F449795

General Info

Members Datasets Scaffolds Average Seq Length
467 255 462 121

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100381470|Ga0070680_1003814702
Length 127
Sequence VSAATVTTALVWVGVVLIGGVGSVLRFVIDRTVARRVSRPFPFGTLAVNISGAALLGFLGGLALNKEVALLAGTAFVGAYTTFSTWMLETQRLGEERQLRAGFANIVVSITLGVAAAFIGQRIAELI

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
254 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.64
Nodule 0.21
Rhizoplane 12.21
Rhizosphere 74.73
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10027103 3300001991 Bacteria 1117
2 Ga0070658_10858120 3300005327 Bacteria 789
3 Ga0070676_10033267 3300005328 Bacteria 2958
4 Ga0070683_101175577 3300005329 Bacteria 737
5 Ga0070690_100470793 3300005330 Bacteria 935
6 Ga0068869_100009416 3300005334 Bacteria 6338
7 Ga0068869_100020065 3300005334 Bacteria 4577
8 Ga0070666_10049377 3300005335 Bacteria 2828
9 Ga0070680_100381470 3300005336 Bacteria 1200
10 Ga0070682_100077054 3300005337 Bacteria 2148
11 Ga0070682_100136037 3300005337 Bacteria 1669
12 Ga0070682_100256811 3300005337 Bacteria 1263
13 Ga0070682_100825472 3300005337 Bacteria 755
14 Ga0068868_100053639 3300005338 Bacteria 3176
15 Ga0068868_100296010 3300005338 Bacteria 1373
16 Ga0068868_100607933 3300005338 Bacteria 969
17 Ga0070660_100435607 3300005339 Bacteria 1086
18 Ga0070660_100940048 3300005339 Bacteria 730
19 Ga0070660_101672608 3300005339 Bacteria 542
20 Ga0070689_100097870 3300005340 Bacteria 2320
21 Ga0070691_10260409 3300005341 Bacteria 933
22 Ga0070687_100234556 3300005343 Bacteria 1131
23 Ga0070661_100345554 3300005344 Bacteria 1166
24 Ga0070692_10143410 3300005345 Bacteria 1354
25 Ga0070668_100016763 3300005347 Bacteria 5477
26 Ga0070668_100023563 3300005347 Bacteria 4657
27 Ga0070668_101522697 3300005347 Bacteria 612
28 Ga0070668_101782510 3300005347 Bacteria 566
29 Ga0070669_100079785 3300005353 Bacteria 2434
30 Ga0070669_101260291 3300005353 Bacteria 640
31 Ga0070671_100058096 3300005355 Bacteria 3220
32 Ga0070671_100106765 3300005355 Bacteria 2351
33 Ga0070671_100533899 3300005355 Bacteria 1011
34 Ga0070674_100008547 3300005356 Bacteria 6104
35 Ga0070674_100084417 3300005356 Bacteria 2277
36 Ga0070673_100316212 3300005364 Bacteria 1378
37 Ga0070659_100325836 3300005366 Bacteria 1285
38 Ga0070667_100000575 3300005367 Bacteria 36222
39 Ga0070667_100017058 3300005367 Bacteria 6013
40 Ga0070703_10077228 3300005406 Bacteria 1126
41 Ga0070709_10076185 3300005434 Bacteria 2178
42 Ga0070714_100109337 3300005435 Bacteria 2445
43 Ga0070714_100397548 3300005435 Bacteria 1302
44 Ga0070714_100782799 3300005435 Bacteria 923
45 Ga0070710_10000006 3300005437 Bacteria 217422
46 Ga0070710_10019276 3300005437 Bacteria 3522
47 Ga0070701_10003068 3300005438 Bacteria 6547
48 Ga0070701_10804982 3300005438 Bacteria 641
49 Ga0070711_100013993 3300005439 Bacteria 5047
50 Ga0070705_100016007 3300005440 Bacteria 3887
51 Ga0070700_100009961 3300005441 Bacteria 5231
52 Ga0070700_100081420 3300005441 Bacteria 2091
53 Ga0070694_100014253 3300005444 Bacteria 4975
54 Ga0070663_100022386 3300005455 Bacteria 4225
55 Ga0070663_100540327 3300005455 Bacteria 973
56 Ga0070678_100018013 3300005456 Bacteria 4566
57 Ga0070662_100007272 3300005457 Bacteria 7174
58 Ga0068867_100020053 3300005459 Bacteria 4764
59 Ga0070685_10045947 3300005466 Bacteria 2506
60 Ga0070685_10548388 3300005466 Bacteria 825
61 Ga0070684_100105969 3300005535 Bacteria 2516
62 Ga0068853_100013403 3300005539 Bacteria 6692
63 Ga0070672_100090621 3300005543 Bacteria 2466
64 Ga0070695_100087957 3300005545 Bacteria 2068
65 Ga0070696_100008478 3300005546 Bacteria 6880
66 Ga0070693_100007808 3300005547 Bacteria 5247
67 Ga0070665_100013490 3300005548 Bacteria 8222
68 Ga0070665_100022862 3300005548 Bacteria 6294
69 Ga0070665_100232284 3300005548 Bacteria 1844
70 Ga0070665_100954876 3300005548 Bacteria 870
71 Ga0070704_100010033 3300005549 Bacteria 5753
72 Ga0070704_100077254 3300005549 Bacteria 2438
73 Ga0068855_100246237 3300005563 Bacteria 1995
74 Ga0068855_100719529 3300005563 Bacteria 1067
75 Ga0068854_100014496 3300005578 Bacteria 5197
76 Ga0068854_100101811 3300005578 Bacteria 2154
77 Ga0068856_100232684 3300005614 Bacteria 1858
78 Ga0068856_101331389 3300005614 Bacteria 733
79 Ga0070702_100008967 3300005615 Bacteria 4871
80 Ga0070702_100144013 3300005615 Bacteria 1521
81 Ga0068852_100142630 3300005616 Bacteria 2219
82 Ga0068852_101382447 3300005616 Bacteria 726
83 Ga0068852_101386141 3300005616 Bacteria 725
84 Ga0068859_100056548 3300005617 Bacteria 3949
85 Ga0068859_100714256 3300005617 Bacteria 1092
86 Ga0068859_102619478 3300005617 Bacteria 555
87 Ga0068864_100166701 3300005618 Bacteria 2006
88 Ga0068864_100206973 3300005618 Bacteria 1805
89 Ga0068864_100222939 3300005618 Bacteria 1740
90 Ga0068866_10002254 3300005718 Bacteria 7997
91 Ga0068861_100015153 3300005719 Bacteria 5426
92 Ga0068861_100113456 3300005719 Bacteria 2174
93 Ga0068863_100236845 3300005841 Bacteria 1762
94 Ga0068863_100908690 3300005841 Bacteria 881
95 Ga0068858_100022398 3300005842 Bacteria 5897
96 Ga0068858_100038340 3300005842 Bacteria 4445
97 Ga0068858_100350196 3300005842 Bacteria 1415
98 Ga0068858_100367182 3300005842 Bacteria 1380
99 Ga0068860_100002358 3300005843 Bacteria 19846
100 Ga0068860_100243511 3300005843 Bacteria 1749
101 Ga0068860_101220194 3300005843 Bacteria 772
102 Ga0068862_100101274 3300005844 Bacteria 2520
103 Ga0081455_10062573 3300005937 Bacteria 3127
104 Ga0081455_10267740 3300005937 Bacteria 1241
105 Ga0070717_10916049 3300006028 Bacteria 798
106 Ga0075365_10178525 3300006038 Bacteria 1484
107 Ga0075363_100007442 3300006048 Bacteria 5034
108 Ga0075363_100025630 3300006048 Bacteria 3009
109 Ga0075363_100043050 3300006048 Bacteria 2387
110 Ga0075364_10078752 3300006051 Bacteria 2177
111 Ga0075364_10105630 3300006051 Bacteria 1876
112 Ga0075364_10311027 3300006051 Bacteria 1073
113 Ga0070715_10024734 3300006163 Bacteria 2370
114 Ga0070715_10764253 3300006163 Bacteria 583
115 Ga0070712_100012405 3300006175 Bacteria 5416
116 Ga0075362_10130245 3300006177 Bacteria 1196
117 Ga0075369_10021031 3300006186 Bacteria 2677
118 Ga0075369_10237860 3300006186 Bacteria 844
119 Ga0075369_10249964 3300006186 Bacteria 823
120 Ga0075369_10390356 3300006186 Bacteria 655
121 Ga0075366_10578183 3300006195 Bacteria 696
122 Ga0097621_100299974 3300006237 Bacteria 1419
123 Ga0075370_10050140 3300006353 Bacteria 2368
124 Ga0068871_100049118 3300006358 Bacteria 3409
125 Ga0075430_100000964 3300006846 Bacteria 22702
126 Ga0068865_100012553 3300006881 Bacteria 5337
127 Ga0068865_101271006 3300006881 Bacteria 653
128 Ga0075436_100083089 3300006914 Bacteria 2222
129 Ga0097620_100056548 3300006931 Bacteria 3949
130 Ga0097620_100714271 3300006931 Bacteria 1092
131 Ga0097620_102619502 3300006931 Bacteria 555
132 Ga0105250_10370475 3300009092 Bacteria 630
133 Ga0105245_10024085 3300009098 Bacteria 5345
134 Ga0105245_10735790 3300009098 Bacteria 1021
135 Ga0105245_11746045 3300009098 Bacteria 675
136 Ga0105247_10001532 3300009101 Bacteria 16499
137 Ga0105243_10001339 3300009148 Bacteria 21944
138 Ga0105243_10243443 3300009148 Bacteria 1602
139 Ga0105241_10210002 3300009174 Bacteria 1631
140 Ga0105242_10001137 3300009176 Bacteria 20962
141 Ga0105248_10031352 3300009177 Bacteria 5942
142 Ga0105248_10202401 3300009177 Bacteria 2237
143 Ga0105237_10003521 3300009545 Bacteria 18559
144 Ga0105237_10130961 3300009545 Bacteria 2503
145 Ga0105237_10305466 3300009545 Bacteria 1594
146 Ga0105238_10334516 3300009551 Bacteria 1502
147 Ga0105238_10403515 3300009551 Bacteria 1360
148 Ga0105239_10002436 3300010375 Bacteria 23713
149 Ga0105239_10182902 3300010375 Bacteria 2345
150 Ga0105239_11159399 3300010375 Bacteria 890
151 Ga0157374_10108636 3300013296 Bacteria 2666
152 Ga0157378_10020735 3300013297 Bacteria 5781
153 Ga0157378_11070713 3300013297 Bacteria 842
154 Ga0163162_10007394 3300013306 Bacteria 10679
155 Ga0163162_10066606 3300013306 Bacteria 3650
156 Ga0163162_10856903 3300013306 Bacteria 1023
157 Ga0157372_10002210 3300013307 Bacteria 21129
158 Ga0157372_10381786 3300013307 Bacteria 1642
159 Ga0157375_10309208 3300013308 Bacteria 1745
160 Ga0163163_10113994 3300014325 Bacteria 2734
161 Ga0163163_10138458 3300014325 Bacteria 2476
162 Ga0163163_11064702 3300014325 Bacteria 872
163 Ga0163163_12349646 3300014325 Bacteria 592
164 Ga0157380_10000872 3300014326 Bacteria 18978
165 Ga0157380_11868020 3300014326 Bacteria 661
166 Ga0157379_10068539 3300014968 Bacteria 3171
167 Ga0163161_10040330 3300017792 Bacteria 3353
168 Ga0163161_10078644 3300017792 Bacteria 2424
169 Ga0163161_10116169 3300017792 Bacteria 2006
170 Ga0213876_10002160 3300021384 Bacteria 11623
171 Ga0213876_10029767 3300021384 Bacteria 2877
172 Ga0213875_10014627 3300021388 Bacteria 3827
173 Ga0213875_10183906 3300021388 Bacteria 982
174 Ga0209051_1000011 3300025303 Bacteria 610828
175 Ga0207692_10000001 3300025898 Bacteria 558345
176 Ga0207692_10006171 3300025898 Bacteria 4853
177 Ga0207642_10063431 3300025899 Bacteria 1728
178 Ga0207710_10006688 3300025900 Bacteria 4912
179 Ga0207710_10180275 3300025900 Bacteria 1036
180 Ga0207688_10002449 3300025901 Bacteria 9984
181 Ga0207688_10011076 3300025901 Bacteria 4907
182 Ga0207680_10168104 3300025903 Bacteria 1475
183 Ga0207647_10450372 3300025904 Bacteria 721
184 Ga0207685_10065838 3300025905 Bacteria 1452
185 Ga0207699_10037765 3300025906 Bacteria 2763
186 Ga0207645_10065175 3300025907 Bacteria 2328
187 Ga0207654_10046715 3300025911 Bacteria 2470
188 Ga0207671_10003916 3300025914 Bacteria 14515
189 Ga0207671_10070012 3300025914 Bacteria 2614
190 Ga0207671_10092672 3300025914 Bacteria 2278
191 Ga0207693_10001549 3300025915 Bacteria 20293
192 Ga0207663_10146908 3300025916 Bacteria 1649
193 Ga0207662_10027386 3300025918 Bacteria 3289
194 Ga0207657_10160163 3300025919 Bacteria 1828
195 Ga0207657_10166933 3300025919 Bacteria 1785
196 Ga0207649_10162306 3300025920 Bacteria 1549
197 Ga0207681_10186617 3300025923 Bacteria 1583
198 Ga0207694_10495250 3300025924 Bacteria 1023
199 Ga0207659_11188640 3300025926 Bacteria 656
200 Ga0207687_10049507 3300025927 Bacteria 2922
201 Ga0207687_10556773 3300025927 Bacteria 963
202 Ga0207664_10720414 3300025929 Bacteria 897
203 Ga0207644_10094984 3300025931 Bacteria 2229
204 Ga0207644_10369891 3300025931 Bacteria 1167
205 Ga0207690_10047730 3300025932 Bacteria 2843
206 Ga0207690_10072433 3300025932 Bacteria 2379
207 Ga0207706_10011686 3300025933 Bacteria 8006
208 Ga0207686_10011133 3300025934 Bacteria 4917
209 Ga0207709_10214847 3300025935 Bacteria 1383
210 Ga0207709_10567450 3300025935 Bacteria 895
211 Ga0207670_10110960 3300025936 Bacteria 1976
212 Ga0207669_10006074 3300025937 Bacteria 5481
213 Ga0207704_10049898 3300025938 Bacteria 2521
214 Ga0207665_10029016 3300025939 Bacteria 3658
215 Ga0207691_10078655 3300025940 Bacteria 2968
216 Ga0207691_10153743 3300025940 Bacteria 2022
217 Ga0207689_10081304 3300025942 Bacteria 2663
218 Ga0207689_10529024 3300025942 Bacteria 989
219 Ga0207661_10900783 3300025944 Bacteria 815
220 Ga0207667_10264810 3300025949 Bacteria 1758
221 Ga0207667_10319156 3300025949 Bacteria 1587
222 Ga0207712_10029176 3300025961 Bacteria 3698
223 Ga0207668_10010485 3300025972 Bacteria 5600
224 Ga0207668_10083815 3300025972 Bacteria 2321
225 Ga0207668_10264062 3300025972 Bacteria 1404
226 Ga0207640_10088097 3300025981 Bacteria 2142
227 Ga0207640_10439457 3300025981 Bacteria 1072
228 Ga0207658_10000502 3300025986 Bacteria 35835
229 Ga0207658_10005441 3300025986 Bacteria 8731
230 Ga0207658_10022924 3300025986 Bacteria 4351
231 Ga0207658_10880503 3300025986 Bacteria 815
232 Ga0207677_10563127 3300026023 Bacteria 995
233 Ga0207703_10033427 3300026035 Bacteria 4077
234 Ga0207703_10501669 3300026035 Bacteria 1139
235 Ga0207639_10035174 3300026041 Bacteria 3706
236 Ga0207639_10092211 3300026041 Bacteria 2427
237 Ga0207639_10401443 3300026041 Bacteria 1235
238 Ga0207678_10014268 3300026067 Bacteria 6986
239 Ga0207678_10025578 3300026067 Bacteria 5152
240 Ga0207678_10724158 3300026067 Bacteria 876
241 Ga0207708_10002852 3300026075 Bacteria 12716
242 Ga0207708_10025987 3300026075 Bacteria 4429
243 Ga0207702_10183454 3300026078 Bacteria 1929
244 Ga0207702_10295142 3300026078 Bacteria 1537
245 Ga0207702_10369359 3300026078 Bacteria 1377
246 Ga0207641_10050338 3300026088 Bacteria 3524
247 Ga0207641_11338147 3300026088 Bacteria 717
248 Ga0207648_10007000 3300026089 Bacteria 11150
249 Ga0207648_10045017 3300026089 Bacteria 3872
250 Ga0207676_10277931 3300026095 Bacteria 1519
251 Ga0207676_10588823 3300026095 Bacteria 1067
252 Ga0207675_100027425 3300026118 Bacteria 5305
253 Ga0207675_100030175 3300026118 Bacteria 5050
254 Ga0207683_10023585 3300026121 Bacteria 5293
255 Ga0207698_10623556 3300026142 Bacteria 1065
256 Ga0268266_10018695 3300028379 Bacteria 5904
257 Ga0268266_10035140 3300028379 Bacteria 4263
258 Ga0268266_10041000 3300028379 Bacteria 3948
259 Ga0268266_11186567 3300028379 Bacteria 738
260 Ga0268264_10015366 3300028381 Bacteria 6278
261 Ga0265327_10004178 3300031251 Bacteria 13020
262 Ga0265327_10116176 3300031251 Bacteria 1273
263 Ga0307405_10445095 3300031731 Bacteria 1026
264 Ga0307406_10157530 3300031901 Bacteria 1628
265 Ga0307406_10644599 3300031901 Bacteria 878
266 Ga0307409_102083321 3300031995 Bacteria 597
267 Ga0373928_0086032 3300035084 Bacteria 800
268 Ga0373949_0065654 3300035090 Bacteria 942
269 Ga0373939_0140991 3300035114 Bacteria 869
270 Ga0373943_0253535 3300035170 Bacteria 989
271 Ga0373946_0015962 3300035171 Bacteria 2856
272 Ga0373931_0193947 3300035691 Bacteria 1210
273 Ga0436364_0288923 3300037853 Bacteria 7333
274 Ga0436364_1154307 3300037853 Bacteria 1045
275 Ga0395901_2084143 3300038443 Bacteria 512
276 Ga0436365_0178124 3300039437 Bacteria 860
277 Ga0436365_0307061 3300039437 Bacteria 6040
278 Ga0436365_1376337 3300039437 Bacteria 20253
279 Ga0436365_1909980 3300039437 Bacteria 15850
280 Ga0436360_1064439 3300039438 Bacteria 601
281 Ga0436361_0753093 3300039447 Bacteria 965
282 Ga0439461_0010152 3300041410 Bacteria 1723
283 Ga0439466_0007603 3300041411 Bacteria 4093
284 Ga0439465_0365165 3300041413 Bacteria 546
285 Ga0451802_1256245 3300041460 Bacteria 991
286 Ga0451853_2731377 3300041512 Bacteria 1372
287 Ga0439431_0007653 3300041997 Bacteria 2412
288 Ga0439434_0131017 3300042435 Bacteria 822
289 Ga0439459_0026672 3300042438 Bacteria 1149
290 Ga0466972_0092997 3300044658 Bacteria 1429
291 Ga0466965_0012931 3300044683 Bacteria 3931
292 Ga0466965_0014166 3300044683 Bacteria 3773
293 Ga0466965_0034794 3300044683 Bacteria 2466
294 Ga0466966_0011171 3300044684 Bacteria 5956
295 Ga0466966_0039190 3300044684 Bacteria 3052
296 Ga0466966_0068359 3300044684 Bacteria 2230
297 Ga0466966_0927083 3300044684 Bacteria 525
298 Ga0466961_0018993 3300044693 Bacteria 4422
299 Ga0466961_0565349 3300044693 Bacteria 684
300 Ga0466963_0157420 3300044694 Bacteria 1580
301 Ga0466963_0199855 3300044694 Bacteria 1398
302 Ga0466963_0212472 3300044694 Bacteria 1354
303 Ga0466964_0293504 3300044706 Bacteria 817
304 Ga0466964_0525551 3300044706 Bacteria 639
305 Ga0466964_0674467 3300044706 Bacteria 574
306 Ga0466971_0039549 3300044719 Bacteria 2116
307 Ga0466971_0100659 3300044719 Bacteria 1328
308 Ga0466968_0003968 3300044735 Bacteria 5494
309 Ga0466968_0092057 3300044735 Bacteria 1345
310 Ga0466968_0124083 3300044735 Bacteria 1170
311 Ga0466970_0020656 3300044765 Bacteria 3423
312 Ga0466957_0006220 3300044842 Bacteria 6739
313 Ga0466957_0006518 3300044842 Bacteria 6592
314 Ga0466957_0020545 3300044842 Bacteria 3886
315 Ga0466957_0132479 3300044842 Bacteria 1598
316 Ga0466960_0000760 3300044901 Bacteria 11347
317 Ga0466960_0010837 3300044901 Bacteria 3795
318 Ga0466960_0020341 3300044901 Bacteria 2939
319 Ga0466960_0094756 3300044901 Bacteria 1527
320 Ga0466959_0003950 3300045049 Bacteria 9850
321 Ga0466959_0011761 3300045049 Bacteria 6300
322 Ga0466959_0027140 3300045049 Bacteria 4247
323 Ga0466959_0399854 3300045049 Bacteria 934
324 Ga0466958_0037989 3300045836 Bacteria 2887
325 Ga0466958_0242184 3300045836 Bacteria 1152
326 Ga0466958_0253826 3300045836 Bacteria 1125
327 Ga0466958_0474409 3300045836 Bacteria 811
328 Ga0466967_0029748 3300045976 Bacteria 4576
329 Ga0466967_0052607 3300045976 Bacteria 3575
330 Ga0466967_0119962 3300045976 Bacteria 2428
331 Ga0466967_1045381 3300045976 Bacteria 813
332 Ga0495603_0129947 3300046455 Bacteria 1467
333 Ga0495594_0266232 3300046499 Bacteria 976
334 Ga0495583_0118648 3300046506 Bacteria 1115
335 Ga0495648_0031589 3300046524 Bacteria 3484
336 Ga0495654_0149874 3300046530 Bacteria 1032
337 Ga0495668_0053941 3300046616 Bacteria 2222
338 Ga0495611_0138319 3300046648 Bacteria 1137
339 Ga0495624_0212034 3300046690 Bacteria 1175
340 Ga0495649_0258037 3300046694 Bacteria 894
341 Ga0495673_0000444 3300047469 Bacteria 45563
342 Ga0496100_0000327 3300048903 Bacteria 23421
343 Ga0496100_0358049 3300048903 Bacteria 1103
344 Ga0496100_0982142 3300048903 Bacteria 664
345 Ga0496101_0000549 3300048904 Bacteria 22984
346 Ga0496102_0016753 3300048905 Bacteria 6408
347 Ga0496102_0028569 3300048905 Bacteria 4982
348 Ga0496102_0029642 3300048905 Bacteria 4897
349 Ga0496102_0068195 3300048905 Bacteria 3264
350 Ga0496102_0171237 3300048905 Bacteria 2044
351 Ga0496102_0208489 3300048905 Bacteria 1842
352 Ga0496102_0266732 3300048905 Bacteria 1614
353 Ga0496102_0405671 3300048905 Bacteria 1281
354 Ga0496103_0000946 3300048906 Bacteria 20800
355 Ga0496103_0027965 3300048906 Bacteria 3420
356 Ga0496103_0129328 3300048906 Bacteria 1612
357 Ga0496103_0244493 3300048906 Bacteria 1154
358 Ga0496104_0036803 3300048907 Bacteria 4576
359 Ga0496104_0046516 3300048907 Bacteria 4087
360 Ga0496104_0823323 3300048907 Bacteria 834
361 Ga0496104_0826806 3300048907 Bacteria 832
362 Ga0496106_0002484 3300048909 Bacteria 13747
363 Ga0496106_0015537 3300048909 Bacteria 5631
364 Ga0496106_0510148 3300048909 Bacteria 966
365 Ga0496106_1220193 3300048909 Bacteria 586
366 Ga0496107_0000464 3300048910 Bacteria 22198
367 Ga0496107_0019519 3300048910 Bacteria 4782
368 Ga0496108_0004778 3300048911 Bacteria 10925
369 Ga0496108_0008786 3300048911 Bacteria 8191
370 Ga0496108_0076787 3300048911 Bacteria 2824
371 Ga0496108_0076965 3300048911 Bacteria 2821
372 Ga0496108_0272923 3300048911 Bacteria 1472
373 Ga0496108_0450754 3300048911 Bacteria 1124
374 Ga0496109_0000706 3300048912 Bacteria 27759
375 Ga0496109_0007281 3300048912 Bacteria 9354
376 Ga0496109_0073093 3300048912 Bacteria 3151
377 Ga0496109_0096999 3300048912 Bacteria 2732
378 Ga0496109_0412045 3300048912 Bacteria 1277
379 Ga0496110_0001610 3300048913 Bacteria 16525
380 Ga0496110_0107539 3300048913 Bacteria 2504
381 Ga0496110_0294816 3300048913 Bacteria 1477
382 Ga0496110_0805374 3300048913 Bacteria 844
383 Ga0496111_0007247 3300048914 Bacteria 7256
384 Ga0496111_0397558 3300048914 Bacteria 1018
385 Ga0496111_1044832 3300048914 Bacteria 584
386 Ga0496112_0307867 3300048915 Bacteria 1529
387 Ga0496112_0509662 3300048915 Bacteria 1138
388 Ga0496113_0143190 3300048916 Bacteria 1882
389 Ga0496113_0255197 3300048916 Bacteria 1400
390 Ga0496114_0000774 3300048917 Bacteria 23896
391 Ga0496114_0098795 3300048917 Bacteria 2489
392 Ga0496114_0108019 3300048917 Bacteria 2382
393 Ga0496114_0888857 3300048917 Bacteria 772
394 Ga0496114_1038437 3300048917 Bacteria 703
395 Ga0496114_1104748 3300048917 Bacteria 678
396 Ga0496115_0007319 3300048918 Bacteria 8118
397 Ga0496115_0352603 3300048918 Bacteria 1200
398 Ga0496116_0003582 3300048919 Bacteria 15273
399 Ga0496117_0016974 3300048920 Bacteria 6099
400 Ga0496117_0061525 3300048920 Bacteria 2580
401 Ga0496118_0000595 3300048921 Bacteria 59802
402 Ga0496118_0017436 3300048921 Bacteria 6536
403 Ga0496118_0351824 3300048921 Bacteria 785
404 Ga0496119_0003009 3300048922 Bacteria 17854
405 Ga0496120_0045432 3300048923 Bacteria 2544
406 Ga0496121_0000016 3300048924 Bacteria 562911
407 Ga0496122_0002739 3300048925 Bacteria 24368
408 Ga0496124_0000015 3300048927 Bacteria 460700
409 Ga0496125_0000021 3300048928 Bacteria 460688
410 Ga0496126_0000015 3300048929 Bacteria 663212
411 Ga0496126_0001911 3300048929 Bacteria 29891
412 Ga0501031_0203889 3300049568 Bacteria 1290
413 Ga0501031_0659521 3300049568 Bacteria 672
414 Ga0501032_0037168 3300049569 Bacteria 3321
415 Ga0501032_0175602 3300049569 Bacteria 1403
416 Ga0501032_0387522 3300049569 Bacteria 898
417 Ga0501033_0017450 3300049570 Bacteria 5423
418 Ga0501033_0116714 3300049570 Bacteria 1939
419 Ga0501034_0007092 3300049571 Bacteria 11955
420 Ga0501034_0087568 3300049571 Bacteria 3114
421 Ga0501036_0145140 3300049572 Bacteria 2002
422 Ga0501037_0044362 3300049573 Bacteria 3265
423 Ga0501043_0038751 3300049579 Bacteria 3748
424 Ga0501043_0064253 3300049579 Bacteria 2882
425 Ga0501046_0002772 3300049580 Bacteria 16302
426 Ga0501046_0313473 3300049580 Bacteria 1144
427 Ga0501047_0002519 3300049581 Bacteria 17469
428 Ga0501047_0739395 3300049581 Bacteria 800
429 Ga0501048_0017886 3300049582 Bacteria 5215
430 Ga0501048_0663669 3300049582 Bacteria 749
431 Ga0501069_0020640 3300049585 Bacteria 3570
432 Ga0501070_0000997 3300049586 Bacteria 25451
433 Ga0501070_0184988 3300049586 Bacteria 1714
434 Ga0501071_0384348 3300049587 Bacteria 1071
435 Ga0501080_0075773 3300049742 Bacteria 3129
436 Ga0501083_0452767 3300049744 Bacteria 835
437 Ga0501035_0001107 3300049822 Bacteria 28241
438 Ga0501035_0003647 3300049822 Bacteria 14685
439 Ga0501035_0189832 3300049822 Bacteria 1767
440 Ga0501044_0002461 3300049823 Bacteria 21119
441 Ga0501044_0007204 3300049823 Bacteria 12234
442 nmdc:mga03683_198595_c1 3300050489 Bacteria 920
443 nmdc:mga03n38_104369_c1 3300050490 Bacteria 1371
444 nmdc:mga03n38_384195_c1 3300050490 Bacteria 770
445 nmdc:mga03n38_54731_c1 3300050490 Bacteria 1795
446 nmdc:mga03n38_918066_c1 3300050490 Bacteria 515
447 nmdc:mga00v17_3047_c1 3300050491 Bacteria 8615
448 nmdc:mga00v17_52858_c1 3300050491 Bacteria 2474
449 nmdc:mga00v17_53524_c1 3300050491 Bacteria 2460
450 nmdc:mga0yw44_289735_c1 3300050492 Bacteria 1095
451 nmdc:mga0qj67_3373_c1 3300050509 Bacteria 11523
452 nmdc:mga08x19_44563_c2 3300050514 Bacteria 1545
453 nmdc:mga0sz30_180086_c1 3300050516 Bacteria 938
454 nmdc:mga0sz30_25009_c1 3300050516 Bacteria 2441
455 nmdc:mga0sz30_262411_c1 3300050516 Bacteria 769
456 nmdc:mga0sz30_71226_c1 3300050516 Bacteria 1497
457 Ga0495655_0070605 3300053083 Bacteria 975
458 Ga0500641_0062484 3300053096 Bacteria 1553
459 Ga0500628_102184 3300053129 Bacteria 760
460 Ga0500564_067843 3300053138 Bacteria 1612
461 Ga0466962_0037035 3300061719 Bacteria 2335
462 Ga0466962_0225257 3300061719 Bacteria 919

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100136037 Ga0070682_1001360373 97
2 3300005347 Ga0070668_101782510 Ga0070668_1017825101 104
3 3300009098 Ga0105245_10735790 Ga0105245_107357902 107
4 3300017792 Ga0163161_10116169 Ga0163161_101161692 107
5 3300041410 Ga0439461_0010152 Ga0439461_0010152_726_1064 112
6 3300041411 Ga0439466_0007603 Ga0439466_0007603_41_379 112
7 3300041413 Ga0439465_0365165 Ga0439465_0365165_198_536 112
8 3300041997 Ga0439431_0007653 Ga0439431_0007653_1996_2334 112
9 3300042435 Ga0439434_0131017 Ga0439434_0131017_37_375 112
10 3300005329 Ga0070683_101175577 Ga0070683_1011755772 115
11 3300025944 Ga0207661_10900783 Ga0207661_109007832 115
12 iso_pu_bacteria 2842134933 2842138727 115
13 iso_pu_bacteria 2738541264 2738667033 117
14 iso_pu_bacteria 2738541356 2739145877 117
15 3300044706 Ga0466964_0674467 Ga0466964_0674467_45_401 118
16 3300044901 Ga0466960_0020341 Ga0466960_0020341_196_552 118
17 3300045976 Ga0466967_0029748 Ga0466967_0029748_2673_3029 118
18 iso_pu_bacteria 2643221715 2644636086 118
19 iso_pu_bacteria 2902810491 2902815610 118
20 3300039437 Ga0436365_0178124 Ga0436365_0178124_13_372 119
21 3300039447 Ga0436361_0753093 Ga0436361_0753093_219_578 119
22 3300044684 Ga0466966_0011171 Ga0466966_0011171_1853_2212 119
23 3300044684 Ga0466966_0039190 Ga0466966_0039190_484_846 119
24 3300044693 Ga0466961_0565349 Ga0466961_0565349_25_384 119
25 3300044694 Ga0466963_0199855 Ga0466963_0199855_973_1332 119
26 3300044735 Ga0466968_0003968 Ga0466968_0003968_3126_3485 119
27 3300044842 Ga0466957_0132479 Ga0466957_0132479_277_636 119
28 3300045049 Ga0466959_0011761 Ga0466959_0011761_3326_3685 119
29 3300045836 Ga0466958_0037989 Ga0466958_0037989_306_665 119
30 3300049568 Ga0501031_0203889 Ga0501031_0203889_209_568 119
31 3300049569 Ga0501032_0037168 Ga0501032_0037168_2294_2653 119
32 3300049570 Ga0501033_0116714 Ga0501033_0116714_516_875 119
33 3300049571 Ga0501034_0087568 Ga0501034_0087568_2402_2761 119
34 3300049579 Ga0501043_0064253 Ga0501043_0064253_1073_1432 119
35 3300049580 Ga0501046_0313473 Ga0501046_0313473_439_798 119
36 3300049822 Ga0501035_0001107 Ga0501035_0001107_25493_25852 119
37 3300049823 Ga0501044_0002461 Ga0501044_0002461_3526_3885 119
38 3300001991 JGI24743J22301_10027103 JGI24743J22301_100271032 121
39 3300005327 Ga0070658_10858120 Ga0070658_108581202 121
40 3300005328 Ga0070676_10033267 Ga0070676_100332673 121
41 3300005330 Ga0070690_100470793 Ga0070690_1004707932 121
42 3300005334 Ga0068869_100009416 Ga0068869_1000094163 121
43 3300005334 Ga0068869_100020065 Ga0068869_1000200652 121
44 3300005335 Ga0070666_10049377 Ga0070666_100493773 121
45 3300005336 Ga0070680_100381470 Ga0070680_1003814702 121
46 3300005337 Ga0070682_100077054 Ga0070682_1000770543 121
47 3300005337 Ga0070682_100256811 Ga0070682_1002568112 121
48 3300005337 Ga0070682_100825472 Ga0070682_1008254722 121
49 3300005338 Ga0068868_100053639 Ga0068868_1000536393 121
50 3300005338 Ga0068868_100296010 Ga0068868_1002960102 121
51 3300005338 Ga0068868_100607933 Ga0068868_1006079331 121
52 3300005339 Ga0070660_100435607 Ga0070660_1004356072 121
53 3300005339 Ga0070660_100940048 Ga0070660_1009400482 121
54 3300005339 Ga0070660_101672608 Ga0070660_1016726082 121
55 3300005340 Ga0070689_100097870 Ga0070689_1000978703 121
56 3300005341 Ga0070691_10260409 Ga0070691_102604092 121
57 3300005343 Ga0070687_100234556 Ga0070687_1002345562 121
58 3300005344 Ga0070661_100345554 Ga0070661_1003455543 121
59 3300005345 Ga0070692_10143410 Ga0070692_101434103 121
60 3300005347 Ga0070668_100016763 Ga0070668_1000167636 121
61 3300005347 Ga0070668_100023563 Ga0070668_1000235632 121
62 3300005347 Ga0070668_101522697 Ga0070668_1015226972 121
63 3300005353 Ga0070669_100079785 Ga0070669_1000797853 121
64 3300005353 Ga0070669_101260291 Ga0070669_1012602912 121
65 3300005355 Ga0070671_100058096 Ga0070671_1000580963 121
66 3300005355 Ga0070671_100106765 Ga0070671_1001067653 121
67 3300005355 Ga0070671_100533899 Ga0070671_1005338992 121
68 3300005356 Ga0070674_100008547 Ga0070674_1000085476 121
69 3300005356 Ga0070674_100084417 Ga0070674_1000844173 121
70 3300005364 Ga0070673_100316212 Ga0070673_1003162123 121
71 3300005366 Ga0070659_100325836 Ga0070659_1003258363 121
72 3300005367 Ga0070667_100000575 Ga0070667_10000057524 121
73 3300005367 Ga0070667_100017058 Ga0070667_1000170583 121
74 3300005406 Ga0070703_10077228 Ga0070703_100772281 121
75 3300005434 Ga0070709_10076185 Ga0070709_100761852 121
76 3300005435 Ga0070714_100109337 Ga0070714_1001093373 121
77 3300005435 Ga0070714_100397548 Ga0070714_1003975481 121
78 3300005435 Ga0070714_100782799 Ga0070714_1007827992 121
79 3300005437 Ga0070710_10000006 Ga0070710_1000000660 121
80 3300005437 Ga0070710_10019276 Ga0070710_100192762 121
81 3300005438 Ga0070701_10003068 Ga0070701_100030684 121
82 3300005438 Ga0070701_10804982 Ga0070701_108049821 121
83 3300005439 Ga0070711_100013993 Ga0070711_1000139937 121
84 3300005440 Ga0070705_100016007 Ga0070705_1000160072 121
85 3300005441 Ga0070700_100009961 Ga0070700_1000099616 121
86 3300005441 Ga0070700_100081420 Ga0070700_1000814202 121
87 3300005444 Ga0070694_100014253 Ga0070694_1000142535 121
88 3300005455 Ga0070663_100022386 Ga0070663_1000223862 121
89 3300005455 Ga0070663_100540327 Ga0070663_1005403271 121
90 3300005456 Ga0070678_100018013 Ga0070678_1000180132 121
91 3300005457 Ga0070662_100007272 Ga0070662_1000072725 121
92 3300005459 Ga0068867_100020053 Ga0068867_1000200536 121
93 3300005466 Ga0070685_10045947 Ga0070685_100459474 121
94 3300005466 Ga0070685_10548388 Ga0070685_105483881 121
95 3300005535 Ga0070684_100105969 Ga0070684_1001059692 121
96 3300005539 Ga0068853_100013403 Ga0068853_1000134036 121
97 3300005543 Ga0070672_100090621 Ga0070672_1000906213 121
98 3300005545 Ga0070695_100087957 Ga0070695_1000879573 121
99 3300005546 Ga0070696_100008478 Ga0070696_1000084785 121
100 3300005547 Ga0070693_100007808 Ga0070693_1000078086 121
101 3300005548 Ga0070665_100013490 Ga0070665_1000134903 121
102 3300005548 Ga0070665_100022862 Ga0070665_1000228625 121
103 3300005548 Ga0070665_100232284 Ga0070665_1002322842 121
104 3300005548 Ga0070665_100954876 Ga0070665_1009548762 121
105 3300005549 Ga0070704_100010033 Ga0070704_1000100332 121
106 3300005549 Ga0070704_100077254 Ga0070704_1000772541 121
107 3300005563 Ga0068855_100246237 Ga0068855_1002462372 121
108 3300005563 Ga0068855_100719529 Ga0068855_1007195292 121
109 3300005578 Ga0068854_100014496 Ga0068854_1000144962 121
110 3300005578 Ga0068854_100101811 Ga0068854_1001018113 121
111 3300005614 Ga0068856_100232684 Ga0068856_1002326842 121
112 3300005614 Ga0068856_101331389 Ga0068856_1013313892 121
113 3300005615 Ga0070702_100008967 Ga0070702_1000089675 121
114 3300005615 Ga0070702_100144013 Ga0070702_1001440132 121
115 3300005616 Ga0068852_100142630 Ga0068852_1001426302 121
116 3300005616 Ga0068852_101382447 Ga0068852_1013824472 121
117 3300005616 Ga0068852_101386141 Ga0068852_1013861412 121
118 3300005617 Ga0068859_100056548 Ga0068859_1000565484 121
119 3300005617 Ga0068859_100714256 Ga0068859_1007142562 121
120 3300005617 Ga0068859_102619478 Ga0068859_1026194782 121
121 3300005618 Ga0068864_100166701 Ga0068864_1001667013 121
122 3300005618 Ga0068864_100206973 Ga0068864_1002069732 121
123 3300005618 Ga0068864_100222939 Ga0068864_1002229393 121
124 3300005718 Ga0068866_10002254 Ga0068866_100022549 121
125 3300005719 Ga0068861_100015153 Ga0068861_1000151533 121
126 3300005719 Ga0068861_100113456 Ga0068861_1001134562 121
127 3300005841 Ga0068863_100236845 Ga0068863_1002368452 121
128 3300005841 Ga0068863_100908690 Ga0068863_1009086903 121
129 3300005842 Ga0068858_100022398 Ga0068858_1000223983 121
130 3300005842 Ga0068858_100038340 Ga0068858_1000383405 121
131 3300005842 Ga0068858_100350196 Ga0068858_1003501962 121
132 3300005842 Ga0068858_100367182 Ga0068858_1003671822 121
133 3300005843 Ga0068860_100002358 Ga0068860_10000235822 121
134 3300005843 Ga0068860_100243511 Ga0068860_1002435112 121
135 3300005843 Ga0068860_101220194 Ga0068860_1012201942 121
136 3300005844 Ga0068862_100101274 Ga0068862_1001012743 121
137 3300005937 Ga0081455_10062573 Ga0081455_100625733 121
138 3300005937 Ga0081455_10267740 Ga0081455_102677402 121
139 3300006028 Ga0070717_10916049 Ga0070717_109160491 121
140 3300006038 Ga0075365_10178525 Ga0075365_101785252 121
141 3300006048 Ga0075363_100007442 Ga0075363_1000074422 121
142 3300006048 Ga0075363_100025630 Ga0075363_1000256303 121
143 3300006048 Ga0075363_100043050 Ga0075363_1000430503 121
144 3300006051 Ga0075364_10078752 Ga0075364_100787522 121
145 3300006051 Ga0075364_10105630 Ga0075364_101056302 121
146 3300006051 Ga0075364_10311027 Ga0075364_103110272 121
147 3300006163 Ga0070715_10024734 Ga0070715_100247342 121
148 3300006163 Ga0070715_10764253 Ga0070715_107642532 121
149 3300006175 Ga0070712_100012405 Ga0070712_1000124053 121
150 3300006177 Ga0075362_10130245 Ga0075362_101302452 121
151 3300006186 Ga0075369_10021031 Ga0075369_100210311 121
152 3300006186 Ga0075369_10237860 Ga0075369_102378602 121
153 3300006186 Ga0075369_10249964 Ga0075369_102499641 121
154 3300006186 Ga0075369_10390356 Ga0075369_103903561 121
155 3300006195 Ga0075366_10578183 Ga0075366_105781831 121
156 3300006237 Ga0097621_100299974 Ga0097621_1002999742 121
157 3300006353 Ga0075370_10050140 Ga0075370_100501402 121
158 3300006358 Ga0068871_100049118 Ga0068871_1000491184 121
159 3300006846 Ga0075430_100000964 Ga0075430_1000009649 121
160 3300006881 Ga0068865_100012553 Ga0068865_1000125535 121
161 3300006881 Ga0068865_101271006 Ga0068865_1012710062 121
162 3300006914 Ga0075436_100083089 Ga0075436_1000830893 121
163 3300006931 Ga0097620_100056548 Ga0097620_1000565482 121
164 3300006931 Ga0097620_100714271 Ga0097620_1007142712 121
165 3300006931 Ga0097620_102619502 Ga0097620_1026195022 121
166 3300009092 Ga0105250_10370475 Ga0105250_103704752 121
167 3300009098 Ga0105245_10024085 Ga0105245_100240853 121
168 3300009098 Ga0105245_11746045 Ga0105245_117460452 121
169 3300009101 Ga0105247_10001532 Ga0105247_100015325 121
170 3300009148 Ga0105243_10001339 Ga0105243_1000133922 121
171 3300009148 Ga0105243_10243443 Ga0105243_102434432 121
172 3300009174 Ga0105241_10210002 Ga0105241_102100022 121
173 3300009176 Ga0105242_10001137 Ga0105242_1000113721 121
174 3300009177 Ga0105248_10031352 Ga0105248_100313521 121
175 3300009177 Ga0105248_10202401 Ga0105248_102024012 121
176 3300009545 Ga0105237_10003521 Ga0105237_100035216 121
177 3300009545 Ga0105237_10130961 Ga0105237_101309613 121
178 3300009545 Ga0105237_10305466 Ga0105237_103054663 121
179 3300009551 Ga0105238_10334516 Ga0105238_103345162 121
180 3300009551 Ga0105238_10403515 Ga0105238_104035151 121
181 3300010375 Ga0105239_10002436 Ga0105239_100024366 121
182 3300010375 Ga0105239_10182902 Ga0105239_101829022 121
183 3300010375 Ga0105239_11159399 Ga0105239_111593992 121
184 3300013296 Ga0157374_10108636 Ga0157374_101086362 121
185 3300013297 Ga0157378_10020735 Ga0157378_100207353 121
186 3300013297 Ga0157378_11070713 Ga0157378_110707132 121
187 3300013306 Ga0163162_10007394 Ga0163162_1000739410 121
188 3300013306 Ga0163162_10066606 Ga0163162_100666064 121
189 3300013306 Ga0163162_10856903 Ga0163162_108569032 121
190 3300013307 Ga0157372_10002210 Ga0157372_100022105 121
191 3300013307 Ga0157372_10381786 Ga0157372_103817863 121
192 3300013308 Ga0157375_10309208 Ga0157375_103092082 121
193 3300014325 Ga0163163_10113994 Ga0163163_101139942 121
194 3300014325 Ga0163163_10138458 Ga0163163_101384582 121
195 3300014325 Ga0163163_11064702 Ga0163163_110647022 121
196 3300014325 Ga0163163_12349646 Ga0163163_123496462 121
197 3300014326 Ga0157380_10000872 Ga0157380_1000087221 121
198 3300014326 Ga0157380_11868020 Ga0157380_118680202 121
199 3300014968 Ga0157379_10068539 Ga0157379_100685393 121
200 3300017792 Ga0163161_10040330 Ga0163161_100403303 121
201 3300017792 Ga0163161_10078644 Ga0163161_100786443 121
202 3300021384 Ga0213876_10002160 Ga0213876_1000216010 121
203 3300021384 Ga0213876_10029767 Ga0213876_100297674 121
204 3300021388 Ga0213875_10014627 Ga0213875_100146275 121
205 3300021388 Ga0213875_10183906 Ga0213875_101839062 121
206 3300025303 Ga0209051_1000011 Ga0209051_1000011524 121
207 3300025898 Ga0207692_10000001 Ga0207692_10000001171 121
208 3300025898 Ga0207692_10006171 Ga0207692_100061716 121
209 3300025899 Ga0207642_10063431 Ga0207642_100634313 121
210 3300025900 Ga0207710_10006688 Ga0207710_100066885 121
211 3300025900 Ga0207710_10180275 Ga0207710_101802752 121
212 3300025901 Ga0207688_10002449 Ga0207688_100024495 121
213 3300025901 Ga0207688_10011076 Ga0207688_100110764 121
214 3300025903 Ga0207680_10168104 Ga0207680_101681043 121
215 3300025904 Ga0207647_10450372 Ga0207647_104503722 121
216 3300025905 Ga0207685_10065838 Ga0207685_100658383 121
217 3300025906 Ga0207699_10037765 Ga0207699_100377653 121
218 3300025907 Ga0207645_10065175 Ga0207645_100651752 121
219 3300025911 Ga0207654_10046715 Ga0207654_100467153 121
220 3300025914 Ga0207671_10003916 Ga0207671_100039166 121
221 3300025914 Ga0207671_10070012 Ga0207671_100700122 121
222 3300025914 Ga0207671_10092672 Ga0207671_100926722 121
223 3300025915 Ga0207693_10001549 Ga0207693_1000154921 121
224 3300025916 Ga0207663_10146908 Ga0207663_101469082 121
225 3300025918 Ga0207662_10027386 Ga0207662_100273863 121
226 3300025919 Ga0207657_10160163 Ga0207657_101601632 121
227 3300025919 Ga0207657_10166933 Ga0207657_101669332 121
228 3300025920 Ga0207649_10162306 Ga0207649_101623063 121
229 3300025923 Ga0207681_10186617 Ga0207681_101866173 121
230 3300025924 Ga0207694_10495250 Ga0207694_104952502 121
231 3300025926 Ga0207659_11188640 Ga0207659_111886402 121
232 3300025927 Ga0207687_10049507 Ga0207687_100495073 121
233 3300025927 Ga0207687_10556773 Ga0207687_105567732 121
234 3300025929 Ga0207664_10720414 Ga0207664_107204141 121
235 3300025931 Ga0207644_10094984 Ga0207644_100949843 121
236 3300025931 Ga0207644_10369891 Ga0207644_103698912 121
237 3300025932 Ga0207690_10047730 Ga0207690_100477302 121
238 3300025932 Ga0207690_10072433 Ga0207690_100724332 121
239 3300025933 Ga0207706_10011686 Ga0207706_100116869 121
240 3300025934 Ga0207686_10011133 Ga0207686_100111336 121
241 3300025935 Ga0207709_10214847 Ga0207709_102148472 121
242 3300025935 Ga0207709_10567450 Ga0207709_105674502 121
243 3300025936 Ga0207670_10110960 Ga0207670_101109602 121
244 3300025937 Ga0207669_10006074 Ga0207669_100060743 121
245 3300025938 Ga0207704_10049898 Ga0207704_100498983 121
246 3300025939 Ga0207665_10029016 Ga0207665_100290163 121
247 3300025940 Ga0207691_10078655 Ga0207691_100786553 121
248 3300025940 Ga0207691_10153743 Ga0207691_101537432 121
249 3300025942 Ga0207689_10081304 Ga0207689_100813042 121
250 3300025942 Ga0207689_10529024 Ga0207689_105290242 121
251 3300025949 Ga0207667_10264810 Ga0207667_102648103 121
252 3300025949 Ga0207667_10319156 Ga0207667_103191562 121
253 3300025961 Ga0207712_10029176 Ga0207712_100291762 121
254 3300025972 Ga0207668_10010485 Ga0207668_100104855 121
255 3300025972 Ga0207668_10083815 Ga0207668_100838152 121
256 3300025972 Ga0207668_10264062 Ga0207668_102640622 121
257 3300025981 Ga0207640_10088097 Ga0207640_100880972 121
258 3300025981 Ga0207640_10439457 Ga0207640_104394571 121
259 3300025986 Ga0207658_10000502 Ga0207658_1000050225 121
260 3300025986 Ga0207658_10005441 Ga0207658_100054417 121
261 3300025986 Ga0207658_10022924 Ga0207658_100229242 121
262 3300025986 Ga0207658_10880503 Ga0207658_108805031 121
263 3300026023 Ga0207677_10563127 Ga0207677_105631272 121
264 3300026035 Ga0207703_10033427 Ga0207703_100334272 121
265 3300026035 Ga0207703_10501669 Ga0207703_105016692 121
266 3300026041 Ga0207639_10035174 Ga0207639_100351745 121
267 3300026041 Ga0207639_10092211 Ga0207639_100922112 121
268 3300026041 Ga0207639_10401443 Ga0207639_104014432 121
269 3300026067 Ga0207678_10014268 Ga0207678_100142684 121
270 3300026067 Ga0207678_10025578 Ga0207678_100255787 121
271 3300026067 Ga0207678_10724158 Ga0207678_107241582 121
272 3300026075 Ga0207708_10002852 Ga0207708_1000285211 121
273 3300026075 Ga0207708_10025987 Ga0207708_100259873 121
274 3300026078 Ga0207702_10183454 Ga0207702_101834543 121
275 3300026078 Ga0207702_10295142 Ga0207702_102951422 121
276 3300026078 Ga0207702_10369359 Ga0207702_103693592 121
277 3300026088 Ga0207641_10050338 Ga0207641_100503382 121
278 3300026088 Ga0207641_11338147 Ga0207641_113381471 121
279 3300026089 Ga0207648_10007000 Ga0207648_1000700010 121
280 3300026089 Ga0207648_10045017 Ga0207648_100450174 121
281 3300026095 Ga0207676_10277931 Ga0207676_102779312 121
282 3300026095 Ga0207676_10588823 Ga0207676_105888232 121
283 3300026118 Ga0207675_100027425 Ga0207675_1000274252 121
284 3300026118 Ga0207675_100030175 Ga0207675_1000301753 121
285 3300026121 Ga0207683_10023585 Ga0207683_100235856 121
286 3300026142 Ga0207698_10623556 Ga0207698_106235562 121
287 3300028379 Ga0268266_10018695 Ga0268266_100186954 121
288 3300028379 Ga0268266_10035140 Ga0268266_100351404 121
289 3300028379 Ga0268266_10041000 Ga0268266_100410003 121
290 3300028379 Ga0268266_11186567 Ga0268266_111865672 121
291 3300028381 Ga0268264_10015366 Ga0268264_100153666 121
292 3300031251 Ga0265327_10004178 Ga0265327_100041785 121
293 3300031251 Ga0265327_10116176 Ga0265327_101161762 121
294 3300031731 Ga0307405_10445095 Ga0307405_104450952 121
295 3300031901 Ga0307406_10157530 Ga0307406_101575303 121
296 3300031901 Ga0307406_10644599 Ga0307406_106445992 121
297 3300031995 Ga0307409_102083321 Ga0307409_1020833212 121
298 3300035084 Ga0373928_0086032 Ga0373928_0086032_220_585 121
299 3300035090 Ga0373949_0065654 Ga0373949_0065654_300_665 121
300 3300035114 Ga0373939_0140991 Ga0373939_0140991_94_459 121
301 3300035170 Ga0373943_0253535 Ga0373943_0253535_426_791 121
302 3300035171 Ga0373946_0015962 Ga0373946_0015962_391_756 121
303 3300035691 Ga0373931_0193947 Ga0373931_0193947_10_375 121
304 3300037853 Ga0436364_0288923 Ga0436364_0288923_1855_2220 121
305 3300037853 Ga0436364_1154307 Ga0436364_1154307_101_466 121
306 3300038443 Ga0395901_2084143 Ga0395901_2084143_18_383 121
307 3300039437 Ga0436365_0307061 Ga0436365_0307061_3995_4363 121
308 3300039437 Ga0436365_1376337 Ga0436365_1376337_1834_2217 121
309 3300039437 Ga0436365_1909980 Ga0436365_1909980_12252_12617 121
310 3300039438 Ga0436360_1064439 Ga0436360_1064439_20_403 121
311 3300041460 Ga0451802_1256245 Ga0451802_1256245_65_433 121
312 3300041512 Ga0451853_2731377 Ga0451853_2731377_316_684 121
313 3300042438 Ga0439459_0026672 Ga0439459_0026672_680_1048 121
314 3300044658 Ga0466972_0092997 Ga0466972_0092997_884_1252 121
315 3300044683 Ga0466965_0012931 Ga0466965_0012931_1668_2033 121
316 3300044683 Ga0466965_0014166 Ga0466965_0014166_2153_2521 121
317 3300044683 Ga0466965_0034794 Ga0466965_0034794_2070_2435 121
318 3300044684 Ga0466966_0068359 Ga0466966_0068359_572_937 121
319 3300044684 Ga0466966_0927083 Ga0466966_0927083_16_399 121
320 3300044693 Ga0466961_0018993 Ga0466961_0018993_396_761 121
321 3300044694 Ga0466963_0157420 Ga0466963_0157420_626_994 121
322 3300044694 Ga0466963_0212472 Ga0466963_0212472_390_773 121
323 3300044706 Ga0466964_0293504 Ga0466964_0293504_25_408 121
324 3300044706 Ga0466964_0525551 Ga0466964_0525551_204_587 121
325 3300044719 Ga0466971_0039549 Ga0466971_0039549_741_1106 121
326 3300044719 Ga0466971_0100659 Ga0466971_0100659_310_693 121
327 3300044735 Ga0466968_0092057 Ga0466968_0092057_756_1121 121
328 3300044735 Ga0466968_0124083 Ga0466968_0124083_192_560 121
329 3300044765 Ga0466970_0020656 Ga0466970_0020656_1955_2320 121
330 3300044842 Ga0466957_0006220 Ga0466957_0006220_1174_1557 121
331 3300044842 Ga0466957_0006518 Ga0466957_0006518_5010_5378 121
332 3300044842 Ga0466957_0020545 Ga0466957_0020545_2522_2887 121
333 3300044901 Ga0466960_0000760 Ga0466960_0000760_6203_6568 121
334 3300044901 Ga0466960_0010837 Ga0466960_0010837_2622_2990 121
335 3300044901 Ga0466960_0094756 Ga0466960_0094756_91_474 121
336 3300045049 Ga0466959_0003950 Ga0466959_0003950_1764_2129 121
337 3300045049 Ga0466959_0027140 Ga0466959_0027140_1566_1934 121
338 3300045049 Ga0466959_0399854 Ga0466959_0399854_170_535 121
339 3300045836 Ga0466958_0242184 Ga0466958_0242184_192_557 121
340 3300045836 Ga0466958_0253826 Ga0466958_0253826_698_1066 121
341 3300045836 Ga0466958_0474409 Ga0466958_0474409_113_496 121
342 3300045976 Ga0466967_0052607 Ga0466967_0052607_1341_1724 121
343 3300045976 Ga0466967_0119962 Ga0466967_0119962_1621_1989 121
344 3300045976 Ga0466967_1045381 Ga0466967_1045381_26_391 121
345 3300046455 Ga0495603_0129947 Ga0495603_0129947_551_916 121
346 3300046499 Ga0495594_0266232 Ga0495594_0266232_551_916 121
347 3300046506 Ga0495583_0118648 Ga0495583_0118648_237_602 121
348 3300046524 Ga0495648_0031589 Ga0495648_0031589_1131_1496 121
349 3300046530 Ga0495654_0149874 Ga0495654_0149874_434_799 121
350 3300046616 Ga0495668_0053941 Ga0495668_0053941_1846_2211 121
351 3300046648 Ga0495611_0138319 Ga0495611_0138319_159_524 121
352 3300046690 Ga0495624_0212034 Ga0495624_0212034_696_1061 121
353 3300046694 Ga0495649_0258037 Ga0495649_0258037_295_663 121
354 3300047469 Ga0495673_0000444 Ga0495673_0000444_35456_35821 121
355 3300048903 Ga0496100_0000327 Ga0496100_0000327_4190_4555 121
356 3300048903 Ga0496100_0358049 Ga0496100_0358049_553_918 121
357 3300048903 Ga0496100_0982142 Ga0496100_0982142_71_436 121
358 3300048904 Ga0496101_0000549 Ga0496101_0000549_6036_6401 121
359 3300048905 Ga0496102_0016753 Ga0496102_0016753_707_1072 121
360 3300048905 Ga0496102_0028569 Ga0496102_0028569_922_1287 121
361 3300048905 Ga0496102_0029642 Ga0496102_0029642_290_655 121
362 3300048905 Ga0496102_0068195 Ga0496102_0068195_223_591 121
363 3300048905 Ga0496102_0171237 Ga0496102_0171237_1404_1769 121
364 3300048905 Ga0496102_0208489 Ga0496102_0208489_33_398 121
365 3300048905 Ga0496102_0266732 Ga0496102_0266732_125_490 121
366 3300048905 Ga0496102_0405671 Ga0496102_0405671_152_520 121
367 3300048906 Ga0496103_0000946 Ga0496103_0000946_18629_18994 121
368 3300048906 Ga0496103_0027965 Ga0496103_0027965_1030_1395 121
369 3300048906 Ga0496103_0129328 Ga0496103_0129328_946_1311 121
370 3300048906 Ga0496103_0244493 Ga0496103_0244493_105_470 121
371 3300048907 Ga0496104_0036803 Ga0496104_0036803_1031_1396 121
372 3300048907 Ga0496104_0046516 Ga0496104_0046516_3164_3529 121
373 3300048907 Ga0496104_0823323 Ga0496104_0823323_392_757 121
374 3300048907 Ga0496104_0826806 Ga0496104_0826806_346_711 121
375 3300048909 Ga0496106_0002484 Ga0496106_0002484_5875_6240 121
376 3300048909 Ga0496106_0015537 Ga0496106_0015537_1534_1899 121
377 3300048909 Ga0496106_0510148 Ga0496106_0510148_38_406 121
378 3300048909 Ga0496106_1220193 Ga0496106_1220193_110_475 121
379 3300048910 Ga0496107_0000464 Ga0496107_0000464_4949_5314 121
380 3300048910 Ga0496107_0019519 Ga0496107_0019519_3829_4194 121
381 3300048911 Ga0496108_0004778 Ga0496108_0004778_4655_5020 121
382 3300048911 Ga0496108_0008786 Ga0496108_0008786_259_624 121
383 3300048911 Ga0496108_0076787 Ga0496108_0076787_924_1292 121
384 3300048911 Ga0496108_0076965 Ga0496108_0076965_52_417 121
385 3300048911 Ga0496108_0272923 Ga0496108_0272923_384_752 121
386 3300048911 Ga0496108_0450754 Ga0496108_0450754_502_867 121
387 3300048912 Ga0496109_0000706 Ga0496109_0000706_6047_6412 121
388 3300048912 Ga0496109_0007281 Ga0496109_0007281_4097_4462 121
389 3300048912 Ga0496109_0073093 Ga0496109_0073093_87_455 121
390 3300048912 Ga0496109_0096999 Ga0496109_0096999_2105_2473 121
391 3300048912 Ga0496109_0412045 Ga0496109_0412045_803_1168 121
392 3300048913 Ga0496110_0001610 Ga0496110_0001610_5227_5592 121
393 3300048913 Ga0496110_0107539 Ga0496110_0107539_937_1305 121
394 3300048913 Ga0496110_0294816 Ga0496110_0294816_675_1040 121
395 3300048913 Ga0496110_0805374 Ga0496110_0805374_179_544 121
396 3300048914 Ga0496111_0007247 Ga0496111_0007247_5962_6327 121
397 3300048914 Ga0496111_0397558 Ga0496111_0397558_65_430 121
398 3300048914 Ga0496111_1044832 Ga0496111_1044832_87_452 121
399 3300048915 Ga0496112_0307867 Ga0496112_0307867_483_851 121
400 3300048915 Ga0496112_0509662 Ga0496112_0509662_400_765 121
401 3300048916 Ga0496113_0143190 Ga0496113_0143190_1423_1788 121
402 3300048916 Ga0496113_0255197 Ga0496113_0255197_86_454 121
403 3300048917 Ga0496114_0000774 Ga0496114_0000774_16952_17317 121
404 3300048917 Ga0496114_0098795 Ga0496114_0098795_1565_1930 121
405 3300048917 Ga0496114_0108019 Ga0496114_0108019_1327_1701 121
406 3300048917 Ga0496114_0888857 Ga0496114_0888857_232_597 121
407 3300048917 Ga0496114_1038437 Ga0496114_1038437_43_411 121
408 3300048917 Ga0496114_1104748 Ga0496114_1104748_268_633 121
409 3300048918 Ga0496115_0007319 Ga0496115_0007319_6264_6629 121
410 3300048918 Ga0496115_0352603 Ga0496115_0352603_312_686 121
411 3300048919 Ga0496116_0003582 Ga0496116_0003582_10934_11299 121
412 3300048920 Ga0496117_0016974 Ga0496117_0016974_1390_1755 121
413 3300048920 Ga0496117_0061525 Ga0496117_0061525_2060_2428 121
414 3300048921 Ga0496118_0000595 Ga0496118_0000595_10233_10601 121
415 3300048921 Ga0496118_0017436 Ga0496118_0017436_835_1200 121
416 3300048921 Ga0496118_0351824 Ga0496118_0351824_205_570 121
417 3300048922 Ga0496119_0003009 Ga0496119_0003009_11481_11846 121
418 3300048923 Ga0496120_0045432 Ga0496120_0045432_187_552 121
419 3300048924 Ga0496121_0000016 Ga0496121_0000016_281680_282045 121
420 3300048925 Ga0496122_0002739 Ga0496122_0002739_19809_20174 121
421 3300048927 Ga0496124_0000015 Ga0496124_0000015_96345_96710 121
422 3300048928 Ga0496125_0000021 Ga0496125_0000021_363991_364356 121
423 3300048929 Ga0496126_0000015 Ga0496126_0000015_363991_364356 121
424 3300048929 Ga0496126_0001911 Ga0496126_0001911_1204_1578 121
425 3300049568 Ga0501031_0659521 Ga0501031_0659521_224_607 121
426 3300049569 Ga0501032_0175602 Ga0501032_0175602_143_526 121
427 3300049569 Ga0501032_0387522 Ga0501032_0387522_140_508 121
428 3300049570 Ga0501033_0017450 Ga0501033_0017450_2874_3257 121
429 3300049571 Ga0501034_0007092 Ga0501034_0007092_8588_8971 121
430 3300049572 Ga0501036_0145140 Ga0501036_0145140_118_501 121
431 3300049573 Ga0501037_0044362 Ga0501037_0044362_1436_1819 121
432 3300049579 Ga0501043_0038751 Ga0501043_0038751_1305_1688 121
433 3300049580 Ga0501046_0002772 Ga0501046_0002772_15198_15581 121
434 3300049581 Ga0501047_0002519 Ga0501047_0002519_1511_1894 121
435 3300049581 Ga0501047_0739395 Ga0501047_0739395_121_489 121
436 3300049582 Ga0501048_0017886 Ga0501048_0017886_1215_1598 121
437 3300049582 Ga0501048_0663669 Ga0501048_0663669_162_530 121
438 3300049585 Ga0501069_0020640 Ga0501069_0020640_280_663 121
439 3300049586 Ga0501070_0000997 Ga0501070_0000997_23750_24133 121
440 3300049586 Ga0501070_0184988 Ga0501070_0184988_426_794 121
441 3300049587 Ga0501071_0384348 Ga0501071_0384348_290_673 121
442 3300049742 Ga0501080_0075773 Ga0501080_0075773_2123_2506 121
443 3300049744 Ga0501083_0452767 Ga0501083_0452767_185_568 121
444 3300049822 Ga0501035_0003647 Ga0501035_0003647_5434_5817 121
445 3300049822 Ga0501035_0189832 Ga0501035_0189832_1231_1599 121
446 3300049823 Ga0501044_0007204 Ga0501044_0007204_2222_2605 121
447 3300050489 nmdc:mga03683_198595_c1 nmdc:mga03683_198595_c1_269_634 121
448 3300050490 nmdc:mga03n38_104369_c1 nmdc:mga03n38_104369_c1_363_731 121
449 3300050490 nmdc:mga03n38_384195_c1 nmdc:mga03n38_384195_c1_20_385 121
450 3300050490 nmdc:mga03n38_54731_c1 nmdc:mga03n38_54731_c1_13_381 121
451 3300050490 nmdc:mga03n38_918066_c1 nmdc:mga03n38_918066_c1_132_497 121
452 3300050491 nmdc:mga00v17_3047_c1 nmdc:mga00v17_3047_c1_458_826 121
453 3300050491 nmdc:mga00v17_52858_c1 nmdc:mga00v17_52858_c1_2052_2426 121
454 3300050491 nmdc:mga00v17_53524_c1 nmdc:mga00v17_53524_c1_2049_2414 121
455 3300050492 nmdc:mga0yw44_289735_c1 nmdc:mga0yw44_289735_c1_546_911 121
456 3300050509 nmdc:mga0qj67_3373_c1 nmdc:mga0qj67_3373_c1_4353_4733 121
457 3300050514 nmdc:mga08x19_44563_c2 nmdc:mga08x19_44563_c2_501_866 121
458 3300050516 nmdc:mga0sz30_180086_c1 nmdc:mga0sz30_180086_c1_43_408 121
459 3300050516 nmdc:mga0sz30_25009_c1 nmdc:mga0sz30_25009_c1_1483_1851 121
460 3300050516 nmdc:mga0sz30_262411_c1 nmdc:mga0sz30_262411_c1_131_496 121
461 3300050516 nmdc:mga0sz30_71226_c1 nmdc:mga0sz30_71226_c1_188_553 121
462 3300053083 Ga0495655_0070605 Ga0495655_0070605_494_862 121
463 3300053096 Ga0500641_0062484 Ga0500641_0062484_731_1096 121
464 3300053129 Ga0500628_102184 Ga0500628_102184_287_655 121
465 3300053138 Ga0500564_067843 Ga0500564_067843_132_497 121
466 3300061719 Ga0466962_0037035 Ga0466962_0037035_1389_1757 121
467 3300061719 Ga0466962_0225257 Ga0466962_0225257_427_792 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

13

121

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a43-assembly1.cif.gz_B crystal structure of a dual topology fluoride ion channel. 0.7891 2 120
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.789 2 120
7kk9-assembly1.cif.gz_A fluoride channel fluc-ec2 mutant s81a/t82a with bromide 0.7869 8 120
6bx5-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 with monobody s12 0.783 2 117
5a40-assembly2.cif.gz_C crystal structure of a dual topology fluoride ion channel. 0.7809 2 120
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8342 8 114 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8138 8 114 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8084 13 116 1.10.287.70
af_Q4D2Y9_236_346_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8033 11 114 1.10.287.70
af_A4I767_271_383_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7943 8 114 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A6B9B6Y5-F1-model_v4 deleted 0.969 43 121
AF-W2E1V3-F1-model_v4 deleted 0.9689 35 116
AF-A0A0R1KYM9-F1-model_v4 Fluoride-specific ion channel FluC 0.9606 35 121 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A9WPV4-F1-model_v4 Fluoride-specific ion channel 0.9571 35 119 GO:0005886
GO:0034220
AF-A0A1L8D3N1-F1-model_v4 Fluoride-specific ion channel 0.9557 39 119 GO:0005886
GO:0034220

Feature Viewer

pLDDT pTM Quality
92.08 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map