F449795
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 467 | 255 | 462 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100381470|Ga0070680_1003814702 |
| Length | 127 |
| Sequence | VSAATVTTALVWVGVVLIGGVGSVLRFVIDRTVARRVSRPFPFGTLAVNISGAALLGFLGGLALNKEVALLAGTAFVGAYTTFSTWMLETQRLGEERQLRAGFANIVVSITLGVAAAFIGQRIAELI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 2 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 3 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 4 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 5 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 168 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 169 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 170 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 171 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 172 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 173 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 175 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 176 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 177 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 178 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 179 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 180 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 181 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 184 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 185 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 206 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 218 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 219 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 220 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 221 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 222 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 223 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 224 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 225 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 226 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 227 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 245 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 246 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 247 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 253 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 254 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 255 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.93 |
| Metatranscriptomes | 0 |
| Isolates | 1.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.64 |
| Nodule | 0.21 |
| Rhizoplane | 12.21 |
| Rhizosphere | 74.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10027103 | 3300001991 | Bacteria | 1117 |
| 2 | Ga0070658_10858120 | 3300005327 | Bacteria | 789 |
| 3 | Ga0070676_10033267 | 3300005328 | Bacteria | 2958 |
| 4 | Ga0070683_101175577 | 3300005329 | Bacteria | 737 |
| 5 | Ga0070690_100470793 | 3300005330 | Bacteria | 935 |
| 6 | Ga0068869_100009416 | 3300005334 | Bacteria | 6338 |
| 7 | Ga0068869_100020065 | 3300005334 | Bacteria | 4577 |
| 8 | Ga0070666_10049377 | 3300005335 | Bacteria | 2828 |
| 9 | Ga0070680_100381470 | 3300005336 | Bacteria | 1200 |
| 10 | Ga0070682_100077054 | 3300005337 | Bacteria | 2148 |
| 11 | Ga0070682_100136037 | 3300005337 | Bacteria | 1669 |
| 12 | Ga0070682_100256811 | 3300005337 | Bacteria | 1263 |
| 13 | Ga0070682_100825472 | 3300005337 | Bacteria | 755 |
| 14 | Ga0068868_100053639 | 3300005338 | Bacteria | 3176 |
| 15 | Ga0068868_100296010 | 3300005338 | Bacteria | 1373 |
| 16 | Ga0068868_100607933 | 3300005338 | Bacteria | 969 |
| 17 | Ga0070660_100435607 | 3300005339 | Bacteria | 1086 |
| 18 | Ga0070660_100940048 | 3300005339 | Bacteria | 730 |
| 19 | Ga0070660_101672608 | 3300005339 | Bacteria | 542 |
| 20 | Ga0070689_100097870 | 3300005340 | Bacteria | 2320 |
| 21 | Ga0070691_10260409 | 3300005341 | Bacteria | 933 |
| 22 | Ga0070687_100234556 | 3300005343 | Bacteria | 1131 |
| 23 | Ga0070661_100345554 | 3300005344 | Bacteria | 1166 |
| 24 | Ga0070692_10143410 | 3300005345 | Bacteria | 1354 |
| 25 | Ga0070668_100016763 | 3300005347 | Bacteria | 5477 |
| 26 | Ga0070668_100023563 | 3300005347 | Bacteria | 4657 |
| 27 | Ga0070668_101522697 | 3300005347 | Bacteria | 612 |
| 28 | Ga0070668_101782510 | 3300005347 | Bacteria | 566 |
| 29 | Ga0070669_100079785 | 3300005353 | Bacteria | 2434 |
| 30 | Ga0070669_101260291 | 3300005353 | Bacteria | 640 |
| 31 | Ga0070671_100058096 | 3300005355 | Bacteria | 3220 |
| 32 | Ga0070671_100106765 | 3300005355 | Bacteria | 2351 |
| 33 | Ga0070671_100533899 | 3300005355 | Bacteria | 1011 |
| 34 | Ga0070674_100008547 | 3300005356 | Bacteria | 6104 |
| 35 | Ga0070674_100084417 | 3300005356 | Bacteria | 2277 |
| 36 | Ga0070673_100316212 | 3300005364 | Bacteria | 1378 |
| 37 | Ga0070659_100325836 | 3300005366 | Bacteria | 1285 |
| 38 | Ga0070667_100000575 | 3300005367 | Bacteria | 36222 |
| 39 | Ga0070667_100017058 | 3300005367 | Bacteria | 6013 |
| 40 | Ga0070703_10077228 | 3300005406 | Bacteria | 1126 |
| 41 | Ga0070709_10076185 | 3300005434 | Bacteria | 2178 |
| 42 | Ga0070714_100109337 | 3300005435 | Bacteria | 2445 |
| 43 | Ga0070714_100397548 | 3300005435 | Bacteria | 1302 |
| 44 | Ga0070714_100782799 | 3300005435 | Bacteria | 923 |
| 45 | Ga0070710_10000006 | 3300005437 | Bacteria | 217422 |
| 46 | Ga0070710_10019276 | 3300005437 | Bacteria | 3522 |
| 47 | Ga0070701_10003068 | 3300005438 | Bacteria | 6547 |
| 48 | Ga0070701_10804982 | 3300005438 | Bacteria | 641 |
| 49 | Ga0070711_100013993 | 3300005439 | Bacteria | 5047 |
| 50 | Ga0070705_100016007 | 3300005440 | Bacteria | 3887 |
| 51 | Ga0070700_100009961 | 3300005441 | Bacteria | 5231 |
| 52 | Ga0070700_100081420 | 3300005441 | Bacteria | 2091 |
| 53 | Ga0070694_100014253 | 3300005444 | Bacteria | 4975 |
| 54 | Ga0070663_100022386 | 3300005455 | Bacteria | 4225 |
| 55 | Ga0070663_100540327 | 3300005455 | Bacteria | 973 |
| 56 | Ga0070678_100018013 | 3300005456 | Bacteria | 4566 |
| 57 | Ga0070662_100007272 | 3300005457 | Bacteria | 7174 |
| 58 | Ga0068867_100020053 | 3300005459 | Bacteria | 4764 |
| 59 | Ga0070685_10045947 | 3300005466 | Bacteria | 2506 |
| 60 | Ga0070685_10548388 | 3300005466 | Bacteria | 825 |
| 61 | Ga0070684_100105969 | 3300005535 | Bacteria | 2516 |
| 62 | Ga0068853_100013403 | 3300005539 | Bacteria | 6692 |
| 63 | Ga0070672_100090621 | 3300005543 | Bacteria | 2466 |
| 64 | Ga0070695_100087957 | 3300005545 | Bacteria | 2068 |
| 65 | Ga0070696_100008478 | 3300005546 | Bacteria | 6880 |
| 66 | Ga0070693_100007808 | 3300005547 | Bacteria | 5247 |
| 67 | Ga0070665_100013490 | 3300005548 | Bacteria | 8222 |
| 68 | Ga0070665_100022862 | 3300005548 | Bacteria | 6294 |
| 69 | Ga0070665_100232284 | 3300005548 | Bacteria | 1844 |
| 70 | Ga0070665_100954876 | 3300005548 | Bacteria | 870 |
| 71 | Ga0070704_100010033 | 3300005549 | Bacteria | 5753 |
| 72 | Ga0070704_100077254 | 3300005549 | Bacteria | 2438 |
| 73 | Ga0068855_100246237 | 3300005563 | Bacteria | 1995 |
| 74 | Ga0068855_100719529 | 3300005563 | Bacteria | 1067 |
| 75 | Ga0068854_100014496 | 3300005578 | Bacteria | 5197 |
| 76 | Ga0068854_100101811 | 3300005578 | Bacteria | 2154 |
| 77 | Ga0068856_100232684 | 3300005614 | Bacteria | 1858 |
| 78 | Ga0068856_101331389 | 3300005614 | Bacteria | 733 |
| 79 | Ga0070702_100008967 | 3300005615 | Bacteria | 4871 |
| 80 | Ga0070702_100144013 | 3300005615 | Bacteria | 1521 |
| 81 | Ga0068852_100142630 | 3300005616 | Bacteria | 2219 |
| 82 | Ga0068852_101382447 | 3300005616 | Bacteria | 726 |
| 83 | Ga0068852_101386141 | 3300005616 | Bacteria | 725 |
| 84 | Ga0068859_100056548 | 3300005617 | Bacteria | 3949 |
| 85 | Ga0068859_100714256 | 3300005617 | Bacteria | 1092 |
| 86 | Ga0068859_102619478 | 3300005617 | Bacteria | 555 |
| 87 | Ga0068864_100166701 | 3300005618 | Bacteria | 2006 |
| 88 | Ga0068864_100206973 | 3300005618 | Bacteria | 1805 |
| 89 | Ga0068864_100222939 | 3300005618 | Bacteria | 1740 |
| 90 | Ga0068866_10002254 | 3300005718 | Bacteria | 7997 |
| 91 | Ga0068861_100015153 | 3300005719 | Bacteria | 5426 |
| 92 | Ga0068861_100113456 | 3300005719 | Bacteria | 2174 |
| 93 | Ga0068863_100236845 | 3300005841 | Bacteria | 1762 |
| 94 | Ga0068863_100908690 | 3300005841 | Bacteria | 881 |
| 95 | Ga0068858_100022398 | 3300005842 | Bacteria | 5897 |
| 96 | Ga0068858_100038340 | 3300005842 | Bacteria | 4445 |
| 97 | Ga0068858_100350196 | 3300005842 | Bacteria | 1415 |
| 98 | Ga0068858_100367182 | 3300005842 | Bacteria | 1380 |
| 99 | Ga0068860_100002358 | 3300005843 | Bacteria | 19846 |
| 100 | Ga0068860_100243511 | 3300005843 | Bacteria | 1749 |
| 101 | Ga0068860_101220194 | 3300005843 | Bacteria | 772 |
| 102 | Ga0068862_100101274 | 3300005844 | Bacteria | 2520 |
| 103 | Ga0081455_10062573 | 3300005937 | Bacteria | 3127 |
| 104 | Ga0081455_10267740 | 3300005937 | Bacteria | 1241 |
| 105 | Ga0070717_10916049 | 3300006028 | Bacteria | 798 |
| 106 | Ga0075365_10178525 | 3300006038 | Bacteria | 1484 |
| 107 | Ga0075363_100007442 | 3300006048 | Bacteria | 5034 |
| 108 | Ga0075363_100025630 | 3300006048 | Bacteria | 3009 |
| 109 | Ga0075363_100043050 | 3300006048 | Bacteria | 2387 |
| 110 | Ga0075364_10078752 | 3300006051 | Bacteria | 2177 |
| 111 | Ga0075364_10105630 | 3300006051 | Bacteria | 1876 |
| 112 | Ga0075364_10311027 | 3300006051 | Bacteria | 1073 |
| 113 | Ga0070715_10024734 | 3300006163 | Bacteria | 2370 |
| 114 | Ga0070715_10764253 | 3300006163 | Bacteria | 583 |
| 115 | Ga0070712_100012405 | 3300006175 | Bacteria | 5416 |
| 116 | Ga0075362_10130245 | 3300006177 | Bacteria | 1196 |
| 117 | Ga0075369_10021031 | 3300006186 | Bacteria | 2677 |
| 118 | Ga0075369_10237860 | 3300006186 | Bacteria | 844 |
| 119 | Ga0075369_10249964 | 3300006186 | Bacteria | 823 |
| 120 | Ga0075369_10390356 | 3300006186 | Bacteria | 655 |
| 121 | Ga0075366_10578183 | 3300006195 | Bacteria | 696 |
| 122 | Ga0097621_100299974 | 3300006237 | Bacteria | 1419 |
| 123 | Ga0075370_10050140 | 3300006353 | Bacteria | 2368 |
| 124 | Ga0068871_100049118 | 3300006358 | Bacteria | 3409 |
| 125 | Ga0075430_100000964 | 3300006846 | Bacteria | 22702 |
| 126 | Ga0068865_100012553 | 3300006881 | Bacteria | 5337 |
| 127 | Ga0068865_101271006 | 3300006881 | Bacteria | 653 |
| 128 | Ga0075436_100083089 | 3300006914 | Bacteria | 2222 |
| 129 | Ga0097620_100056548 | 3300006931 | Bacteria | 3949 |
| 130 | Ga0097620_100714271 | 3300006931 | Bacteria | 1092 |
| 131 | Ga0097620_102619502 | 3300006931 | Bacteria | 555 |
| 132 | Ga0105250_10370475 | 3300009092 | Bacteria | 630 |
| 133 | Ga0105245_10024085 | 3300009098 | Bacteria | 5345 |
| 134 | Ga0105245_10735790 | 3300009098 | Bacteria | 1021 |
| 135 | Ga0105245_11746045 | 3300009098 | Bacteria | 675 |
| 136 | Ga0105247_10001532 | 3300009101 | Bacteria | 16499 |
| 137 | Ga0105243_10001339 | 3300009148 | Bacteria | 21944 |
| 138 | Ga0105243_10243443 | 3300009148 | Bacteria | 1602 |
| 139 | Ga0105241_10210002 | 3300009174 | Bacteria | 1631 |
| 140 | Ga0105242_10001137 | 3300009176 | Bacteria | 20962 |
| 141 | Ga0105248_10031352 | 3300009177 | Bacteria | 5942 |
| 142 | Ga0105248_10202401 | 3300009177 | Bacteria | 2237 |
| 143 | Ga0105237_10003521 | 3300009545 | Bacteria | 18559 |
| 144 | Ga0105237_10130961 | 3300009545 | Bacteria | 2503 |
| 145 | Ga0105237_10305466 | 3300009545 | Bacteria | 1594 |
| 146 | Ga0105238_10334516 | 3300009551 | Bacteria | 1502 |
| 147 | Ga0105238_10403515 | 3300009551 | Bacteria | 1360 |
| 148 | Ga0105239_10002436 | 3300010375 | Bacteria | 23713 |
| 149 | Ga0105239_10182902 | 3300010375 | Bacteria | 2345 |
| 150 | Ga0105239_11159399 | 3300010375 | Bacteria | 890 |
| 151 | Ga0157374_10108636 | 3300013296 | Bacteria | 2666 |
| 152 | Ga0157378_10020735 | 3300013297 | Bacteria | 5781 |
| 153 | Ga0157378_11070713 | 3300013297 | Bacteria | 842 |
| 154 | Ga0163162_10007394 | 3300013306 | Bacteria | 10679 |
| 155 | Ga0163162_10066606 | 3300013306 | Bacteria | 3650 |
| 156 | Ga0163162_10856903 | 3300013306 | Bacteria | 1023 |
| 157 | Ga0157372_10002210 | 3300013307 | Bacteria | 21129 |
| 158 | Ga0157372_10381786 | 3300013307 | Bacteria | 1642 |
| 159 | Ga0157375_10309208 | 3300013308 | Bacteria | 1745 |
| 160 | Ga0163163_10113994 | 3300014325 | Bacteria | 2734 |
| 161 | Ga0163163_10138458 | 3300014325 | Bacteria | 2476 |
| 162 | Ga0163163_11064702 | 3300014325 | Bacteria | 872 |
| 163 | Ga0163163_12349646 | 3300014325 | Bacteria | 592 |
| 164 | Ga0157380_10000872 | 3300014326 | Bacteria | 18978 |
| 165 | Ga0157380_11868020 | 3300014326 | Bacteria | 661 |
| 166 | Ga0157379_10068539 | 3300014968 | Bacteria | 3171 |
| 167 | Ga0163161_10040330 | 3300017792 | Bacteria | 3353 |
| 168 | Ga0163161_10078644 | 3300017792 | Bacteria | 2424 |
| 169 | Ga0163161_10116169 | 3300017792 | Bacteria | 2006 |
| 170 | Ga0213876_10002160 | 3300021384 | Bacteria | 11623 |
| 171 | Ga0213876_10029767 | 3300021384 | Bacteria | 2877 |
| 172 | Ga0213875_10014627 | 3300021388 | Bacteria | 3827 |
| 173 | Ga0213875_10183906 | 3300021388 | Bacteria | 982 |
| 174 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 175 | Ga0207692_10000001 | 3300025898 | Bacteria | 558345 |
| 176 | Ga0207692_10006171 | 3300025898 | Bacteria | 4853 |
| 177 | Ga0207642_10063431 | 3300025899 | Bacteria | 1728 |
| 178 | Ga0207710_10006688 | 3300025900 | Bacteria | 4912 |
| 179 | Ga0207710_10180275 | 3300025900 | Bacteria | 1036 |
| 180 | Ga0207688_10002449 | 3300025901 | Bacteria | 9984 |
| 181 | Ga0207688_10011076 | 3300025901 | Bacteria | 4907 |
| 182 | Ga0207680_10168104 | 3300025903 | Bacteria | 1475 |
| 183 | Ga0207647_10450372 | 3300025904 | Bacteria | 721 |
| 184 | Ga0207685_10065838 | 3300025905 | Bacteria | 1452 |
| 185 | Ga0207699_10037765 | 3300025906 | Bacteria | 2763 |
| 186 | Ga0207645_10065175 | 3300025907 | Bacteria | 2328 |
| 187 | Ga0207654_10046715 | 3300025911 | Bacteria | 2470 |
| 188 | Ga0207671_10003916 | 3300025914 | Bacteria | 14515 |
| 189 | Ga0207671_10070012 | 3300025914 | Bacteria | 2614 |
| 190 | Ga0207671_10092672 | 3300025914 | Bacteria | 2278 |
| 191 | Ga0207693_10001549 | 3300025915 | Bacteria | 20293 |
| 192 | Ga0207663_10146908 | 3300025916 | Bacteria | 1649 |
| 193 | Ga0207662_10027386 | 3300025918 | Bacteria | 3289 |
| 194 | Ga0207657_10160163 | 3300025919 | Bacteria | 1828 |
| 195 | Ga0207657_10166933 | 3300025919 | Bacteria | 1785 |
| 196 | Ga0207649_10162306 | 3300025920 | Bacteria | 1549 |
| 197 | Ga0207681_10186617 | 3300025923 | Bacteria | 1583 |
| 198 | Ga0207694_10495250 | 3300025924 | Bacteria | 1023 |
| 199 | Ga0207659_11188640 | 3300025926 | Bacteria | 656 |
| 200 | Ga0207687_10049507 | 3300025927 | Bacteria | 2922 |
| 201 | Ga0207687_10556773 | 3300025927 | Bacteria | 963 |
| 202 | Ga0207664_10720414 | 3300025929 | Bacteria | 897 |
| 203 | Ga0207644_10094984 | 3300025931 | Bacteria | 2229 |
| 204 | Ga0207644_10369891 | 3300025931 | Bacteria | 1167 |
| 205 | Ga0207690_10047730 | 3300025932 | Bacteria | 2843 |
| 206 | Ga0207690_10072433 | 3300025932 | Bacteria | 2379 |
| 207 | Ga0207706_10011686 | 3300025933 | Bacteria | 8006 |
| 208 | Ga0207686_10011133 | 3300025934 | Bacteria | 4917 |
| 209 | Ga0207709_10214847 | 3300025935 | Bacteria | 1383 |
| 210 | Ga0207709_10567450 | 3300025935 | Bacteria | 895 |
| 211 | Ga0207670_10110960 | 3300025936 | Bacteria | 1976 |
| 212 | Ga0207669_10006074 | 3300025937 | Bacteria | 5481 |
| 213 | Ga0207704_10049898 | 3300025938 | Bacteria | 2521 |
| 214 | Ga0207665_10029016 | 3300025939 | Bacteria | 3658 |
| 215 | Ga0207691_10078655 | 3300025940 | Bacteria | 2968 |
| 216 | Ga0207691_10153743 | 3300025940 | Bacteria | 2022 |
| 217 | Ga0207689_10081304 | 3300025942 | Bacteria | 2663 |
| 218 | Ga0207689_10529024 | 3300025942 | Bacteria | 989 |
| 219 | Ga0207661_10900783 | 3300025944 | Bacteria | 815 |
| 220 | Ga0207667_10264810 | 3300025949 | Bacteria | 1758 |
| 221 | Ga0207667_10319156 | 3300025949 | Bacteria | 1587 |
| 222 | Ga0207712_10029176 | 3300025961 | Bacteria | 3698 |
| 223 | Ga0207668_10010485 | 3300025972 | Bacteria | 5600 |
| 224 | Ga0207668_10083815 | 3300025972 | Bacteria | 2321 |
| 225 | Ga0207668_10264062 | 3300025972 | Bacteria | 1404 |
| 226 | Ga0207640_10088097 | 3300025981 | Bacteria | 2142 |
| 227 | Ga0207640_10439457 | 3300025981 | Bacteria | 1072 |
| 228 | Ga0207658_10000502 | 3300025986 | Bacteria | 35835 |
| 229 | Ga0207658_10005441 | 3300025986 | Bacteria | 8731 |
| 230 | Ga0207658_10022924 | 3300025986 | Bacteria | 4351 |
| 231 | Ga0207658_10880503 | 3300025986 | Bacteria | 815 |
| 232 | Ga0207677_10563127 | 3300026023 | Bacteria | 995 |
| 233 | Ga0207703_10033427 | 3300026035 | Bacteria | 4077 |
| 234 | Ga0207703_10501669 | 3300026035 | Bacteria | 1139 |
| 235 | Ga0207639_10035174 | 3300026041 | Bacteria | 3706 |
| 236 | Ga0207639_10092211 | 3300026041 | Bacteria | 2427 |
| 237 | Ga0207639_10401443 | 3300026041 | Bacteria | 1235 |
| 238 | Ga0207678_10014268 | 3300026067 | Bacteria | 6986 |
| 239 | Ga0207678_10025578 | 3300026067 | Bacteria | 5152 |
| 240 | Ga0207678_10724158 | 3300026067 | Bacteria | 876 |
| 241 | Ga0207708_10002852 | 3300026075 | Bacteria | 12716 |
| 242 | Ga0207708_10025987 | 3300026075 | Bacteria | 4429 |
| 243 | Ga0207702_10183454 | 3300026078 | Bacteria | 1929 |
| 244 | Ga0207702_10295142 | 3300026078 | Bacteria | 1537 |
| 245 | Ga0207702_10369359 | 3300026078 | Bacteria | 1377 |
| 246 | Ga0207641_10050338 | 3300026088 | Bacteria | 3524 |
| 247 | Ga0207641_11338147 | 3300026088 | Bacteria | 717 |
| 248 | Ga0207648_10007000 | 3300026089 | Bacteria | 11150 |
| 249 | Ga0207648_10045017 | 3300026089 | Bacteria | 3872 |
| 250 | Ga0207676_10277931 | 3300026095 | Bacteria | 1519 |
| 251 | Ga0207676_10588823 | 3300026095 | Bacteria | 1067 |
| 252 | Ga0207675_100027425 | 3300026118 | Bacteria | 5305 |
| 253 | Ga0207675_100030175 | 3300026118 | Bacteria | 5050 |
| 254 | Ga0207683_10023585 | 3300026121 | Bacteria | 5293 |
| 255 | Ga0207698_10623556 | 3300026142 | Bacteria | 1065 |
| 256 | Ga0268266_10018695 | 3300028379 | Bacteria | 5904 |
| 257 | Ga0268266_10035140 | 3300028379 | Bacteria | 4263 |
| 258 | Ga0268266_10041000 | 3300028379 | Bacteria | 3948 |
| 259 | Ga0268266_11186567 | 3300028379 | Bacteria | 738 |
| 260 | Ga0268264_10015366 | 3300028381 | Bacteria | 6278 |
| 261 | Ga0265327_10004178 | 3300031251 | Bacteria | 13020 |
| 262 | Ga0265327_10116176 | 3300031251 | Bacteria | 1273 |
| 263 | Ga0307405_10445095 | 3300031731 | Bacteria | 1026 |
| 264 | Ga0307406_10157530 | 3300031901 | Bacteria | 1628 |
| 265 | Ga0307406_10644599 | 3300031901 | Bacteria | 878 |
| 266 | Ga0307409_102083321 | 3300031995 | Bacteria | 597 |
| 267 | Ga0373928_0086032 | 3300035084 | Bacteria | 800 |
| 268 | Ga0373949_0065654 | 3300035090 | Bacteria | 942 |
| 269 | Ga0373939_0140991 | 3300035114 | Bacteria | 869 |
| 270 | Ga0373943_0253535 | 3300035170 | Bacteria | 989 |
| 271 | Ga0373946_0015962 | 3300035171 | Bacteria | 2856 |
| 272 | Ga0373931_0193947 | 3300035691 | Bacteria | 1210 |
| 273 | Ga0436364_0288923 | 3300037853 | Bacteria | 7333 |
| 274 | Ga0436364_1154307 | 3300037853 | Bacteria | 1045 |
| 275 | Ga0395901_2084143 | 3300038443 | Bacteria | 512 |
| 276 | Ga0436365_0178124 | 3300039437 | Bacteria | 860 |
| 277 | Ga0436365_0307061 | 3300039437 | Bacteria | 6040 |
| 278 | Ga0436365_1376337 | 3300039437 | Bacteria | 20253 |
| 279 | Ga0436365_1909980 | 3300039437 | Bacteria | 15850 |
| 280 | Ga0436360_1064439 | 3300039438 | Bacteria | 601 |
| 281 | Ga0436361_0753093 | 3300039447 | Bacteria | 965 |
| 282 | Ga0439461_0010152 | 3300041410 | Bacteria | 1723 |
| 283 | Ga0439466_0007603 | 3300041411 | Bacteria | 4093 |
| 284 | Ga0439465_0365165 | 3300041413 | Bacteria | 546 |
| 285 | Ga0451802_1256245 | 3300041460 | Bacteria | 991 |
| 286 | Ga0451853_2731377 | 3300041512 | Bacteria | 1372 |
| 287 | Ga0439431_0007653 | 3300041997 | Bacteria | 2412 |
| 288 | Ga0439434_0131017 | 3300042435 | Bacteria | 822 |
| 289 | Ga0439459_0026672 | 3300042438 | Bacteria | 1149 |
| 290 | Ga0466972_0092997 | 3300044658 | Bacteria | 1429 |
| 291 | Ga0466965_0012931 | 3300044683 | Bacteria | 3931 |
| 292 | Ga0466965_0014166 | 3300044683 | Bacteria | 3773 |
| 293 | Ga0466965_0034794 | 3300044683 | Bacteria | 2466 |
| 294 | Ga0466966_0011171 | 3300044684 | Bacteria | 5956 |
| 295 | Ga0466966_0039190 | 3300044684 | Bacteria | 3052 |
| 296 | Ga0466966_0068359 | 3300044684 | Bacteria | 2230 |
| 297 | Ga0466966_0927083 | 3300044684 | Bacteria | 525 |
| 298 | Ga0466961_0018993 | 3300044693 | Bacteria | 4422 |
| 299 | Ga0466961_0565349 | 3300044693 | Bacteria | 684 |
| 300 | Ga0466963_0157420 | 3300044694 | Bacteria | 1580 |
| 301 | Ga0466963_0199855 | 3300044694 | Bacteria | 1398 |
| 302 | Ga0466963_0212472 | 3300044694 | Bacteria | 1354 |
| 303 | Ga0466964_0293504 | 3300044706 | Bacteria | 817 |
| 304 | Ga0466964_0525551 | 3300044706 | Bacteria | 639 |
| 305 | Ga0466964_0674467 | 3300044706 | Bacteria | 574 |
| 306 | Ga0466971_0039549 | 3300044719 | Bacteria | 2116 |
| 307 | Ga0466971_0100659 | 3300044719 | Bacteria | 1328 |
| 308 | Ga0466968_0003968 | 3300044735 | Bacteria | 5494 |
| 309 | Ga0466968_0092057 | 3300044735 | Bacteria | 1345 |
| 310 | Ga0466968_0124083 | 3300044735 | Bacteria | 1170 |
| 311 | Ga0466970_0020656 | 3300044765 | Bacteria | 3423 |
| 312 | Ga0466957_0006220 | 3300044842 | Bacteria | 6739 |
| 313 | Ga0466957_0006518 | 3300044842 | Bacteria | 6592 |
| 314 | Ga0466957_0020545 | 3300044842 | Bacteria | 3886 |
| 315 | Ga0466957_0132479 | 3300044842 | Bacteria | 1598 |
| 316 | Ga0466960_0000760 | 3300044901 | Bacteria | 11347 |
| 317 | Ga0466960_0010837 | 3300044901 | Bacteria | 3795 |
| 318 | Ga0466960_0020341 | 3300044901 | Bacteria | 2939 |
| 319 | Ga0466960_0094756 | 3300044901 | Bacteria | 1527 |
| 320 | Ga0466959_0003950 | 3300045049 | Bacteria | 9850 |
| 321 | Ga0466959_0011761 | 3300045049 | Bacteria | 6300 |
| 322 | Ga0466959_0027140 | 3300045049 | Bacteria | 4247 |
| 323 | Ga0466959_0399854 | 3300045049 | Bacteria | 934 |
| 324 | Ga0466958_0037989 | 3300045836 | Bacteria | 2887 |
| 325 | Ga0466958_0242184 | 3300045836 | Bacteria | 1152 |
| 326 | Ga0466958_0253826 | 3300045836 | Bacteria | 1125 |
| 327 | Ga0466958_0474409 | 3300045836 | Bacteria | 811 |
| 328 | Ga0466967_0029748 | 3300045976 | Bacteria | 4576 |
| 329 | Ga0466967_0052607 | 3300045976 | Bacteria | 3575 |
| 330 | Ga0466967_0119962 | 3300045976 | Bacteria | 2428 |
| 331 | Ga0466967_1045381 | 3300045976 | Bacteria | 813 |
| 332 | Ga0495603_0129947 | 3300046455 | Bacteria | 1467 |
| 333 | Ga0495594_0266232 | 3300046499 | Bacteria | 976 |
| 334 | Ga0495583_0118648 | 3300046506 | Bacteria | 1115 |
| 335 | Ga0495648_0031589 | 3300046524 | Bacteria | 3484 |
| 336 | Ga0495654_0149874 | 3300046530 | Bacteria | 1032 |
| 337 | Ga0495668_0053941 | 3300046616 | Bacteria | 2222 |
| 338 | Ga0495611_0138319 | 3300046648 | Bacteria | 1137 |
| 339 | Ga0495624_0212034 | 3300046690 | Bacteria | 1175 |
| 340 | Ga0495649_0258037 | 3300046694 | Bacteria | 894 |
| 341 | Ga0495673_0000444 | 3300047469 | Bacteria | 45563 |
| 342 | Ga0496100_0000327 | 3300048903 | Bacteria | 23421 |
| 343 | Ga0496100_0358049 | 3300048903 | Bacteria | 1103 |
| 344 | Ga0496100_0982142 | 3300048903 | Bacteria | 664 |
| 345 | Ga0496101_0000549 | 3300048904 | Bacteria | 22984 |
| 346 | Ga0496102_0016753 | 3300048905 | Bacteria | 6408 |
| 347 | Ga0496102_0028569 | 3300048905 | Bacteria | 4982 |
| 348 | Ga0496102_0029642 | 3300048905 | Bacteria | 4897 |
| 349 | Ga0496102_0068195 | 3300048905 | Bacteria | 3264 |
| 350 | Ga0496102_0171237 | 3300048905 | Bacteria | 2044 |
| 351 | Ga0496102_0208489 | 3300048905 | Bacteria | 1842 |
| 352 | Ga0496102_0266732 | 3300048905 | Bacteria | 1614 |
| 353 | Ga0496102_0405671 | 3300048905 | Bacteria | 1281 |
| 354 | Ga0496103_0000946 | 3300048906 | Bacteria | 20800 |
| 355 | Ga0496103_0027965 | 3300048906 | Bacteria | 3420 |
| 356 | Ga0496103_0129328 | 3300048906 | Bacteria | 1612 |
| 357 | Ga0496103_0244493 | 3300048906 | Bacteria | 1154 |
| 358 | Ga0496104_0036803 | 3300048907 | Bacteria | 4576 |
| 359 | Ga0496104_0046516 | 3300048907 | Bacteria | 4087 |
| 360 | Ga0496104_0823323 | 3300048907 | Bacteria | 834 |
| 361 | Ga0496104_0826806 | 3300048907 | Bacteria | 832 |
| 362 | Ga0496106_0002484 | 3300048909 | Bacteria | 13747 |
| 363 | Ga0496106_0015537 | 3300048909 | Bacteria | 5631 |
| 364 | Ga0496106_0510148 | 3300048909 | Bacteria | 966 |
| 365 | Ga0496106_1220193 | 3300048909 | Bacteria | 586 |
| 366 | Ga0496107_0000464 | 3300048910 | Bacteria | 22198 |
| 367 | Ga0496107_0019519 | 3300048910 | Bacteria | 4782 |
| 368 | Ga0496108_0004778 | 3300048911 | Bacteria | 10925 |
| 369 | Ga0496108_0008786 | 3300048911 | Bacteria | 8191 |
| 370 | Ga0496108_0076787 | 3300048911 | Bacteria | 2824 |
| 371 | Ga0496108_0076965 | 3300048911 | Bacteria | 2821 |
| 372 | Ga0496108_0272923 | 3300048911 | Bacteria | 1472 |
| 373 | Ga0496108_0450754 | 3300048911 | Bacteria | 1124 |
| 374 | Ga0496109_0000706 | 3300048912 | Bacteria | 27759 |
| 375 | Ga0496109_0007281 | 3300048912 | Bacteria | 9354 |
| 376 | Ga0496109_0073093 | 3300048912 | Bacteria | 3151 |
| 377 | Ga0496109_0096999 | 3300048912 | Bacteria | 2732 |
| 378 | Ga0496109_0412045 | 3300048912 | Bacteria | 1277 |
| 379 | Ga0496110_0001610 | 3300048913 | Bacteria | 16525 |
| 380 | Ga0496110_0107539 | 3300048913 | Bacteria | 2504 |
| 381 | Ga0496110_0294816 | 3300048913 | Bacteria | 1477 |
| 382 | Ga0496110_0805374 | 3300048913 | Bacteria | 844 |
| 383 | Ga0496111_0007247 | 3300048914 | Bacteria | 7256 |
| 384 | Ga0496111_0397558 | 3300048914 | Bacteria | 1018 |
| 385 | Ga0496111_1044832 | 3300048914 | Bacteria | 584 |
| 386 | Ga0496112_0307867 | 3300048915 | Bacteria | 1529 |
| 387 | Ga0496112_0509662 | 3300048915 | Bacteria | 1138 |
| 388 | Ga0496113_0143190 | 3300048916 | Bacteria | 1882 |
| 389 | Ga0496113_0255197 | 3300048916 | Bacteria | 1400 |
| 390 | Ga0496114_0000774 | 3300048917 | Bacteria | 23896 |
| 391 | Ga0496114_0098795 | 3300048917 | Bacteria | 2489 |
| 392 | Ga0496114_0108019 | 3300048917 | Bacteria | 2382 |
| 393 | Ga0496114_0888857 | 3300048917 | Bacteria | 772 |
| 394 | Ga0496114_1038437 | 3300048917 | Bacteria | 703 |
| 395 | Ga0496114_1104748 | 3300048917 | Bacteria | 678 |
| 396 | Ga0496115_0007319 | 3300048918 | Bacteria | 8118 |
| 397 | Ga0496115_0352603 | 3300048918 | Bacteria | 1200 |
| 398 | Ga0496116_0003582 | 3300048919 | Bacteria | 15273 |
| 399 | Ga0496117_0016974 | 3300048920 | Bacteria | 6099 |
| 400 | Ga0496117_0061525 | 3300048920 | Bacteria | 2580 |
| 401 | Ga0496118_0000595 | 3300048921 | Bacteria | 59802 |
| 402 | Ga0496118_0017436 | 3300048921 | Bacteria | 6536 |
| 403 | Ga0496118_0351824 | 3300048921 | Bacteria | 785 |
| 404 | Ga0496119_0003009 | 3300048922 | Bacteria | 17854 |
| 405 | Ga0496120_0045432 | 3300048923 | Bacteria | 2544 |
| 406 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 407 | Ga0496122_0002739 | 3300048925 | Bacteria | 24368 |
| 408 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 409 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 410 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 411 | Ga0496126_0001911 | 3300048929 | Bacteria | 29891 |
| 412 | Ga0501031_0203889 | 3300049568 | Bacteria | 1290 |
| 413 | Ga0501031_0659521 | 3300049568 | Bacteria | 672 |
| 414 | Ga0501032_0037168 | 3300049569 | Bacteria | 3321 |
| 415 | Ga0501032_0175602 | 3300049569 | Bacteria | 1403 |
| 416 | Ga0501032_0387522 | 3300049569 | Bacteria | 898 |
| 417 | Ga0501033_0017450 | 3300049570 | Bacteria | 5423 |
| 418 | Ga0501033_0116714 | 3300049570 | Bacteria | 1939 |
| 419 | Ga0501034_0007092 | 3300049571 | Bacteria | 11955 |
| 420 | Ga0501034_0087568 | 3300049571 | Bacteria | 3114 |
| 421 | Ga0501036_0145140 | 3300049572 | Bacteria | 2002 |
| 422 | Ga0501037_0044362 | 3300049573 | Bacteria | 3265 |
| 423 | Ga0501043_0038751 | 3300049579 | Bacteria | 3748 |
| 424 | Ga0501043_0064253 | 3300049579 | Bacteria | 2882 |
| 425 | Ga0501046_0002772 | 3300049580 | Bacteria | 16302 |
| 426 | Ga0501046_0313473 | 3300049580 | Bacteria | 1144 |
| 427 | Ga0501047_0002519 | 3300049581 | Bacteria | 17469 |
| 428 | Ga0501047_0739395 | 3300049581 | Bacteria | 800 |
| 429 | Ga0501048_0017886 | 3300049582 | Bacteria | 5215 |
| 430 | Ga0501048_0663669 | 3300049582 | Bacteria | 749 |
| 431 | Ga0501069_0020640 | 3300049585 | Bacteria | 3570 |
| 432 | Ga0501070_0000997 | 3300049586 | Bacteria | 25451 |
| 433 | Ga0501070_0184988 | 3300049586 | Bacteria | 1714 |
| 434 | Ga0501071_0384348 | 3300049587 | Bacteria | 1071 |
| 435 | Ga0501080_0075773 | 3300049742 | Bacteria | 3129 |
| 436 | Ga0501083_0452767 | 3300049744 | Bacteria | 835 |
| 437 | Ga0501035_0001107 | 3300049822 | Bacteria | 28241 |
| 438 | Ga0501035_0003647 | 3300049822 | Bacteria | 14685 |
| 439 | Ga0501035_0189832 | 3300049822 | Bacteria | 1767 |
| 440 | Ga0501044_0002461 | 3300049823 | Bacteria | 21119 |
| 441 | Ga0501044_0007204 | 3300049823 | Bacteria | 12234 |
| 442 | nmdc:mga03683_198595_c1 | 3300050489 | Bacteria | 920 |
| 443 | nmdc:mga03n38_104369_c1 | 3300050490 | Bacteria | 1371 |
| 444 | nmdc:mga03n38_384195_c1 | 3300050490 | Bacteria | 770 |
| 445 | nmdc:mga03n38_54731_c1 | 3300050490 | Bacteria | 1795 |
| 446 | nmdc:mga03n38_918066_c1 | 3300050490 | Bacteria | 515 |
| 447 | nmdc:mga00v17_3047_c1 | 3300050491 | Bacteria | 8615 |
| 448 | nmdc:mga00v17_52858_c1 | 3300050491 | Bacteria | 2474 |
| 449 | nmdc:mga00v17_53524_c1 | 3300050491 | Bacteria | 2460 |
| 450 | nmdc:mga0yw44_289735_c1 | 3300050492 | Bacteria | 1095 |
| 451 | nmdc:mga0qj67_3373_c1 | 3300050509 | Bacteria | 11523 |
| 452 | nmdc:mga08x19_44563_c2 | 3300050514 | Bacteria | 1545 |
| 453 | nmdc:mga0sz30_180086_c1 | 3300050516 | Bacteria | 938 |
| 454 | nmdc:mga0sz30_25009_c1 | 3300050516 | Bacteria | 2441 |
| 455 | nmdc:mga0sz30_262411_c1 | 3300050516 | Bacteria | 769 |
| 456 | nmdc:mga0sz30_71226_c1 | 3300050516 | Bacteria | 1497 |
| 457 | Ga0495655_0070605 | 3300053083 | Bacteria | 975 |
| 458 | Ga0500641_0062484 | 3300053096 | Bacteria | 1553 |
| 459 | Ga0500628_102184 | 3300053129 | Bacteria | 760 |
| 460 | Ga0500564_067843 | 3300053138 | Bacteria | 1612 |
| 461 | Ga0466962_0037035 | 3300061719 | Bacteria | 2335 |
| 462 | Ga0466962_0225257 | 3300061719 | Bacteria | 919 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005337 | Ga0070682_100136037 | Ga0070682_1001360373 | 97 |
| 2 | 3300005347 | Ga0070668_101782510 | Ga0070668_1017825101 | 104 |
| 3 | 3300009098 | Ga0105245_10735790 | Ga0105245_107357902 | 107 |
| 4 | 3300017792 | Ga0163161_10116169 | Ga0163161_101161692 | 107 |
| 5 | 3300041410 | Ga0439461_0010152 | Ga0439461_0010152_726_1064 | 112 |
| 6 | 3300041411 | Ga0439466_0007603 | Ga0439466_0007603_41_379 | 112 |
| 7 | 3300041413 | Ga0439465_0365165 | Ga0439465_0365165_198_536 | 112 |
| 8 | 3300041997 | Ga0439431_0007653 | Ga0439431_0007653_1996_2334 | 112 |
| 9 | 3300042435 | Ga0439434_0131017 | Ga0439434_0131017_37_375 | 112 |
| 10 | 3300005329 | Ga0070683_101175577 | Ga0070683_1011755772 | 115 |
| 11 | 3300025944 | Ga0207661_10900783 | Ga0207661_109007832 | 115 |
| 12 | iso_pu_bacteria | 2842134933 | 2842138727 | 115 |
| 13 | iso_pu_bacteria | 2738541264 | 2738667033 | 117 |
| 14 | iso_pu_bacteria | 2738541356 | 2739145877 | 117 |
| 15 | 3300044706 | Ga0466964_0674467 | Ga0466964_0674467_45_401 | 118 |
| 16 | 3300044901 | Ga0466960_0020341 | Ga0466960_0020341_196_552 | 118 |
| 17 | 3300045976 | Ga0466967_0029748 | Ga0466967_0029748_2673_3029 | 118 |
| 18 | iso_pu_bacteria | 2643221715 | 2644636086 | 118 |
| 19 | iso_pu_bacteria | 2902810491 | 2902815610 | 118 |
| 20 | 3300039437 | Ga0436365_0178124 | Ga0436365_0178124_13_372 | 119 |
| 21 | 3300039447 | Ga0436361_0753093 | Ga0436361_0753093_219_578 | 119 |
| 22 | 3300044684 | Ga0466966_0011171 | Ga0466966_0011171_1853_2212 | 119 |
| 23 | 3300044684 | Ga0466966_0039190 | Ga0466966_0039190_484_846 | 119 |
| 24 | 3300044693 | Ga0466961_0565349 | Ga0466961_0565349_25_384 | 119 |
| 25 | 3300044694 | Ga0466963_0199855 | Ga0466963_0199855_973_1332 | 119 |
| 26 | 3300044735 | Ga0466968_0003968 | Ga0466968_0003968_3126_3485 | 119 |
| 27 | 3300044842 | Ga0466957_0132479 | Ga0466957_0132479_277_636 | 119 |
| 28 | 3300045049 | Ga0466959_0011761 | Ga0466959_0011761_3326_3685 | 119 |
| 29 | 3300045836 | Ga0466958_0037989 | Ga0466958_0037989_306_665 | 119 |
| 30 | 3300049568 | Ga0501031_0203889 | Ga0501031_0203889_209_568 | 119 |
| 31 | 3300049569 | Ga0501032_0037168 | Ga0501032_0037168_2294_2653 | 119 |
| 32 | 3300049570 | Ga0501033_0116714 | Ga0501033_0116714_516_875 | 119 |
| 33 | 3300049571 | Ga0501034_0087568 | Ga0501034_0087568_2402_2761 | 119 |
| 34 | 3300049579 | Ga0501043_0064253 | Ga0501043_0064253_1073_1432 | 119 |
| 35 | 3300049580 | Ga0501046_0313473 | Ga0501046_0313473_439_798 | 119 |
| 36 | 3300049822 | Ga0501035_0001107 | Ga0501035_0001107_25493_25852 | 119 |
| 37 | 3300049823 | Ga0501044_0002461 | Ga0501044_0002461_3526_3885 | 119 |
| 38 | 3300001991 | JGI24743J22301_10027103 | JGI24743J22301_100271032 | 121 |
| 39 | 3300005327 | Ga0070658_10858120 | Ga0070658_108581202 | 121 |
| 40 | 3300005328 | Ga0070676_10033267 | Ga0070676_100332673 | 121 |
| 41 | 3300005330 | Ga0070690_100470793 | Ga0070690_1004707932 | 121 |
| 42 | 3300005334 | Ga0068869_100009416 | Ga0068869_1000094163 | 121 |
| 43 | 3300005334 | Ga0068869_100020065 | Ga0068869_1000200652 | 121 |
| 44 | 3300005335 | Ga0070666_10049377 | Ga0070666_100493773 | 121 |
| 45 | 3300005336 | Ga0070680_100381470 | Ga0070680_1003814702 | 121 |
| 46 | 3300005337 | Ga0070682_100077054 | Ga0070682_1000770543 | 121 |
| 47 | 3300005337 | Ga0070682_100256811 | Ga0070682_1002568112 | 121 |
| 48 | 3300005337 | Ga0070682_100825472 | Ga0070682_1008254722 | 121 |
| 49 | 3300005338 | Ga0068868_100053639 | Ga0068868_1000536393 | 121 |
| 50 | 3300005338 | Ga0068868_100296010 | Ga0068868_1002960102 | 121 |
| 51 | 3300005338 | Ga0068868_100607933 | Ga0068868_1006079331 | 121 |
| 52 | 3300005339 | Ga0070660_100435607 | Ga0070660_1004356072 | 121 |
| 53 | 3300005339 | Ga0070660_100940048 | Ga0070660_1009400482 | 121 |
| 54 | 3300005339 | Ga0070660_101672608 | Ga0070660_1016726082 | 121 |
| 55 | 3300005340 | Ga0070689_100097870 | Ga0070689_1000978703 | 121 |
| 56 | 3300005341 | Ga0070691_10260409 | Ga0070691_102604092 | 121 |
| 57 | 3300005343 | Ga0070687_100234556 | Ga0070687_1002345562 | 121 |
| 58 | 3300005344 | Ga0070661_100345554 | Ga0070661_1003455543 | 121 |
| 59 | 3300005345 | Ga0070692_10143410 | Ga0070692_101434103 | 121 |
| 60 | 3300005347 | Ga0070668_100016763 | Ga0070668_1000167636 | 121 |
| 61 | 3300005347 | Ga0070668_100023563 | Ga0070668_1000235632 | 121 |
| 62 | 3300005347 | Ga0070668_101522697 | Ga0070668_1015226972 | 121 |
| 63 | 3300005353 | Ga0070669_100079785 | Ga0070669_1000797853 | 121 |
| 64 | 3300005353 | Ga0070669_101260291 | Ga0070669_1012602912 | 121 |
| 65 | 3300005355 | Ga0070671_100058096 | Ga0070671_1000580963 | 121 |
| 66 | 3300005355 | Ga0070671_100106765 | Ga0070671_1001067653 | 121 |
| 67 | 3300005355 | Ga0070671_100533899 | Ga0070671_1005338992 | 121 |
| 68 | 3300005356 | Ga0070674_100008547 | Ga0070674_1000085476 | 121 |
| 69 | 3300005356 | Ga0070674_100084417 | Ga0070674_1000844173 | 121 |
| 70 | 3300005364 | Ga0070673_100316212 | Ga0070673_1003162123 | 121 |
| 71 | 3300005366 | Ga0070659_100325836 | Ga0070659_1003258363 | 121 |
| 72 | 3300005367 | Ga0070667_100000575 | Ga0070667_10000057524 | 121 |
| 73 | 3300005367 | Ga0070667_100017058 | Ga0070667_1000170583 | 121 |
| 74 | 3300005406 | Ga0070703_10077228 | Ga0070703_100772281 | 121 |
| 75 | 3300005434 | Ga0070709_10076185 | Ga0070709_100761852 | 121 |
| 76 | 3300005435 | Ga0070714_100109337 | Ga0070714_1001093373 | 121 |
| 77 | 3300005435 | Ga0070714_100397548 | Ga0070714_1003975481 | 121 |
| 78 | 3300005435 | Ga0070714_100782799 | Ga0070714_1007827992 | 121 |
| 79 | 3300005437 | Ga0070710_10000006 | Ga0070710_1000000660 | 121 |
| 80 | 3300005437 | Ga0070710_10019276 | Ga0070710_100192762 | 121 |
| 81 | 3300005438 | Ga0070701_10003068 | Ga0070701_100030684 | 121 |
| 82 | 3300005438 | Ga0070701_10804982 | Ga0070701_108049821 | 121 |
| 83 | 3300005439 | Ga0070711_100013993 | Ga0070711_1000139937 | 121 |
| 84 | 3300005440 | Ga0070705_100016007 | Ga0070705_1000160072 | 121 |
| 85 | 3300005441 | Ga0070700_100009961 | Ga0070700_1000099616 | 121 |
| 86 | 3300005441 | Ga0070700_100081420 | Ga0070700_1000814202 | 121 |
| 87 | 3300005444 | Ga0070694_100014253 | Ga0070694_1000142535 | 121 |
| 88 | 3300005455 | Ga0070663_100022386 | Ga0070663_1000223862 | 121 |
| 89 | 3300005455 | Ga0070663_100540327 | Ga0070663_1005403271 | 121 |
| 90 | 3300005456 | Ga0070678_100018013 | Ga0070678_1000180132 | 121 |
| 91 | 3300005457 | Ga0070662_100007272 | Ga0070662_1000072725 | 121 |
| 92 | 3300005459 | Ga0068867_100020053 | Ga0068867_1000200536 | 121 |
| 93 | 3300005466 | Ga0070685_10045947 | Ga0070685_100459474 | 121 |
| 94 | 3300005466 | Ga0070685_10548388 | Ga0070685_105483881 | 121 |
| 95 | 3300005535 | Ga0070684_100105969 | Ga0070684_1001059692 | 121 |
| 96 | 3300005539 | Ga0068853_100013403 | Ga0068853_1000134036 | 121 |
| 97 | 3300005543 | Ga0070672_100090621 | Ga0070672_1000906213 | 121 |
| 98 | 3300005545 | Ga0070695_100087957 | Ga0070695_1000879573 | 121 |
| 99 | 3300005546 | Ga0070696_100008478 | Ga0070696_1000084785 | 121 |
| 100 | 3300005547 | Ga0070693_100007808 | Ga0070693_1000078086 | 121 |
| 101 | 3300005548 | Ga0070665_100013490 | Ga0070665_1000134903 | 121 |
| 102 | 3300005548 | Ga0070665_100022862 | Ga0070665_1000228625 | 121 |
| 103 | 3300005548 | Ga0070665_100232284 | Ga0070665_1002322842 | 121 |
| 104 | 3300005548 | Ga0070665_100954876 | Ga0070665_1009548762 | 121 |
| 105 | 3300005549 | Ga0070704_100010033 | Ga0070704_1000100332 | 121 |
| 106 | 3300005549 | Ga0070704_100077254 | Ga0070704_1000772541 | 121 |
| 107 | 3300005563 | Ga0068855_100246237 | Ga0068855_1002462372 | 121 |
| 108 | 3300005563 | Ga0068855_100719529 | Ga0068855_1007195292 | 121 |
| 109 | 3300005578 | Ga0068854_100014496 | Ga0068854_1000144962 | 121 |
| 110 | 3300005578 | Ga0068854_100101811 | Ga0068854_1001018113 | 121 |
| 111 | 3300005614 | Ga0068856_100232684 | Ga0068856_1002326842 | 121 |
| 112 | 3300005614 | Ga0068856_101331389 | Ga0068856_1013313892 | 121 |
| 113 | 3300005615 | Ga0070702_100008967 | Ga0070702_1000089675 | 121 |
| 114 | 3300005615 | Ga0070702_100144013 | Ga0070702_1001440132 | 121 |
| 115 | 3300005616 | Ga0068852_100142630 | Ga0068852_1001426302 | 121 |
| 116 | 3300005616 | Ga0068852_101382447 | Ga0068852_1013824472 | 121 |
| 117 | 3300005616 | Ga0068852_101386141 | Ga0068852_1013861412 | 121 |
| 118 | 3300005617 | Ga0068859_100056548 | Ga0068859_1000565484 | 121 |
| 119 | 3300005617 | Ga0068859_100714256 | Ga0068859_1007142562 | 121 |
| 120 | 3300005617 | Ga0068859_102619478 | Ga0068859_1026194782 | 121 |
| 121 | 3300005618 | Ga0068864_100166701 | Ga0068864_1001667013 | 121 |
| 122 | 3300005618 | Ga0068864_100206973 | Ga0068864_1002069732 | 121 |
| 123 | 3300005618 | Ga0068864_100222939 | Ga0068864_1002229393 | 121 |
| 124 | 3300005718 | Ga0068866_10002254 | Ga0068866_100022549 | 121 |
| 125 | 3300005719 | Ga0068861_100015153 | Ga0068861_1000151533 | 121 |
| 126 | 3300005719 | Ga0068861_100113456 | Ga0068861_1001134562 | 121 |
| 127 | 3300005841 | Ga0068863_100236845 | Ga0068863_1002368452 | 121 |
| 128 | 3300005841 | Ga0068863_100908690 | Ga0068863_1009086903 | 121 |
| 129 | 3300005842 | Ga0068858_100022398 | Ga0068858_1000223983 | 121 |
| 130 | 3300005842 | Ga0068858_100038340 | Ga0068858_1000383405 | 121 |
| 131 | 3300005842 | Ga0068858_100350196 | Ga0068858_1003501962 | 121 |
| 132 | 3300005842 | Ga0068858_100367182 | Ga0068858_1003671822 | 121 |
| 133 | 3300005843 | Ga0068860_100002358 | Ga0068860_10000235822 | 121 |
| 134 | 3300005843 | Ga0068860_100243511 | Ga0068860_1002435112 | 121 |
| 135 | 3300005843 | Ga0068860_101220194 | Ga0068860_1012201942 | 121 |
| 136 | 3300005844 | Ga0068862_100101274 | Ga0068862_1001012743 | 121 |
| 137 | 3300005937 | Ga0081455_10062573 | Ga0081455_100625733 | 121 |
| 138 | 3300005937 | Ga0081455_10267740 | Ga0081455_102677402 | 121 |
| 139 | 3300006028 | Ga0070717_10916049 | Ga0070717_109160491 | 121 |
| 140 | 3300006038 | Ga0075365_10178525 | Ga0075365_101785252 | 121 |
| 141 | 3300006048 | Ga0075363_100007442 | Ga0075363_1000074422 | 121 |
| 142 | 3300006048 | Ga0075363_100025630 | Ga0075363_1000256303 | 121 |
| 143 | 3300006048 | Ga0075363_100043050 | Ga0075363_1000430503 | 121 |
| 144 | 3300006051 | Ga0075364_10078752 | Ga0075364_100787522 | 121 |
| 145 | 3300006051 | Ga0075364_10105630 | Ga0075364_101056302 | 121 |
| 146 | 3300006051 | Ga0075364_10311027 | Ga0075364_103110272 | 121 |
| 147 | 3300006163 | Ga0070715_10024734 | Ga0070715_100247342 | 121 |
| 148 | 3300006163 | Ga0070715_10764253 | Ga0070715_107642532 | 121 |
| 149 | 3300006175 | Ga0070712_100012405 | Ga0070712_1000124053 | 121 |
| 150 | 3300006177 | Ga0075362_10130245 | Ga0075362_101302452 | 121 |
| 151 | 3300006186 | Ga0075369_10021031 | Ga0075369_100210311 | 121 |
| 152 | 3300006186 | Ga0075369_10237860 | Ga0075369_102378602 | 121 |
| 153 | 3300006186 | Ga0075369_10249964 | Ga0075369_102499641 | 121 |
| 154 | 3300006186 | Ga0075369_10390356 | Ga0075369_103903561 | 121 |
| 155 | 3300006195 | Ga0075366_10578183 | Ga0075366_105781831 | 121 |
| 156 | 3300006237 | Ga0097621_100299974 | Ga0097621_1002999742 | 121 |
| 157 | 3300006353 | Ga0075370_10050140 | Ga0075370_100501402 | 121 |
| 158 | 3300006358 | Ga0068871_100049118 | Ga0068871_1000491184 | 121 |
| 159 | 3300006846 | Ga0075430_100000964 | Ga0075430_1000009649 | 121 |
| 160 | 3300006881 | Ga0068865_100012553 | Ga0068865_1000125535 | 121 |
| 161 | 3300006881 | Ga0068865_101271006 | Ga0068865_1012710062 | 121 |
| 162 | 3300006914 | Ga0075436_100083089 | Ga0075436_1000830893 | 121 |
| 163 | 3300006931 | Ga0097620_100056548 | Ga0097620_1000565482 | 121 |
| 164 | 3300006931 | Ga0097620_100714271 | Ga0097620_1007142712 | 121 |
| 165 | 3300006931 | Ga0097620_102619502 | Ga0097620_1026195022 | 121 |
| 166 | 3300009092 | Ga0105250_10370475 | Ga0105250_103704752 | 121 |
| 167 | 3300009098 | Ga0105245_10024085 | Ga0105245_100240853 | 121 |
| 168 | 3300009098 | Ga0105245_11746045 | Ga0105245_117460452 | 121 |
| 169 | 3300009101 | Ga0105247_10001532 | Ga0105247_100015325 | 121 |
| 170 | 3300009148 | Ga0105243_10001339 | Ga0105243_1000133922 | 121 |
| 171 | 3300009148 | Ga0105243_10243443 | Ga0105243_102434432 | 121 |
| 172 | 3300009174 | Ga0105241_10210002 | Ga0105241_102100022 | 121 |
| 173 | 3300009176 | Ga0105242_10001137 | Ga0105242_1000113721 | 121 |
| 174 | 3300009177 | Ga0105248_10031352 | Ga0105248_100313521 | 121 |
| 175 | 3300009177 | Ga0105248_10202401 | Ga0105248_102024012 | 121 |
| 176 | 3300009545 | Ga0105237_10003521 | Ga0105237_100035216 | 121 |
| 177 | 3300009545 | Ga0105237_10130961 | Ga0105237_101309613 | 121 |
| 178 | 3300009545 | Ga0105237_10305466 | Ga0105237_103054663 | 121 |
| 179 | 3300009551 | Ga0105238_10334516 | Ga0105238_103345162 | 121 |
| 180 | 3300009551 | Ga0105238_10403515 | Ga0105238_104035151 | 121 |
| 181 | 3300010375 | Ga0105239_10002436 | Ga0105239_100024366 | 121 |
| 182 | 3300010375 | Ga0105239_10182902 | Ga0105239_101829022 | 121 |
| 183 | 3300010375 | Ga0105239_11159399 | Ga0105239_111593992 | 121 |
| 184 | 3300013296 | Ga0157374_10108636 | Ga0157374_101086362 | 121 |
| 185 | 3300013297 | Ga0157378_10020735 | Ga0157378_100207353 | 121 |
| 186 | 3300013297 | Ga0157378_11070713 | Ga0157378_110707132 | 121 |
| 187 | 3300013306 | Ga0163162_10007394 | Ga0163162_1000739410 | 121 |
| 188 | 3300013306 | Ga0163162_10066606 | Ga0163162_100666064 | 121 |
| 189 | 3300013306 | Ga0163162_10856903 | Ga0163162_108569032 | 121 |
| 190 | 3300013307 | Ga0157372_10002210 | Ga0157372_100022105 | 121 |
| 191 | 3300013307 | Ga0157372_10381786 | Ga0157372_103817863 | 121 |
| 192 | 3300013308 | Ga0157375_10309208 | Ga0157375_103092082 | 121 |
| 193 | 3300014325 | Ga0163163_10113994 | Ga0163163_101139942 | 121 |
| 194 | 3300014325 | Ga0163163_10138458 | Ga0163163_101384582 | 121 |
| 195 | 3300014325 | Ga0163163_11064702 | Ga0163163_110647022 | 121 |
| 196 | 3300014325 | Ga0163163_12349646 | Ga0163163_123496462 | 121 |
| 197 | 3300014326 | Ga0157380_10000872 | Ga0157380_1000087221 | 121 |
| 198 | 3300014326 | Ga0157380_11868020 | Ga0157380_118680202 | 121 |
| 199 | 3300014968 | Ga0157379_10068539 | Ga0157379_100685393 | 121 |
| 200 | 3300017792 | Ga0163161_10040330 | Ga0163161_100403303 | 121 |
| 201 | 3300017792 | Ga0163161_10078644 | Ga0163161_100786443 | 121 |
| 202 | 3300021384 | Ga0213876_10002160 | Ga0213876_1000216010 | 121 |
| 203 | 3300021384 | Ga0213876_10029767 | Ga0213876_100297674 | 121 |
| 204 | 3300021388 | Ga0213875_10014627 | Ga0213875_100146275 | 121 |
| 205 | 3300021388 | Ga0213875_10183906 | Ga0213875_101839062 | 121 |
| 206 | 3300025303 | Ga0209051_1000011 | Ga0209051_1000011524 | 121 |
| 207 | 3300025898 | Ga0207692_10000001 | Ga0207692_10000001171 | 121 |
| 208 | 3300025898 | Ga0207692_10006171 | Ga0207692_100061716 | 121 |
| 209 | 3300025899 | Ga0207642_10063431 | Ga0207642_100634313 | 121 |
| 210 | 3300025900 | Ga0207710_10006688 | Ga0207710_100066885 | 121 |
| 211 | 3300025900 | Ga0207710_10180275 | Ga0207710_101802752 | 121 |
| 212 | 3300025901 | Ga0207688_10002449 | Ga0207688_100024495 | 121 |
| 213 | 3300025901 | Ga0207688_10011076 | Ga0207688_100110764 | 121 |
| 214 | 3300025903 | Ga0207680_10168104 | Ga0207680_101681043 | 121 |
| 215 | 3300025904 | Ga0207647_10450372 | Ga0207647_104503722 | 121 |
| 216 | 3300025905 | Ga0207685_10065838 | Ga0207685_100658383 | 121 |
| 217 | 3300025906 | Ga0207699_10037765 | Ga0207699_100377653 | 121 |
| 218 | 3300025907 | Ga0207645_10065175 | Ga0207645_100651752 | 121 |
| 219 | 3300025911 | Ga0207654_10046715 | Ga0207654_100467153 | 121 |
| 220 | 3300025914 | Ga0207671_10003916 | Ga0207671_100039166 | 121 |
| 221 | 3300025914 | Ga0207671_10070012 | Ga0207671_100700122 | 121 |
| 222 | 3300025914 | Ga0207671_10092672 | Ga0207671_100926722 | 121 |
| 223 | 3300025915 | Ga0207693_10001549 | Ga0207693_1000154921 | 121 |
| 224 | 3300025916 | Ga0207663_10146908 | Ga0207663_101469082 | 121 |
| 225 | 3300025918 | Ga0207662_10027386 | Ga0207662_100273863 | 121 |
| 226 | 3300025919 | Ga0207657_10160163 | Ga0207657_101601632 | 121 |
| 227 | 3300025919 | Ga0207657_10166933 | Ga0207657_101669332 | 121 |
| 228 | 3300025920 | Ga0207649_10162306 | Ga0207649_101623063 | 121 |
| 229 | 3300025923 | Ga0207681_10186617 | Ga0207681_101866173 | 121 |
| 230 | 3300025924 | Ga0207694_10495250 | Ga0207694_104952502 | 121 |
| 231 | 3300025926 | Ga0207659_11188640 | Ga0207659_111886402 | 121 |
| 232 | 3300025927 | Ga0207687_10049507 | Ga0207687_100495073 | 121 |
| 233 | 3300025927 | Ga0207687_10556773 | Ga0207687_105567732 | 121 |
| 234 | 3300025929 | Ga0207664_10720414 | Ga0207664_107204141 | 121 |
| 235 | 3300025931 | Ga0207644_10094984 | Ga0207644_100949843 | 121 |
| 236 | 3300025931 | Ga0207644_10369891 | Ga0207644_103698912 | 121 |
| 237 | 3300025932 | Ga0207690_10047730 | Ga0207690_100477302 | 121 |
| 238 | 3300025932 | Ga0207690_10072433 | Ga0207690_100724332 | 121 |
| 239 | 3300025933 | Ga0207706_10011686 | Ga0207706_100116869 | 121 |
| 240 | 3300025934 | Ga0207686_10011133 | Ga0207686_100111336 | 121 |
| 241 | 3300025935 | Ga0207709_10214847 | Ga0207709_102148472 | 121 |
| 242 | 3300025935 | Ga0207709_10567450 | Ga0207709_105674502 | 121 |
| 243 | 3300025936 | Ga0207670_10110960 | Ga0207670_101109602 | 121 |
| 244 | 3300025937 | Ga0207669_10006074 | Ga0207669_100060743 | 121 |
| 245 | 3300025938 | Ga0207704_10049898 | Ga0207704_100498983 | 121 |
| 246 | 3300025939 | Ga0207665_10029016 | Ga0207665_100290163 | 121 |
| 247 | 3300025940 | Ga0207691_10078655 | Ga0207691_100786553 | 121 |
| 248 | 3300025940 | Ga0207691_10153743 | Ga0207691_101537432 | 121 |
| 249 | 3300025942 | Ga0207689_10081304 | Ga0207689_100813042 | 121 |
| 250 | 3300025942 | Ga0207689_10529024 | Ga0207689_105290242 | 121 |
| 251 | 3300025949 | Ga0207667_10264810 | Ga0207667_102648103 | 121 |
| 252 | 3300025949 | Ga0207667_10319156 | Ga0207667_103191562 | 121 |
| 253 | 3300025961 | Ga0207712_10029176 | Ga0207712_100291762 | 121 |
| 254 | 3300025972 | Ga0207668_10010485 | Ga0207668_100104855 | 121 |
| 255 | 3300025972 | Ga0207668_10083815 | Ga0207668_100838152 | 121 |
| 256 | 3300025972 | Ga0207668_10264062 | Ga0207668_102640622 | 121 |
| 257 | 3300025981 | Ga0207640_10088097 | Ga0207640_100880972 | 121 |
| 258 | 3300025981 | Ga0207640_10439457 | Ga0207640_104394571 | 121 |
| 259 | 3300025986 | Ga0207658_10000502 | Ga0207658_1000050225 | 121 |
| 260 | 3300025986 | Ga0207658_10005441 | Ga0207658_100054417 | 121 |
| 261 | 3300025986 | Ga0207658_10022924 | Ga0207658_100229242 | 121 |
| 262 | 3300025986 | Ga0207658_10880503 | Ga0207658_108805031 | 121 |
| 263 | 3300026023 | Ga0207677_10563127 | Ga0207677_105631272 | 121 |
| 264 | 3300026035 | Ga0207703_10033427 | Ga0207703_100334272 | 121 |
| 265 | 3300026035 | Ga0207703_10501669 | Ga0207703_105016692 | 121 |
| 266 | 3300026041 | Ga0207639_10035174 | Ga0207639_100351745 | 121 |
| 267 | 3300026041 | Ga0207639_10092211 | Ga0207639_100922112 | 121 |
| 268 | 3300026041 | Ga0207639_10401443 | Ga0207639_104014432 | 121 |
| 269 | 3300026067 | Ga0207678_10014268 | Ga0207678_100142684 | 121 |
| 270 | 3300026067 | Ga0207678_10025578 | Ga0207678_100255787 | 121 |
| 271 | 3300026067 | Ga0207678_10724158 | Ga0207678_107241582 | 121 |
| 272 | 3300026075 | Ga0207708_10002852 | Ga0207708_1000285211 | 121 |
| 273 | 3300026075 | Ga0207708_10025987 | Ga0207708_100259873 | 121 |
| 274 | 3300026078 | Ga0207702_10183454 | Ga0207702_101834543 | 121 |
| 275 | 3300026078 | Ga0207702_10295142 | Ga0207702_102951422 | 121 |
| 276 | 3300026078 | Ga0207702_10369359 | Ga0207702_103693592 | 121 |
| 277 | 3300026088 | Ga0207641_10050338 | Ga0207641_100503382 | 121 |
| 278 | 3300026088 | Ga0207641_11338147 | Ga0207641_113381471 | 121 |
| 279 | 3300026089 | Ga0207648_10007000 | Ga0207648_1000700010 | 121 |
| 280 | 3300026089 | Ga0207648_10045017 | Ga0207648_100450174 | 121 |
| 281 | 3300026095 | Ga0207676_10277931 | Ga0207676_102779312 | 121 |
| 282 | 3300026095 | Ga0207676_10588823 | Ga0207676_105888232 | 121 |
| 283 | 3300026118 | Ga0207675_100027425 | Ga0207675_1000274252 | 121 |
| 284 | 3300026118 | Ga0207675_100030175 | Ga0207675_1000301753 | 121 |
| 285 | 3300026121 | Ga0207683_10023585 | Ga0207683_100235856 | 121 |
| 286 | 3300026142 | Ga0207698_10623556 | Ga0207698_106235562 | 121 |
| 287 | 3300028379 | Ga0268266_10018695 | Ga0268266_100186954 | 121 |
| 288 | 3300028379 | Ga0268266_10035140 | Ga0268266_100351404 | 121 |
| 289 | 3300028379 | Ga0268266_10041000 | Ga0268266_100410003 | 121 |
| 290 | 3300028379 | Ga0268266_11186567 | Ga0268266_111865672 | 121 |
| 291 | 3300028381 | Ga0268264_10015366 | Ga0268264_100153666 | 121 |
| 292 | 3300031251 | Ga0265327_10004178 | Ga0265327_100041785 | 121 |
| 293 | 3300031251 | Ga0265327_10116176 | Ga0265327_101161762 | 121 |
| 294 | 3300031731 | Ga0307405_10445095 | Ga0307405_104450952 | 121 |
| 295 | 3300031901 | Ga0307406_10157530 | Ga0307406_101575303 | 121 |
| 296 | 3300031901 | Ga0307406_10644599 | Ga0307406_106445992 | 121 |
| 297 | 3300031995 | Ga0307409_102083321 | Ga0307409_1020833212 | 121 |
| 298 | 3300035084 | Ga0373928_0086032 | Ga0373928_0086032_220_585 | 121 |
| 299 | 3300035090 | Ga0373949_0065654 | Ga0373949_0065654_300_665 | 121 |
| 300 | 3300035114 | Ga0373939_0140991 | Ga0373939_0140991_94_459 | 121 |
| 301 | 3300035170 | Ga0373943_0253535 | Ga0373943_0253535_426_791 | 121 |
| 302 | 3300035171 | Ga0373946_0015962 | Ga0373946_0015962_391_756 | 121 |
| 303 | 3300035691 | Ga0373931_0193947 | Ga0373931_0193947_10_375 | 121 |
| 304 | 3300037853 | Ga0436364_0288923 | Ga0436364_0288923_1855_2220 | 121 |
| 305 | 3300037853 | Ga0436364_1154307 | Ga0436364_1154307_101_466 | 121 |
| 306 | 3300038443 | Ga0395901_2084143 | Ga0395901_2084143_18_383 | 121 |
| 307 | 3300039437 | Ga0436365_0307061 | Ga0436365_0307061_3995_4363 | 121 |
| 308 | 3300039437 | Ga0436365_1376337 | Ga0436365_1376337_1834_2217 | 121 |
| 309 | 3300039437 | Ga0436365_1909980 | Ga0436365_1909980_12252_12617 | 121 |
| 310 | 3300039438 | Ga0436360_1064439 | Ga0436360_1064439_20_403 | 121 |
| 311 | 3300041460 | Ga0451802_1256245 | Ga0451802_1256245_65_433 | 121 |
| 312 | 3300041512 | Ga0451853_2731377 | Ga0451853_2731377_316_684 | 121 |
| 313 | 3300042438 | Ga0439459_0026672 | Ga0439459_0026672_680_1048 | 121 |
| 314 | 3300044658 | Ga0466972_0092997 | Ga0466972_0092997_884_1252 | 121 |
| 315 | 3300044683 | Ga0466965_0012931 | Ga0466965_0012931_1668_2033 | 121 |
| 316 | 3300044683 | Ga0466965_0014166 | Ga0466965_0014166_2153_2521 | 121 |
| 317 | 3300044683 | Ga0466965_0034794 | Ga0466965_0034794_2070_2435 | 121 |
| 318 | 3300044684 | Ga0466966_0068359 | Ga0466966_0068359_572_937 | 121 |
| 319 | 3300044684 | Ga0466966_0927083 | Ga0466966_0927083_16_399 | 121 |
| 320 | 3300044693 | Ga0466961_0018993 | Ga0466961_0018993_396_761 | 121 |
| 321 | 3300044694 | Ga0466963_0157420 | Ga0466963_0157420_626_994 | 121 |
| 322 | 3300044694 | Ga0466963_0212472 | Ga0466963_0212472_390_773 | 121 |
| 323 | 3300044706 | Ga0466964_0293504 | Ga0466964_0293504_25_408 | 121 |
| 324 | 3300044706 | Ga0466964_0525551 | Ga0466964_0525551_204_587 | 121 |
| 325 | 3300044719 | Ga0466971_0039549 | Ga0466971_0039549_741_1106 | 121 |
| 326 | 3300044719 | Ga0466971_0100659 | Ga0466971_0100659_310_693 | 121 |
| 327 | 3300044735 | Ga0466968_0092057 | Ga0466968_0092057_756_1121 | 121 |
| 328 | 3300044735 | Ga0466968_0124083 | Ga0466968_0124083_192_560 | 121 |
| 329 | 3300044765 | Ga0466970_0020656 | Ga0466970_0020656_1955_2320 | 121 |
| 330 | 3300044842 | Ga0466957_0006220 | Ga0466957_0006220_1174_1557 | 121 |
| 331 | 3300044842 | Ga0466957_0006518 | Ga0466957_0006518_5010_5378 | 121 |
| 332 | 3300044842 | Ga0466957_0020545 | Ga0466957_0020545_2522_2887 | 121 |
| 333 | 3300044901 | Ga0466960_0000760 | Ga0466960_0000760_6203_6568 | 121 |
| 334 | 3300044901 | Ga0466960_0010837 | Ga0466960_0010837_2622_2990 | 121 |
| 335 | 3300044901 | Ga0466960_0094756 | Ga0466960_0094756_91_474 | 121 |
| 336 | 3300045049 | Ga0466959_0003950 | Ga0466959_0003950_1764_2129 | 121 |
| 337 | 3300045049 | Ga0466959_0027140 | Ga0466959_0027140_1566_1934 | 121 |
| 338 | 3300045049 | Ga0466959_0399854 | Ga0466959_0399854_170_535 | 121 |
| 339 | 3300045836 | Ga0466958_0242184 | Ga0466958_0242184_192_557 | 121 |
| 340 | 3300045836 | Ga0466958_0253826 | Ga0466958_0253826_698_1066 | 121 |
| 341 | 3300045836 | Ga0466958_0474409 | Ga0466958_0474409_113_496 | 121 |
| 342 | 3300045976 | Ga0466967_0052607 | Ga0466967_0052607_1341_1724 | 121 |
| 343 | 3300045976 | Ga0466967_0119962 | Ga0466967_0119962_1621_1989 | 121 |
| 344 | 3300045976 | Ga0466967_1045381 | Ga0466967_1045381_26_391 | 121 |
| 345 | 3300046455 | Ga0495603_0129947 | Ga0495603_0129947_551_916 | 121 |
| 346 | 3300046499 | Ga0495594_0266232 | Ga0495594_0266232_551_916 | 121 |
| 347 | 3300046506 | Ga0495583_0118648 | Ga0495583_0118648_237_602 | 121 |
| 348 | 3300046524 | Ga0495648_0031589 | Ga0495648_0031589_1131_1496 | 121 |
| 349 | 3300046530 | Ga0495654_0149874 | Ga0495654_0149874_434_799 | 121 |
| 350 | 3300046616 | Ga0495668_0053941 | Ga0495668_0053941_1846_2211 | 121 |
| 351 | 3300046648 | Ga0495611_0138319 | Ga0495611_0138319_159_524 | 121 |
| 352 | 3300046690 | Ga0495624_0212034 | Ga0495624_0212034_696_1061 | 121 |
| 353 | 3300046694 | Ga0495649_0258037 | Ga0495649_0258037_295_663 | 121 |
| 354 | 3300047469 | Ga0495673_0000444 | Ga0495673_0000444_35456_35821 | 121 |
| 355 | 3300048903 | Ga0496100_0000327 | Ga0496100_0000327_4190_4555 | 121 |
| 356 | 3300048903 | Ga0496100_0358049 | Ga0496100_0358049_553_918 | 121 |
| 357 | 3300048903 | Ga0496100_0982142 | Ga0496100_0982142_71_436 | 121 |
| 358 | 3300048904 | Ga0496101_0000549 | Ga0496101_0000549_6036_6401 | 121 |
| 359 | 3300048905 | Ga0496102_0016753 | Ga0496102_0016753_707_1072 | 121 |
| 360 | 3300048905 | Ga0496102_0028569 | Ga0496102_0028569_922_1287 | 121 |
| 361 | 3300048905 | Ga0496102_0029642 | Ga0496102_0029642_290_655 | 121 |
| 362 | 3300048905 | Ga0496102_0068195 | Ga0496102_0068195_223_591 | 121 |
| 363 | 3300048905 | Ga0496102_0171237 | Ga0496102_0171237_1404_1769 | 121 |
| 364 | 3300048905 | Ga0496102_0208489 | Ga0496102_0208489_33_398 | 121 |
| 365 | 3300048905 | Ga0496102_0266732 | Ga0496102_0266732_125_490 | 121 |
| 366 | 3300048905 | Ga0496102_0405671 | Ga0496102_0405671_152_520 | 121 |
| 367 | 3300048906 | Ga0496103_0000946 | Ga0496103_0000946_18629_18994 | 121 |
| 368 | 3300048906 | Ga0496103_0027965 | Ga0496103_0027965_1030_1395 | 121 |
| 369 | 3300048906 | Ga0496103_0129328 | Ga0496103_0129328_946_1311 | 121 |
| 370 | 3300048906 | Ga0496103_0244493 | Ga0496103_0244493_105_470 | 121 |
| 371 | 3300048907 | Ga0496104_0036803 | Ga0496104_0036803_1031_1396 | 121 |
| 372 | 3300048907 | Ga0496104_0046516 | Ga0496104_0046516_3164_3529 | 121 |
| 373 | 3300048907 | Ga0496104_0823323 | Ga0496104_0823323_392_757 | 121 |
| 374 | 3300048907 | Ga0496104_0826806 | Ga0496104_0826806_346_711 | 121 |
| 375 | 3300048909 | Ga0496106_0002484 | Ga0496106_0002484_5875_6240 | 121 |
| 376 | 3300048909 | Ga0496106_0015537 | Ga0496106_0015537_1534_1899 | 121 |
| 377 | 3300048909 | Ga0496106_0510148 | Ga0496106_0510148_38_406 | 121 |
| 378 | 3300048909 | Ga0496106_1220193 | Ga0496106_1220193_110_475 | 121 |
| 379 | 3300048910 | Ga0496107_0000464 | Ga0496107_0000464_4949_5314 | 121 |
| 380 | 3300048910 | Ga0496107_0019519 | Ga0496107_0019519_3829_4194 | 121 |
| 381 | 3300048911 | Ga0496108_0004778 | Ga0496108_0004778_4655_5020 | 121 |
| 382 | 3300048911 | Ga0496108_0008786 | Ga0496108_0008786_259_624 | 121 |
| 383 | 3300048911 | Ga0496108_0076787 | Ga0496108_0076787_924_1292 | 121 |
| 384 | 3300048911 | Ga0496108_0076965 | Ga0496108_0076965_52_417 | 121 |
| 385 | 3300048911 | Ga0496108_0272923 | Ga0496108_0272923_384_752 | 121 |
| 386 | 3300048911 | Ga0496108_0450754 | Ga0496108_0450754_502_867 | 121 |
| 387 | 3300048912 | Ga0496109_0000706 | Ga0496109_0000706_6047_6412 | 121 |
| 388 | 3300048912 | Ga0496109_0007281 | Ga0496109_0007281_4097_4462 | 121 |
| 389 | 3300048912 | Ga0496109_0073093 | Ga0496109_0073093_87_455 | 121 |
| 390 | 3300048912 | Ga0496109_0096999 | Ga0496109_0096999_2105_2473 | 121 |
| 391 | 3300048912 | Ga0496109_0412045 | Ga0496109_0412045_803_1168 | 121 |
| 392 | 3300048913 | Ga0496110_0001610 | Ga0496110_0001610_5227_5592 | 121 |
| 393 | 3300048913 | Ga0496110_0107539 | Ga0496110_0107539_937_1305 | 121 |
| 394 | 3300048913 | Ga0496110_0294816 | Ga0496110_0294816_675_1040 | 121 |
| 395 | 3300048913 | Ga0496110_0805374 | Ga0496110_0805374_179_544 | 121 |
| 396 | 3300048914 | Ga0496111_0007247 | Ga0496111_0007247_5962_6327 | 121 |
| 397 | 3300048914 | Ga0496111_0397558 | Ga0496111_0397558_65_430 | 121 |
| 398 | 3300048914 | Ga0496111_1044832 | Ga0496111_1044832_87_452 | 121 |
| 399 | 3300048915 | Ga0496112_0307867 | Ga0496112_0307867_483_851 | 121 |
| 400 | 3300048915 | Ga0496112_0509662 | Ga0496112_0509662_400_765 | 121 |
| 401 | 3300048916 | Ga0496113_0143190 | Ga0496113_0143190_1423_1788 | 121 |
| 402 | 3300048916 | Ga0496113_0255197 | Ga0496113_0255197_86_454 | 121 |
| 403 | 3300048917 | Ga0496114_0000774 | Ga0496114_0000774_16952_17317 | 121 |
| 404 | 3300048917 | Ga0496114_0098795 | Ga0496114_0098795_1565_1930 | 121 |
| 405 | 3300048917 | Ga0496114_0108019 | Ga0496114_0108019_1327_1701 | 121 |
| 406 | 3300048917 | Ga0496114_0888857 | Ga0496114_0888857_232_597 | 121 |
| 407 | 3300048917 | Ga0496114_1038437 | Ga0496114_1038437_43_411 | 121 |
| 408 | 3300048917 | Ga0496114_1104748 | Ga0496114_1104748_268_633 | 121 |
| 409 | 3300048918 | Ga0496115_0007319 | Ga0496115_0007319_6264_6629 | 121 |
| 410 | 3300048918 | Ga0496115_0352603 | Ga0496115_0352603_312_686 | 121 |
| 411 | 3300048919 | Ga0496116_0003582 | Ga0496116_0003582_10934_11299 | 121 |
| 412 | 3300048920 | Ga0496117_0016974 | Ga0496117_0016974_1390_1755 | 121 |
| 413 | 3300048920 | Ga0496117_0061525 | Ga0496117_0061525_2060_2428 | 121 |
| 414 | 3300048921 | Ga0496118_0000595 | Ga0496118_0000595_10233_10601 | 121 |
| 415 | 3300048921 | Ga0496118_0017436 | Ga0496118_0017436_835_1200 | 121 |
| 416 | 3300048921 | Ga0496118_0351824 | Ga0496118_0351824_205_570 | 121 |
| 417 | 3300048922 | Ga0496119_0003009 | Ga0496119_0003009_11481_11846 | 121 |
| 418 | 3300048923 | Ga0496120_0045432 | Ga0496120_0045432_187_552 | 121 |
| 419 | 3300048924 | Ga0496121_0000016 | Ga0496121_0000016_281680_282045 | 121 |
| 420 | 3300048925 | Ga0496122_0002739 | Ga0496122_0002739_19809_20174 | 121 |
| 421 | 3300048927 | Ga0496124_0000015 | Ga0496124_0000015_96345_96710 | 121 |
| 422 | 3300048928 | Ga0496125_0000021 | Ga0496125_0000021_363991_364356 | 121 |
| 423 | 3300048929 | Ga0496126_0000015 | Ga0496126_0000015_363991_364356 | 121 |
| 424 | 3300048929 | Ga0496126_0001911 | Ga0496126_0001911_1204_1578 | 121 |
| 425 | 3300049568 | Ga0501031_0659521 | Ga0501031_0659521_224_607 | 121 |
| 426 | 3300049569 | Ga0501032_0175602 | Ga0501032_0175602_143_526 | 121 |
| 427 | 3300049569 | Ga0501032_0387522 | Ga0501032_0387522_140_508 | 121 |
| 428 | 3300049570 | Ga0501033_0017450 | Ga0501033_0017450_2874_3257 | 121 |
| 429 | 3300049571 | Ga0501034_0007092 | Ga0501034_0007092_8588_8971 | 121 |
| 430 | 3300049572 | Ga0501036_0145140 | Ga0501036_0145140_118_501 | 121 |
| 431 | 3300049573 | Ga0501037_0044362 | Ga0501037_0044362_1436_1819 | 121 |
| 432 | 3300049579 | Ga0501043_0038751 | Ga0501043_0038751_1305_1688 | 121 |
| 433 | 3300049580 | Ga0501046_0002772 | Ga0501046_0002772_15198_15581 | 121 |
| 434 | 3300049581 | Ga0501047_0002519 | Ga0501047_0002519_1511_1894 | 121 |
| 435 | 3300049581 | Ga0501047_0739395 | Ga0501047_0739395_121_489 | 121 |
| 436 | 3300049582 | Ga0501048_0017886 | Ga0501048_0017886_1215_1598 | 121 |
| 437 | 3300049582 | Ga0501048_0663669 | Ga0501048_0663669_162_530 | 121 |
| 438 | 3300049585 | Ga0501069_0020640 | Ga0501069_0020640_280_663 | 121 |
| 439 | 3300049586 | Ga0501070_0000997 | Ga0501070_0000997_23750_24133 | 121 |
| 440 | 3300049586 | Ga0501070_0184988 | Ga0501070_0184988_426_794 | 121 |
| 441 | 3300049587 | Ga0501071_0384348 | Ga0501071_0384348_290_673 | 121 |
| 442 | 3300049742 | Ga0501080_0075773 | Ga0501080_0075773_2123_2506 | 121 |
| 443 | 3300049744 | Ga0501083_0452767 | Ga0501083_0452767_185_568 | 121 |
| 444 | 3300049822 | Ga0501035_0003647 | Ga0501035_0003647_5434_5817 | 121 |
| 445 | 3300049822 | Ga0501035_0189832 | Ga0501035_0189832_1231_1599 | 121 |
| 446 | 3300049823 | Ga0501044_0007204 | Ga0501044_0007204_2222_2605 | 121 |
| 447 | 3300050489 | nmdc:mga03683_198595_c1 | nmdc:mga03683_198595_c1_269_634 | 121 |
| 448 | 3300050490 | nmdc:mga03n38_104369_c1 | nmdc:mga03n38_104369_c1_363_731 | 121 |
| 449 | 3300050490 | nmdc:mga03n38_384195_c1 | nmdc:mga03n38_384195_c1_20_385 | 121 |
| 450 | 3300050490 | nmdc:mga03n38_54731_c1 | nmdc:mga03n38_54731_c1_13_381 | 121 |
| 451 | 3300050490 | nmdc:mga03n38_918066_c1 | nmdc:mga03n38_918066_c1_132_497 | 121 |
| 452 | 3300050491 | nmdc:mga00v17_3047_c1 | nmdc:mga00v17_3047_c1_458_826 | 121 |
| 453 | 3300050491 | nmdc:mga00v17_52858_c1 | nmdc:mga00v17_52858_c1_2052_2426 | 121 |
| 454 | 3300050491 | nmdc:mga00v17_53524_c1 | nmdc:mga00v17_53524_c1_2049_2414 | 121 |
| 455 | 3300050492 | nmdc:mga0yw44_289735_c1 | nmdc:mga0yw44_289735_c1_546_911 | 121 |
| 456 | 3300050509 | nmdc:mga0qj67_3373_c1 | nmdc:mga0qj67_3373_c1_4353_4733 | 121 |
| 457 | 3300050514 | nmdc:mga08x19_44563_c2 | nmdc:mga08x19_44563_c2_501_866 | 121 |
| 458 | 3300050516 | nmdc:mga0sz30_180086_c1 | nmdc:mga0sz30_180086_c1_43_408 | 121 |
| 459 | 3300050516 | nmdc:mga0sz30_25009_c1 | nmdc:mga0sz30_25009_c1_1483_1851 | 121 |
| 460 | 3300050516 | nmdc:mga0sz30_262411_c1 | nmdc:mga0sz30_262411_c1_131_496 | 121 |
| 461 | 3300050516 | nmdc:mga0sz30_71226_c1 | nmdc:mga0sz30_71226_c1_188_553 | 121 |
| 462 | 3300053083 | Ga0495655_0070605 | Ga0495655_0070605_494_862 | 121 |
| 463 | 3300053096 | Ga0500641_0062484 | Ga0500641_0062484_731_1096 | 121 |
| 464 | 3300053129 | Ga0500628_102184 | Ga0500628_102184_287_655 | 121 |
| 465 | 3300053138 | Ga0500564_067843 | Ga0500564_067843_132_497 | 121 |
| 466 | 3300061719 | Ga0466962_0037035 | Ga0466962_0037035_1389_1757 | 121 |
| 467 | 3300061719 | Ga0466962_0225257 | Ga0466962_0225257_427_792 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5a43-assembly1.cif.gz_B | crystal structure of a dual topology fluoride ion channel. | 0.7891 | 2 | 120 |
| 6bqo-assembly1.cif.gz_A | structure of a dual topology fluoride channel with monobody s8 | 0.789 | 2 | 120 |
| 7kk9-assembly1.cif.gz_A | fluoride channel fluc-ec2 mutant s81a/t82a with bromide | 0.7869 | 8 | 120 |
| 6bx5-assembly1.cif.gz_A | the crystal structure of fluoride channel fluc ec2 with monobody s12 | 0.783 | 2 | 117 |
| 5a40-assembly2.cif.gz_C | crystal structure of a dual topology fluoride ion channel. | 0.7809 | 2 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP61_13_121_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8342 | 8 | 114 | 1.10.287.70 |
| af_P9WP61_13_121_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8138 | 8 | 114 | 1.10.287.70 |
| af_P37002_6_119_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8084 | 13 | 116 | 1.10.287.70 |
| af_Q4D2Y9_236_346_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8033 | 11 | 114 | 1.10.287.70 |
| af_A4I767_271_383_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7943 | 8 | 114 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B9B6Y5-F1-model_v4 | deleted | 0.969 | 43 | 121 |
|
| AF-W2E1V3-F1-model_v4 | deleted | 0.9689 | 35 | 116 |
|
| AF-A0A0R1KYM9-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9606 | 35 | 121 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A9WPV4-F1-model_v4 | Fluoride-specific ion channel | 0.9571 | 35 | 119 |
GO:0005886
GO:0034220 |
| AF-A0A1L8D3N1-F1-model_v4 | Fluoride-specific ion channel | 0.9557 | 39 | 119 |
GO:0005886
GO:0034220 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar