacteria 1570
347 Ga0395899_0023471 3300037312 Bacteria 4671
348 Ga0395900_0018935 3300037418 Bacteria 7021
349 Ga0395898_0005604 3300037466 Bacteria 13533
350 Ga0395905_0008736 3300037471 Bacteria 9966
351 Ga0436364_0129059 3300037853 Bacteria 7150
352 Ga0436364_0676257 3300037853 Bacteria 5088
353 Ga0395901_0000757 3300038443 Bacteria 36285
354 Ga0395901_0236500 3300038443 Bacteria 1906
355 Ga0436365_0301830 3300039437 Unclassified 1769
356 Ga0436365_0542149 3300039437 Bacteria 29982
357 Ga0436360_0115021 3300039438 Bacteria 1007
358 Ga0436360_0887163 3300039438 Bacteria 12151
359 Ga0436360_1027243 3300039438 Unclassified 1804
360 Ga0436360_1031887 3300039438 Bacteria 1140
361 Ga0436360_1062156 3300039438 Bacteria 2055
362 Ga0436360_1224944 3300039438 Bacteria 1060
363 Ga0436361_0105803 3300039447 Bacteria 5215
364 Ga0436361_0511039 3300039447 Bacteria 2860
365 Ga0436361_0519863 3300039447 Bacteria 1560
366 Ga0436361_0520037 3300039447 Bacteria 6523
367 Ga0436361_0574992 3300039447 Unclassified 4234
368 Ga0436361_0936577 3300039447 Bacteria 25310
369 Ga0436361_0952322 3300039447 Bacteria 6050
370 Ga0436361_0983875 3300039447 Unclassified 1073
371 Ga0436361_1074634 3300039447 Bacteria 1201
372 Ga0436361_1126075 3300039447 Bacteria 1889
373 Ga0436363_1316406 3300039450 Bacteria 5500
374 Ga0436363_1696114 3300039450 Bacteria 1455
375 Ga0436362_0430998 3300039453 Unclassified 1742
376 Ga0436362_0492359 3300039453 Bacteria 992
377 Ga0436362_1048685 3300039453 Bacteria 2160
378 Ga0436362_1154616 3300039453 Bacteria 2985
379 Ga0451849_1414837 3300041505 Bacteria 2205
380 Ga0439455_0042465 3300042012 Bacteria 1168
381 Ga0439440_0038169 3300042993 Bacteria 1162
382 Ga0495592_0306916 3300046454 Bacteria 1030
383 Ga0495603_0186513 3300046455 Bacteria 1199
384 Ga0495580_0077225 3300046472 Bacteria 2323
385 Ga0495582_0117503 3300046473 Bacteria 1496
386 Ga0495605_0107845 3300046474 Bacteria 1274
387 Ga0495584_0092544 3300046491 Bacteria 1525
388 Ga0495608_0092390 3300046511 Bacteria 1956
389 Ga0495618_0040539 3300046514 Bacteria 2931
390 Ga0495618_0180179 3300046514 Bacteria 1343
391 Ga0495630_0076604 3300046517 Bacteria 2521
392 Ga0495630_0404085 3300046517 Bacteria 1046
393 Ga0495631_0087353 3300046518 Bacteria 1343
394 Ga0495644_0016961 3300046523 Bacteria 2787
395 Ga0495652_0018155 3300046529 Bacteria 6278
396 Ga0495652_0115010 3300046529 Bacteria 2157
397 Ga0495640_0066165 3300046533 Bacteria 2438
398 Ga0495640_0096834 3300046533 Bacteria 1941
399 Ga0495640_0189056 3300046533 Bacteria 1310
400 Ga0495586_0155868 3300046535 Bacteria 1286
401 Ga0495586_0210357 3300046535 Bacteria 1104
402 Ga0495587_0049076 3300046536 Bacteria 2499
403 Ga0495598_0000913 3300046537 Bacteria 5685
404 Ga0495598_0077543 3300046537 Bacteria 1060
405 Ga0495645_0048973 3300046543 Bacteria 3077
406 Ga0495667_0072374 3300046559 Bacteria 2247
407 Ga0495634_0116758 3300046642 Bacteria 1711
408 Ga0495599_0001566 3300046678 Bacteria 13177
409 Ga0495623_0019148 3300046679 Bacteria 4423
410 Ga0495646_0003926 3300046680 Bacteria 9300
411 Ga0495669_0005416 3300046684 Bacteria 5324
412 Ga0495600_0169630 3300046809 Bacteria 1409
413 Ga0495581_0237783 3300047315 Bacteria 1065
414 Ga0495604_0054874 3300047317 Bacteria 3073
415 Ga0495604_0198756 3300047317 Bacteria 1392
416 Ga0495674_0157999 3300047319 Bacteria 1898
417 Ga0495674_0185034 3300047319 Bacteria 1733
418 Ga0495680_0064556 3300047322 Bacteria 2807
419 Ga0495675_0097407 3300047444 Bacteria 1843
420 Ga0495684_0055249 3300047471 Bacteria 3029
421 Ga0495684_0417450 3300047471 Bacteria 939
422 Ga0496100_0001133 3300048903 Bacteria 12949
423 Ga0496100_0053997 3300048903 Bacteria 2619
424 Ga0496101_0000873 3300048904 Bacteria 17774
425 Ga0496101_0087543 3300048904 Bacteria 2312
426 Ga0496101_0089319 3300048904 Bacteria 2290
427 Ga0496102_0005235 3300048905 Bacteria 11008
428 Ga0496102_0353818 3300048905 Bacteria 1383
429 Ga0496104_0143911 3300048907 Bacteria 2290
430 Ga0496104_0254520 3300048907 Bacteria 1669
431 Ga0496104_0504607 3300048907 Bacteria 1121
432 Ga0496105_0356802 3300048908 Bacteria 1167
433 Ga0496106_0000811 3300048909 Bacteria 22633
434 Ga0496106_0138479 3300048909 Bacteria 1913
435 Ga0496106_0252649 3300048909 Bacteria 1410
436 Ga0496107_0023295 3300048910 Bacteria 4378
437 Ga0496108_0129542 3300048911 Bacteria 2169
438 Ga0496108_0274252 3300048911 Bacteria 1468
439 Ga0496109_0054257 3300048912 Bacteria 3656
440 Ga0496109_0340600 3300048912 Bacteria 1416
441 Ga0496109_0381883 3300048912 Bacteria 1331
442 Ga0496111_0218466 3300048914 Bacteria 1416
443 Ga0496112_0021896 3300048915 Bacteria 6083
444 Ga0496112_0053913 3300048915 Bacteria 3950
445 Ga0496112_0138879 3300048915 Bacteria 2400
446 Ga0496112_0449295 3300048915 Bacteria 1227
447 Ga0496113_0317637 3300048916 Bacteria 1248
448 Ga0496113_0447549 3300048916 Unclassified 1038
449 Ga0496114_0011481 3300048917 Bacteria 7079
450 Ga0496114_0054549 3300048917 Bacteria 3333
451 Ga0496115_0008055 3300048918 Bacteria 7780
452 Ga0496115_0034985 3300048918 Bacteria 3972
453 Ga0496115_0160380 3300048918 Bacteria 1858
454 nmdc:mga03683_541_c1 3300050489 Bacteria 10824
455 nmdc:mga03n38_43230_c1 3300050490 Bacteria 1974
456 nmdc:mga0k408_19328_c1 3300050493 Unclassified 3806
457 nmdc:mga0k408_2367_c1 3300050493 Bacteria 10027
458 nmdc:mga07m45_6784_c1 3300050496 Bacteria 4370
459 nmdc:mga05p37_122375_c1 3300050507 Bacteria 3195
460 nmdc:mga05p37_157592_c1 3300050507 Bacteria 2774
461 nmdc:mga0n895_456054_c1 3300050512 Bacteria 1290
462 nmdc:mga08x19_33964_c1 3300050514 Bacteria 3221
463 nmdc:mga0a205_281229_c1 3300050515 Unclassified 1539
464 Ga0495619_0097216 3300053085 Bacteria 2000
465 Ga0495619_0211247 3300053085 Bacteria 1344
466 Ga0500555_000680 3300053103 Bacteria 12951
467 Ga0500556_0000302 3300053104 Bacteria 37670
468 Ga0070698_100186042
469 SwRhRL2b_contig_1128823
470 SwRhRL2b_contig_134233
471 SwRhRL2b_contig_3313225
472 MRS1b_contig_4125990
473 JGI24035J26624_1001468
474 JGI24035J26624_1005702
475 rootH2_10036831
476 rootH2_10053997
477 Ga0065703_1020215
478 Ga0065704_10001791
479 Ga0065704_10003111
480 Ga0065704_10010344
481 Ga0065704_10099209
482 Ga0065704_10174390
483 Ga0065712_10021633
484 Ga0065712_10099690
485 Ga0065712_10231884
486 Ga0065715_10000530
487 Ga0065715_10002587
488 Ga0065715_10005448
489 Ga0065715_10006690
490 Ga0065715_10097687
491 Ga0065715_10177148
492 Ga0065707_10004267
493 Ga0065707_10088718
494 Ga0065707_10127493
495 Ga0070683_100052188
496 Ga0070690_100308620
497 Ga0070670_100338486
498 Ga0068869_100066285
499 Ga0070680_100106579
500 Ga0068868_100019289
501 Ga0068868_100036155
502 Ga0070660_100104296
503 Ga0070689_100000681
504 Ga0070689_100044297
505 Ga0070689_100510366
506 Ga0070687_100038424
507 Ga0070661_100242686
508 Ga0070668_100003664
509 Ga0070668_100017199
510 Ga0070668_100095722
511 Ga0070669_100011206
512 Ga0070675_100000641
513 Ga0070675_100001807
514 Ga0070675_100017121
515 Ga0070673_100005164
516 Ga0070673_100093189
517 Ga0070673_100261296
518 Ga0070688_100009073
519 Ga0070688_100011465
520 Ga0070659_100000778
521 Ga0070659_100299537
522 Ga0070667_100001723
523 Ga0070667_100139818
524 Ga0070667_100336867
525 Ga0070667_100500464
526 Ga0070703_10013359
527 Ga0070709_10392367
528 Ga0070714_100025901
529 Ga0070714_100102570
530 Ga0070714_100143095
531 Ga0070713_100011425
532 Ga0070713_100704336
533 Ga0070711_100205466
534 Ga0070711_100250981
535 Ga0070705_100005733
536 Ga0070705_100009881
537 Ga0070700_100014411
538 Ga0070708_100025640
539 Ga0070708_100051896
540 Ga0070708_100081326
541 Ga0070708_100431346
542 Ga0070678_100020081
543 Ga0070662_100005856
544 Ga0070662_100180442
545 Ga0070681_10028964
546 Ga0070706_100001704
547 Ga0070706_100004134
548 Ga0070706_100007749
549 Ga0070706_100021217
550 Ga0070706_100030629
551 Ga0070706_100067466
552 Ga0070706_100078876
553 Ga0070706_100088433
554 Ga0070706_100114732
555 Ga0070706_100204303
556 Ga0070706_100228359
557 Ga0070706_100370325
558 Ga0070706_100508225
559 Ga0070707_100002533
560 Ga0070707_100003024
561 Ga0070707_100029606
562 Ga0070707_100070657
563 Ga0070707_100073510
564 Ga0070707_100244402
565 Ga0070707_100267507
566 Ga0070707_100295564
567 Ga0070707_100434692
568 Ga0070698_100006241
569 Ga0070698_100008773
570 Ga0070698_100023003
571 Ga0070698_100039545
572 Ga0070698_100706625
573 Ga0070699_100004803
574 Ga0070699_100020178
575 Ga0070699_100083054
576 Ga0070684_100000434
577 Ga0070697_100001517
578 Ga0070697_100003694
579 Ga0070697_100006076
580 Ga0070697_100017097
581 Ga0070697_100041260
582 Ga0070697_100215243
583 Ga0070697_100235833
584 Ga0070697_100368411
585 Ga0070672_100150038
586 Ga0070695_100382196
587 Ga0070696_100431389
588 Ga0070693_100091796
589 Ga0070665_100021671
590 Ga0070665_100029142
591 Ga0070664_100060335
592 Ga0070664_100073280
593 Ga0068856_100014369
594 Ga0068859_100023527
595 Ga0068864_100064371
596 Ga0068861_100186104
597 Ga0068858_100003405
598 Ga0068860_100005020
599 Ga0068860_100006681
600 Ga0081455_10003329
601 Ga0081455_10008790
602 Ga0081455_10013286
603 Ga0081455_10052892
604 Ga0081455_10065282
605 Ga0081455_10076623
606 Ga0081539_10001276
607 Ga0081539_10160302
608 Ga0070717_10015335
609 Ga0070717_10020822
610 Ga0070717_10021484
611 Ga0070717_10075013
612 Ga0070717_10149022
613 Ga0070717_10293125
614 Ga0070717_10427581
615 Ga0075363_100006420
616 Ga0070715_10048532
617 Ga0070716_100002802
618 Ga0070716_100215783
619 Ga0070712_100006716
620 Ga0070712_100015234
621 Ga0070712_100190868
622 Ga0070712_100269376
623 Ga0075362_10002611
624 Ga0075366_10021555
625 Ga0075370_10017486
626 Ga0068871_100083481
627 Ga0068871_100249756
628 Ga0075433_10225912
629 Ga0075433_10264130
630 Ga0075436_100221608
631 Ga0097620_100023527
632 Ga0075435_100396167
633 Ga0099794_10111132
634 Ga0099795_10108062
635 Ga0111539_10124086
636 Ga0105247_10124580
637 Ga0114129_10025094
638 Ga0105243_10268882
639 Ga0105242_10009628
640 Ga0105242_10327970
641 Ga0105248_10441934
642 Ga0105237_10019235
643 Ga0105238_10293794
644 Ga0105249_10004358
645 Ga0105239_10124323
646 Ga0157371_10026798
647 Ga0157369_10484515
648 Ga0157374_10021971
649 Ga0157374_10063848
650 Ga0157374_10254336
651 Ga0157374_10591465
652 Ga0157378_10010548
653 Ga0157378_10106764
654 Ga0157378_10414765
655 Ga0163162_10032991
656 Ga0163162_10056997
657 Ga0163162_10319118
658 Ga0157372_10026892
659 Ga0157372_10049902
660 Ga0157372_10165261
661 Ga0157375_10095802
662 Ga0157375_10163343
663 Ga0157375_10400448
664 Ga0157375_10776886
665 Ga0182008_10017768
666 Ga0182008_10071589
667 Ga0157377_10032199
668 Ga0157376_10023774
669 Ga0157376_10036037
670 Ga0157376_10104159
671 Ga0157376_10141686
672 Ga0157376_10274202
673 Ga0182005_1024920
674 Ga0213872_10000675
675 Ga0213872_10005614
676 Ga0213872_10024928
677 Ga0213876_10019303
678 Ga0213876_10043616
679 Ga0213876_10237466
680 Ga0213871_10014562
681 Ga0207666_1000389
682 Ga0207697_10000080
683 Ga0207697_10000288
684 Ga0207697_10001924
685 Ga0207697_10001993
686 Ga0207697_10003754
687 Ga0207697_10005966
688 Ga0207653_10016798
689 Ga0207680_10052385
690 Ga0207647_10002631
691 Ga0207685_10007571
692 Ga0207685_10009941
693 Ga0207699_10052502
694 Ga0207699_10151064
695 Ga0207699_10163438
696 Ga0207645_10000462
697 Ga0207645_10001108
698 Ga0207684_10000052
699 Ga0207684_10005370
700 Ga0207684_10014877
701 Ga0207684_10032237
702 Ga0207684_10040143
703 Ga0207684_10094397
704 Ga0207684_10105203
705 Ga0207684_10210534
706 Ga0207684_10272014
707 Ga0207684_10371313
708 Ga0207684_10649243
709 Ga0207707_10186098
710 Ga0207693_10000682
711 Ga0207693_10011592
712 Ga0207693_10132621
713 Ga0207693_10167372
714 Ga0207693_10175365
715 Ga0207693_10208365
716 Ga0207693_10290031
717 Ga0207693_10388629
718 Ga0207663_10023549
719 Ga0207663_10135662
720 Ga0207663_10193551
721 Ga0207662_10000089
722 Ga0207657_10066982
723 Ga0207652_10116350
724 Ga0207646_10000794
725 Ga0207646_10004076
726 Ga0207646_10015930
727 Ga0207646_10022446
728 Ga0207646_10090949
729 Ga0207646_10132634
730 Ga0207646_10158967
731 Ga0207646_10171868
732 Ga0207646_10240330
733 Ga0207681_10001719
734 Ga0207650_10275006
735 Ga0207659_10001123
736 Ga0207659_10004283
737 Ga0207659_10091573
738 Ga0207659_10256375
739 Ga0207687_10078185
740 Ga0207687_10100453
741 Ga0207700_10009760
742 Ga0207700_10034600
743 Ga0207700_10219901
744 Ga0207664_10056342
745 Ga0207664_10204892
746 Ga0207664_10336234
747 Ga0207644_10055970
748 Ga0207644_10130290
749 Ga0207644_10279292
750 Ga0207690_10000727
751 Ga0207690_10074827
752 Ga0207706_10000188
753 Ga0207706_10016518
754 Ga0207706_10047158
755 Ga0207706_10050871
756 Ga0207686_10042118
757 Ga0207670_10009030
758 Ga0207670_10029956
759 Ga0207669_10106658
760 Ga0207704_10392440
761 Ga0207665_10002886
762 Ga0207665_10032030
763 Ga0207665_10208733
764 Ga0207691_10381749
765 Ga0207711_10160222
766 Ga0207711_10178673
767 Ga0207661_10037100
768 Ga0207651_10022400
769 Ga0207651_10314825
770 Ga0207712_10013248
771 Ga0207712_10017171
772 Ga0207668_10006380
773 Ga0207668_10046956
774 Ga0207668_10083100
775 Ga0207668_10735801
776 Ga0207658_10029652
777 Ga0207677_10064157
778 Ga0207677_10162520
779 Ga0207677_10318051
780 Ga0207703_10005840
781 Ga0207678_10001478
782 Ga0207708_10023984
783 Ga0207702_10074883
784 Ga0207676_10052688
785 Ga0207675_100154496
786 Ga0207675_100264389
787 Ga0207683_10035086
788 Ga0207683_10409128
789 Ga0209179_1016039
790 Ga0209998_10023249
791 Ga0268266_10122794
792 Ga0268266_10168840
793 Ga0268265_10024904
794 Ga0268264_10005163
795 Ga0268264_10022135
796 Ga0307513_10010334
797 Ga0307416_100144065
798 Ga0373953_0105469
799 Ga0373943_0191031
800 Ga0373943_0323748
801 Ga0373955_0124120
802 Ga0373931_0117207
803 Ga0373935_0028551
804 Ga0373935_0076583
805 Ga0373935_0123123
806 Ga0373927_0032790
807 Ga0373927_0127840
808 Ga0373933_0314676
809 Ga0373947_0075273
810 Ga0373947_0104572
811 Ga0373937_0165156
812 Ga0373937_0177222
813 Ga0373937_0281796
814 Ga0395899_0023471
815 Ga0395900_0018935
816 Ga0395898_0005604
817 Ga0395905_0008736
818 Ga0436364_0129059
819 Ga0436364_0676257
820 Ga0395901_0000757
821 Ga0395901_0236500
822 Ga0436365_0301830
823 Ga0436365_0542149
824 Ga0436360_0115021
825 Ga0436360_0887163
826 Ga0436360_1027243
827 Ga0436360_1031887
828 Ga0436360_1062156
829 Ga0436360_1224944
830 Ga0436361_0105803
831 Ga0436361_0511039
832 Ga0436361_0519863
833 Ga0436361_0520037
834 Ga0436361_0574992
835 Ga0436361_0936577
836 Ga0436361_0952322
837 Ga0436361_0983875
838 Ga0436361_1074634
839 Ga0436361_1126075
840 Ga0436363_1316406
841 Ga0436363_1696114
842 Ga0436362_0430998
843 Ga0436362_0492359
844 Ga0436362_1048685
845 Ga0436362_1154616
846 Ga0451849_1414837
847 Ga0439455_0042465
848 Ga0439440_0038169
849 Ga0495592_0306916
850 Ga0495603_0186513
851 Ga0495580_0077225
852 Ga0495582_0117503
853 Ga0495605_0107845
854 Ga0495584_0092544
855 Ga0495608_0092390
856 Ga0495618_0040539
857 Ga0495618_0180179
858 Ga0495630_0076604
859 Ga0495630_0404085
860 Ga0495631_0087353
861 Ga0495644_0016961
862 Ga0495652_0018155
863 Ga0495652_0115010
864 Ga0495640_0066165
865 Ga0495640_0096834
866 Ga0495640_0189056
867 Ga0495586_0155868
868 Ga0495586_0210357
869 Ga0495587_0049076
870 Ga0495598_0000913
871 Ga0495598_0077543
872 Ga0495645_0048973
873 Ga0495667_0072374
874 Ga0495634_0116758
875 Ga0495599_0001566
876 Ga0495623_0019148
877 Ga0495646_0003926
878 Ga0495669_0005416
879 Ga0495600_0169630
880 Ga0495581_0237783
881 Ga0495604_0054874
882 Ga0495604_0198756
883 Ga0495674_0157999
884 Ga0495674_0185034
885 Ga0495680_0064556
886 Ga0495675_0097407
887 Ga0495684_0055249
888 Ga0495684_0417450
889 Ga0496100_0001133
890 Ga0496100_0053997
891 Ga0496101_0000873
892 Ga0496101_0087543
893 Ga0496101_0089319
894 Ga0496102_0005235
895 Ga0496102_0353818
896 Ga0496104_0143911
897 Ga0496104_0254520
898 Ga0496104_0504607
899 Ga0496105_0356802
900 Ga0496106_0000811
901 Ga0496106_0138479
902 Ga0496106_0252649
903 Ga0496107_0023295
904 Ga0496108_0129542
905 Ga0496108_0274252
906 Ga0496109_0054257
907 Ga0496109_0340600
908 Ga0496109_0381883
909 Ga0496111_0218466
910 Ga0496112_0021896
911 Ga0496112_0053913
912 Ga0496112_0138879
913 Ga0496112_0449295
914 Ga0496113_0317637
915 Ga0496113_0447549
916 Ga0496114_0011481
917 Ga0496114_0054549
918 Ga0496115_0008055
919 Ga0496115_0034985
920 Ga0496115_0160380
921 nmdc:mga03683_541_c1
922 nmdc:mga03n38_43230_c1
923 nmdc:mga0k408_19328_c1
924 nmdc:mga0k408_2367_c1
925 nmdc:mga07m45_6784_c1
926 nmdc:mga05p37_122375_c1
927 nmdc:mga05p37_157592_c1
928 nmdc:mga0n895_456054_c1
929 nmdc:mga08x19_33964_c1
930 nmdc:mga0a205_281229_c1
931 Ga0495619_0097216
932 Ga0495619_0211247
933 Ga0500555_000680
934 Ga0500556_0000302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02811

PHP

PHP domain

39

223

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yxo-assembly1.cif.gz_B histidinol phosphate phosphatase complexed with sulfate 0.8658 15 272
2yxo-assembly1.cif.gz_B histidinol phosphate phosphatase complexed with sulfate 0.8411 15 272
6nlr-assembly2.cif.gz_B crystal structure of the putative histidinol phosphatase hisk from listeria monocytogenes with trinuclear metals determined by pixe revealing sulphate ion in active site. based on pixe analysis and original date from 3dcp 0.8088 13 244
4gyf-assembly1.cif.gz_A crystal structure of histidinol phosphate phosphatase (hisk) from lactococcus lactis subsp. lactis il1403 complexed with zn, l-histidinol and phosphate 0.7417 15 266
4gyf-assembly1.cif.gz_A crystal structure of histidinol phosphate phosphatase (hisk) from lactococcus lactis subsp. lactis il1403 complexed with zn, l-histidinol and phosphate 0.7111 15 266
ID Description Score Start End Superfamily
2yxoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8644 15 269 3.20.20.140
2yxoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8366 15 269 3.20.20.140
af_O14059_4_267_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8249 15 253 3.20.20.140
af_P38635_2_297_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7974 16 249 3.20.20.140
3dcpC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.794 15 244 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2V6HQF5-F1-model_v4 Histidinol-phosphatase (HolPase) (EC 3.1.3.15) 0.9973 12 270 GO:0000105
GO:0004401
GO:0005737
AF-A0A2V5UZ67-F1-model_v4 Histidinol-phosphatase (HolPase) (EC 3.1.3.15) 0.9965 12 272 GO:0000105
GO:0004401
GO:0005737
AF-A0A2V6BDK9-F1-model_v4 Histidinol-phosphatase (HolPase) (EC 3.1.3.15) 0.9965 45 269 GO:0000105
GO:0004401
GO:0005737
AF-A0A2V6M3G8-F1-model_v4 Histidinol-phosphatase 0.9954 13 79
AF-A0A2V6AKH4-F1-model_v4 Histidinol-phosphatase (HolPase) (EC 3.1.3.15) 0.9951 13 170 GO:0000105
GO:0004401
GO:0005737

Map