F449791

General Info

Members Datasets Scaffolds Average Seq Length
467 238 934 212

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100012801|Ga0070690_1000128013
Length 211
Sequence MERLQRVVGPLATNVHVLADPHSREAIAIDTATPCLAWITDELAARDWTLKLIVSSHGHWDHIGDNAAVAEHTGADVGAHPLDHDRLIHPSTNAPFDIPPSVPAVDLAEGGEVRFGSIRLRVLHTPGHTEGSVCLYEPDEGLLFSGDTLFAGGWGRVDLPGGDPDAMVASLGRFLDLEDGVHVFPGHGPETTIGRERAWLELVRDQRRLLA

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 8.78
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 6.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100012801 3300005330 Bacteria 4942
2 rootH2_10233166 3300003320 Bacteria 2128
3 Ga0070676_10347284 3300005328 Bacteria 1019
4 Ga0070670_100027412 3300005331 Bacteria 4901
5 Ga0070680_100562159 3300005336 Bacteria 978
6 Ga0070682_100012307 3300005337 Bacteria 4903
7 Ga0068868_100474299 3300005338 Bacteria 1092
8 Ga0070660_100097250 3300005339 Bacteria 2329
9 Ga0070689_100004080 3300005340 Bacteria 9836
10 Ga0070691_10112874 3300005341 Bacteria 1361
11 Ga0070687_100031387 3300005343 Bacteria 2606
12 Ga0070661_100101245 3300005344 Bacteria 2143
13 Ga0070692_10007184 3300005345 Bacteria 4890
14 Ga0070692_10020318 3300005345 Bacteria 3220
15 Ga0070692_10117130 3300005345 Bacteria 1481
16 Ga0070668_100127462 3300005347 Bacteria 2040
17 Ga0070668_100878498 3300005347 Bacteria 800
18 Ga0070669_100098704 3300005353 Bacteria 2200
19 Ga0070675_100004579 3300005354 Bacteria 10557
20 Ga0070675_100167227 3300005354 Bacteria 1895
21 Ga0070675_100654512 3300005354 Bacteria 955
22 Ga0070675_100737726 3300005354 Bacteria 898
23 Ga0070671_100285879 3300005355 Bacteria 1403
24 Ga0070674_100006330 3300005356 Bacteria 6896
25 Ga0070674_100028591 3300005356 Bacteria 3663
26 Ga0070688_100009340 3300005365 Bacteria 5359
27 Ga0070701_10006207 3300005438 Bacteria 5012
28 Ga0070701_10053000 3300005438 Bacteria 2110
29 Ga0070705_100075369 3300005440 Bacteria 2054
30 Ga0070705_100089793 3300005440 Bacteria 1911
31 Ga0070705_100092988 3300005440 Bacteria 1884
32 Ga0070705_100131011 3300005440 Bacteria 1636
33 Ga0070705_100147597 3300005440 Bacteria 1556
34 Ga0070700_100002416 3300005441 Bacteria 9520
35 Ga0070700_100030916 3300005441 Bacteria 3204
36 Ga0070694_100026865 3300005444 Bacteria 3734
37 Ga0070694_100029226 3300005444 Bacteria 3595
38 Ga0070694_100333965 3300005444 Bacteria 1170
39 Ga0070708_100008200 3300005445 Bacteria 8383
40 Ga0070708_100137573 3300005445 Bacteria 2264
41 Ga0070708_100153438 3300005445 Bacteria 2143
42 Ga0070708_100169140 3300005445 Unclassified 2040
43 Ga0070708_100769249 3300005445 Bacteria 905
44 Ga0070663_100283057 3300005455 Bacteria 1322
45 Ga0070663_100358583 3300005455 Bacteria 1182
46 Ga0070678_100037130 3300005456 Bacteria 3417
47 Ga0070678_100331818 3300005456 Bacteria 1302
48 Ga0070662_100010425 3300005457 Bacteria 6096
49 Ga0070662_100011301 3300005457 Bacteria 5886
50 Ga0070681_10705644 3300005458 Bacteria 925
51 Ga0068867_100013600 3300005459 Bacteria 5763
52 Ga0070706_100002794 3300005467 Bacteria 17459
53 Ga0070706_100118826 3300005467 Bacteria 2463
54 Ga0070706_100235712 3300005467 Bacteria 1709
55 Ga0070707_100004371 3300005468 Bacteria 13242
56 Ga0070707_100011078 3300005468 Bacteria 8398
57 Ga0070707_100087222 3300005468 Bacteria 3018
58 Ga0070707_100192276 3300005468 Bacteria 1990
59 Ga0070707_100893466 3300005468 Bacteria 853
60 Ga0070698_100069793 3300005471 Bacteria 3527
61 Ga0070698_100449712 3300005471 Unclassified 1224
62 Ga0070699_100065357 3300005518 Bacteria 3157
63 Ga0070699_100323903 3300005518 Bacteria 1385
64 Ga0070679_100284818 3300005530 Bacteria 1605
65 Ga0070684_100005556 3300005535 Bacteria 9677
66 Ga0070697_100002158 3300005536 Bacteria 15064
67 Ga0070697_100103143 3300005536 Bacteria 2371
68 Ga0070697_100220454 3300005536 Bacteria 1616
69 Ga0068853_100077859 3300005539 Unclassified 2897
70 Ga0068853_100567338 3300005539 Bacteria 1076
71 Ga0070672_100058752 3300005543 Bacteria 3024
72 Ga0070686_100237740 3300005544 Bacteria 1325
73 Ga0070686_100300063 3300005544 Bacteria 1191
74 Ga0070695_100035673 3300005545 Bacteria 3124
75 Ga0070695_100141335 3300005545 Bacteria 1669
76 Ga0070695_100235525 3300005545 Bacteria 1325
77 Ga0070696_100005510 3300005546 Bacteria 8444
78 Ga0070696_100009480 3300005546 Bacteria 6521
79 Ga0070696_100020350 3300005546 Bacteria 4498
80 Ga0070696_100401067 3300005546 Unclassified 1073
81 Ga0070696_100457866 3300005546 Bacteria 1008
82 Ga0070665_100728108 3300005548 Bacteria 1005
83 Ga0070704_100027580 3300005549 Bacteria 3769
84 Ga0070704_100113424 3300005549 Bacteria 2067
85 Ga0068855_100463487 3300005563 Bacteria 1381
86 Ga0070664_100243473 3300005564 Bacteria 1615
87 Ga0068857_100166660 3300005577 Bacteria 2001
88 Ga0068857_100243330 3300005577 Bacteria 1647
89 Ga0068854_100795112 3300005578 Bacteria 824
90 Ga0068856_100224952 3300005614 Bacteria 1892
91 Ga0068852_100065153 3300005616 Bacteria 3178
92 Ga0068859_100050200 3300005617 Bacteria 4191
93 Ga0068864_100019060 3300005618 Bacteria 5734
94 Ga0068861_100099114 3300005719 Unclassified 2314
95 Ga0068861_100256388 3300005719 Bacteria 1495
96 Ga0068870_10029608 3300005840 Bacteria 2759
97 Ga0068863_100128560 3300005841 Bacteria 2418
98 Ga0068858_100296491 3300005842 Bacteria 1542
99 Ga0068860_100008502 3300005843 Bacteria 10228
100 Ga0068860_100048968 3300005843 Bacteria 4027
101 Ga0068862_100302325 3300005844 Bacteria 1472
102 Ga0068862_100838629 3300005844 Bacteria 900
103 Ga0081455_10098050 3300005937 Bacteria 2360
104 Ga0081539_10009195 3300005985 Bacteria 8325
105 Ga0070717_10710787 3300006028 Bacteria 913
106 Ga0070716_100346519 3300006173 Bacteria 1050
107 Ga0097621_100082185 3300006237 Bacteria 2682
108 Ga0097621_100384517 3300006237 Bacteria 1254
109 Ga0068871_100276319 3300006358 Bacteria 1468
110 Ga0075428_100001431 3300006844 Bacteria 25463
111 Ga0075433_10016411 3300006852 Bacteria 6103
112 Ga0075434_100034478 3300006871 Bacteria 4997
113 Ga0075429_100173823 3300006880 Bacteria 1887
114 Ga0075429_100448010 3300006880 Bacteria 1131
115 Ga0068865_100002642 3300006881 Bacteria 10646
116 Ga0097620_100050201 3300006931 Bacteria 4191
117 Ga0075435_100509324 3300007076 Bacteria 1041
118 Ga0111539_10023130 3300009094 Bacteria 7632
119 Ga0111539_10049441 3300009094 Bacteria 5014
120 Ga0111539_10109350 3300009094 Bacteria 3244
121 Ga0111539_10250163 3300009094 Bacteria 2064
122 Ga0105245_10017767 3300009098 Bacteria 6207
123 Ga0105245_10170577 3300009098 Bacteria 2072
124 Ga0105245_10324390 3300009098 Bacteria 1518
125 Ga0105245_10449937 3300009098 Bacteria 1296
126 Ga0105245_11190141 3300009098 Bacteria 810
127 Ga0114129_10001927 3300009147 Bacteria 28355
128 Ga0114129_10116850 3300009147 Bacteria 3676
129 Ga0114129_10156505 3300009147 Bacteria 3116
130 Ga0114129_10290035 3300009147 Unclassified 2184
131 Ga0114129_10837807 3300009147 Bacteria 1170
132 Ga0114129_10909240 3300009147 Bacteria 1115
133 Ga0105243_10066945 3300009148 Bacteria 2890
134 Ga0105243_10109854 3300009148 Bacteria 2304
135 Ga0105243_10425373 3300009148 Unclassified 1240
136 Ga0105242_10282108 3300009176 Bacteria 1509
137 Ga0105242_10871872 3300009176 Unclassified 898
138 Ga0105248_10634188 3300009177 Bacteria 1206
139 Ga0105238_10075788 3300009551 Bacteria 3355
140 Ga0105249_10003799 3300009553 Bacteria 13037
141 Ga0105239_10008935 3300010375 Bacteria 11337
142 Ga0105239_10996222 3300010375 Bacteria 963
143 Ga0157373_10460024 3300013100 Bacteria 916
144 Ga0157378_10007754 3300013297 Bacteria 9368
145 Ga0157378_10392399 3300013297 Bacteria 1365
146 Ga0163162_10027318 3300013306 Bacteria 5643
147 Ga0157375_10027384 3300013308 Bacteria 5327
148 Ga0157375_10086655 3300013308 Bacteria 3183
149 Ga0163163_10121755 3300014325 Bacteria 2643
150 Ga0163163_10198242 3300014325 Bacteria 2056
151 Ga0163163_10424365 3300014325 Bacteria 1389
152 Ga0163163_10749288 3300014325 Unclassified 1040
153 Ga0157380_10044423 3300014326 Bacteria 3482
154 Ga0157380_10058302 3300014326 Bacteria 3077
155 Ga0157380_10077846 3300014326 Bacteria 2704
156 Ga0157380_10122992 3300014326 Bacteria 2201
157 Ga0157377_10008485 3300014745 Bacteria 5012
158 Ga0157377_10049952 3300014745 Bacteria 2353
159 Ga0157377_10121602 3300014745 Bacteria 1583
160 Ga0157379_10056399 3300014968 Bacteria 3510
161 Ga0157379_10079611 3300014968 Bacteria 2934
162 Ga0157379_10163417 3300014968 Unclassified 2010
163 Ga0157376_10607321 3300014969 Bacteria 1089
164 Ga0163161_10005304 3300017792 Bacteria 8974
165 Ga0207688_10003628 3300025901 Bacteria 8430
166 Ga0207643_10025527 3300025908 Bacteria 3266
167 Ga0207684_10002777 3300025910 Bacteria 17441
168 Ga0207684_10088569 3300025910 Bacteria 2637
169 Ga0207707_10647957 3300025912 Bacteria 891
170 Ga0207660_10513701 3300025917 Bacteria 972
171 Ga0207662_10001585 3300025918 Bacteria 11136
172 Ga0207657_10103759 3300025919 Bacteria 2356
173 Ga0207652_10112111 3300025921 Bacteria 2420
174 Ga0207652_10810149 3300025921 Bacteria 831
175 Ga0207652_10865950 3300025921 Bacteria 799
176 Ga0207646_10012780 3300025922 Bacteria 8053
177 Ga0207646_10020121 3300025922 Bacteria 6190
178 Ga0207646_10061318 3300025922 Bacteria 3357
179 Ga0207646_10089623 3300025922 Bacteria 2753
180 Ga0207681_10398282 3300025923 Bacteria 1111
181 Ga0207694_10047133 3300025924 Bacteria 3333
182 Ga0207650_10188325 3300025925 Bacteria 1647
183 Ga0207659_10020560 3300025926 Bacteria 4365
184 Ga0207687_10029420 3300025927 Bacteria 3696
185 Ga0207644_10330812 3300025931 Bacteria 1234
186 Ga0207706_10005959 3300025933 Bacteria 11338
187 Ga0207706_10026181 3300025933 Bacteria 5221
188 Ga0207706_10456511 3300025933 Bacteria 1105
189 Ga0207709_10088532 3300025935 Bacteria 2016
190 Ga0207709_10250469 3300025935 Unclassified 1293
191 Ga0207709_10428908 3300025935 Unclassified 1017
192 Ga0207670_10039467 3300025936 Bacteria 3092
193 Ga0207669_10071046 3300025937 Bacteria 2185
194 Ga0207669_10213542 3300025937 Bacteria 1410
195 Ga0207704_10101611 3300025938 Bacteria 1918
196 Ga0207691_10037929 3300025940 Bacteria 4460
197 Ga0207711_10174087 3300025941 Bacteria 1954
198 Ga0207711_10233332 3300025941 Bacteria 1685
199 Ga0207711_10421116 3300025941 Bacteria 1242
200 Ga0207661_10274505 3300025944 Bacteria 1505
201 Ga0207667_10409244 3300025949 Bacteria 1381
202 Ga0207712_10008577 3300025961 Bacteria 6461
203 Ga0207668_10147515 3300025972 Bacteria 1817
204 Ga0207668_10287525 3300025972 Bacteria 1351
205 Ga0207658_10931227 3300025986 Bacteria 792
206 Ga0207677_10748767 3300026023 Unclassified 871
207 Ga0207703_10734343 3300026035 Bacteria 940
208 Ga0207639_10169858 3300026041 Bacteria 1846
209 Ga0207678_10009395 3300026067 Bacteria 8605
210 Ga0207678_10231105 3300026067 Bacteria 1583
211 Ga0207708_10009990 3300026075 Bacteria 7047
212 Ga0207708_10023539 3300026075 Bacteria 4658
213 Ga0207708_10176425 3300026075 Bacteria 1695
214 Ga0207648_10006662 3300026089 Bacteria 11462
215 Ga0207648_10363114 3300026089 Bacteria 1307
216 Ga0207676_10375289 3300026095 Bacteria 1322
217 Ga0207674_10014503 3300026116 Bacteria 8702
218 Ga0207674_10689227 3300026116 Bacteria 986
219 Ga0207675_100133564 3300026118 Bacteria 2353
220 Ga0207675_100812725 3300026118 Bacteria 949
221 Ga0207683_10033577 3300026121 Bacteria 4457
222 Ga0207683_10625737 3300026121 Bacteria 997
223 Ga0207683_11068356 3300026121 Bacteria 749
224 Ga0207683_11084341 3300026121 Bacteria 743
225 Ga0207698_10106583 3300026142 Bacteria 2337
226 Ga0209983_1030883 3300027665 Bacteria 1142
227 Ga0209998_10005817 3300027717 Bacteria 2568
228 Ga0209998_10025652 3300027717 Bacteria 1284
229 Ga0209974_10014463 3300027876 Bacteria 2626
230 Ga0207428_10057613 3300027907 Bacteria 3084
231 Ga0207428_10059857 3300027907 Bacteria 3018
232 Ga0268266_10761210 3300028379 Bacteria 935
233 Ga0268265_10182291 3300028380 Bacteria 1805
234 Ga0268265_10264543 3300028380 Bacteria 1531
235 Ga0268265_10269617 3300028380 Bacteria 1518
236 Ga0268264_10013364 3300028381 Bacteria 6756
237 Ga0268264_10114715 3300028381 Unclassified 2366
238 Ga0268264_10205779 3300028381 Bacteria 1803
239 Ga0265334_10005903 3300028573 Bacteria 5327
240 Ga0265318_10007659 3300028577 Bacteria 4861
241 Ga0265318_10194144 3300028577 Bacteria 742
242 Ga0265322_10022968 3300028654 Bacteria 1784
243 Ga0265322_10077851 3300028654 Bacteria 941
244 Ga0265336_10028168 3300028666 Bacteria 1756
245 Ga0265338_10113426 3300028800 Bacteria 2177
246 Ga0265324_10053857 3300029957 Bacteria 1381
247 Ga0265320_10074625 3300031240 Unclassified 1592
248 Ga0265320_10210708 3300031240 Bacteria 866
249 Ga0265325_10038913 3300031241 Bacteria 2507
250 Ga0265329_10031101 3300031242 Bacteria 1736
251 Ga0265340_10003605 3300031247 Bacteria 8710
252 Ga0265339_10090397 3300031249 Bacteria 1605
253 Ga0307408_100038362 3300031548 Bacteria 3380
254 Ga0265314_10035420 3300031711 Bacteria 3638
255 Ga0316578_10104228 3300031728 Unclassified 1701
256 Ga0307405_10059568 3300031731 Bacteria 2407
257 Ga0307410_10704005 3300031852 Bacteria 852
258 Ga0307406_10367276 3300031901 Bacteria 1130
259 Ga0307409_100633797 3300031995 Bacteria 1061
260 Ga0307409_100878091 3300031995 Bacteria 909
261 Ga0307416_100008327 3300032002 Bacteria 6679
262 Ga0307415_101082159 3300032126 Bacteria 750
263 Ga0373939_0042328 3300035114 Bacteria 1377
264 Ga0373941_0103474 3300035115 Bacteria 994
265 Ga0316574_0047956 3300035398 Bacteria 2652
266 Ga0316574_0142352 3300035398 Bacteria 1545
267 Ga0373931_0381726 3300035691 Bacteria 888
268 Ga0373947_0036209 3300035725 Bacteria 2926
269 Ga0373947_0230885 3300035725 Bacteria 1219
270 Ga0373947_0391112 3300035725 Bacteria 937
271 Ga0373937_0620680 3300036401 Unclassified 1026
272 Ga0373925_0089887 3300037068 Bacteria 2347
273 Ga0373925_0395074 3300037068 Bacteria 1127
274 Ga0395898_0728997 3300037466 Unclassified 933
275 Ga0395901_1380334 3300038443 Bacteria 664
276 Ga0439465_0015783 3300041413 Bacteria 2356
277 Ga0451845_0822257 3300041501 Bacteria 662
278 Ga0451853_3019481 3300041512 Bacteria 1087
279 Ga0450910_001606 3300042147 Bacteria 2887
280 Ga0450910_013458 3300042147 Bacteria 1191
281 Ga0439446_0049338 3300042156 Bacteria 1255
282 Ga0439434_0099786 3300042435 Bacteria 935
283 Ga0451577_0025844 3300042876 Bacteria 5324
284 Ga0451577_0144471 3300042876 Bacteria 2139
285 Ga0451577_0658879 3300042876 Bacteria 949
286 Ga0453683_0163159 3300044673 Bacteria 1410
287 Ga0466964_0302908 3300044706 Bacteria 806
288 Ga0451576_0261923 3300045051 Bacteria 1807
289 Ga0495629_0172871 3300046459 Bacteria 1499
290 Ga0495651_0049756 3300046462 Bacteria 3235
291 Ga0495628_0112638 3300046516 Bacteria 2092
292 Ga0495630_0387974 3300046517 Bacteria 1070
293 Ga0495630_0411966 3300046517 Bacteria 1036
294 Ga0495666_0302999 3300046526 Bacteria 723
295 Ga0495640_0051608 3300046533 Bacteria 2827
296 Ga0495647_0086359 3300046681 Bacteria 1280
297 Ga0495658_0406826 3300046683 Unclassified 868
298 Ga0495602_0055407 3300048088 Bacteria 3492
299 Ga0496101_0330904 3300048904 Bacteria 1196
300 Ga0496102_0104321 3300048905 Unclassified 2637
301 Ga0496102_0154153 3300048905 Bacteria 2159
302 Ga0496103_0020044 3300048906 Bacteria 4015
303 Ga0496103_0055185 3300048906 Bacteria 2464
304 Ga0496103_0597990 3300048906 Bacteria 703
305 Ga0496104_0003954 3300048907 Bacteria 12835
306 Ga0496104_0006810 3300048907 Bacteria 10067
307 Ga0496104_0211988 3300048907 Bacteria 1849
308 Ga0496104_0528485 3300048907 Bacteria 1091
309 Ga0496105_0030778 3300048908 Bacteria 4399
310 Ga0496105_0358813 3300048908 Bacteria 1163
311 Ga0496105_0532129 3300048908 Bacteria 919
312 Ga0496106_0023810 3300048909 Bacteria 4551
313 Ga0496106_0046832 3300048909 Bacteria 3252
314 Ga0496106_0411944 3300048909 Bacteria 1086
315 Ga0496107_0490236 3300048910 Bacteria 912
316 Ga0496108_0012166 3300048911 Bacteria 6997
317 Ga0496108_0027207 3300048911 Bacteria 4720
318 Ga0496108_0067515 3300048911 Bacteria 3016
319 Ga0496108_0105589 3300048911 Bacteria 2405
320 Ga0496109_0003970 3300048912 Bacteria 12355
321 Ga0496109_0004962 3300048912 Bacteria 11115
322 Ga0496109_0006804 3300048912 Bacteria 9635
323 Ga0496109_0047311 3300048912 Bacteria 3911
324 Ga0496109_0178381 3300048912 Bacteria 1994
325 Ga0496109_0271798 3300048912 Bacteria 1597
326 Ga0496110_0031586 3300048913 Bacteria 4570
327 Ga0496110_0390438 3300048913 Bacteria 1268
328 Ga0496111_0018383 3300048914 Bacteria 4842
329 Ga0496111_0019483 3300048914 Bacteria 4713
330 Ga0496111_0192594 3300048914 Unclassified 1516
331 Ga0496112_0000005 3300048915 Bacteria 525541
332 Ga0496112_0018894 3300048915 Bacteria 6494
333 Ga0496112_0564973 3300048915 Bacteria 1071
334 Ga0496113_0005532 3300048916 Bacteria 7888
335 Ga0496113_0006076 3300048916 Bacteria 7613
336 Ga0496113_0008015 3300048916 Bacteria 6850
337 Ga0496114_0020078 3300048917 Bacteria 5420
338 Ga0496114_0047811 3300048917 Bacteria 3558
339 Ga0496114_0200961 3300048917 Bacteria 1746
340 Ga0501031_0081840 3300049568 Bacteria 2105
341 Ga0501031_0118779 3300049568 Bacteria 1728
342 Ga0501031_0193354 3300049568 Bacteria 1328
343 Ga0501032_0033891 3300049569 Bacteria 3498
344 Ga0501036_0189508 3300049572 Bacteria 1731
345 Ga0501036_0225749 3300049572 Bacteria 1572
346 Ga0501036_0463288 3300049572 Unclassified 1055
347 Ga0501036_0772093 3300049572 Bacteria 792
348 Ga0501037_0050640 3300049573 Bacteria 3039
349 Ga0501039_0131830 3300049575 Bacteria 1961
350 Ga0501039_0177636 3300049575 Bacteria 1674
351 Ga0501039_0318772 3300049575 Bacteria 1222
352 Ga0501039_0340391 3300049575 Bacteria 1179
353 Ga0501040_0084018 3300049576 Unclassified 2208
354 Ga0501040_0532782 3300049576 Unclassified 847
355 Ga0501041_0030966 3300049577 Bacteria 3229
356 Ga0501041_0088037 3300049577 Bacteria 1917
357 Ga0501041_0131154 3300049577 Unclassified 1561
358 Ga0501041_0507394 3300049577 Bacteria 767
359 Ga0501042_0140753 3300049578 Bacteria 1740
360 Ga0501042_0177219 3300049578 Bacteria 1538
361 Ga0501046_0165041 3300049580 Bacteria 1664
362 Ga0501046_0301323 3300049580 Bacteria 1170
363 Ga0501046_0466946 3300049580 Bacteria 906
364 Ga0501048_0030597 3300049582 Bacteria 3895
365 Ga0501048_0049921 3300049582 Bacteria 2981
366 Ga0501048_0086116 3300049582 Unclassified 2216
367 Ga0501048_0098322 3300049582 Bacteria 2065
368 Ga0501048_0296070 3300049582 Bacteria 1151
369 Ga0501067_0019084 3300049583 Bacteria 3795
370 Ga0501067_0043212 3300049583 Bacteria 2502
371 Ga0501067_0100820 3300049583 Bacteria 1604
372 Ga0501068_0035767 3300049584 Bacteria 2966
373 Ga0501068_0077167 3300049584 Bacteria 2040
374 Ga0501068_0302840 3300049584 Bacteria 1023
375 Ga0501068_0502953 3300049584 Bacteria 786
376 Ga0501069_0050333 3300049585 Bacteria 2316
377 Ga0501069_0153334 3300049585 Bacteria 1325
378 Ga0501069_0191376 3300049585 Bacteria 1184
379 Ga0501070_0575259 3300049586 Bacteria 900
380 Ga0501071_0050167 3300049587 Bacteria 3006
381 Ga0501071_0157797 3300049587 Bacteria 1694
382 Ga0501072_0019864 3300049588 Bacteria 5199
383 Ga0501072_0093184 3300049588 Bacteria 2393
384 Ga0501072_0274758 3300049588 Bacteria 1340
385 Ga0501073_0615779 3300049589 Unclassified 750
386 Ga0501074_0005907 3300049590 Bacteria 8825
387 Ga0501074_0309946 3300049590 Bacteria 1121
388 Ga0501075_0024061 3300049591 Bacteria 4459
389 Ga0501075_0028688 3300049591 Bacteria 4109
390 Ga0501075_0073374 3300049591 Bacteria 2588
391 Ga0501075_0099753 3300049591 Bacteria 2205
392 Ga0501075_0128214 3300049591 Unclassified 1932
393 Ga0501075_0291542 3300049591 Bacteria 1243
394 Ga0501076_0062824 3300049592 Bacteria 2958
395 Ga0501076_0111879 3300049592 Bacteria 2208
396 Ga0501076_0127675 3300049592 Bacteria 2061
397 Ga0501076_0301185 3300049592 Bacteria 1314
398 Ga0501077_0061319 3300049593 Bacteria 2386
399 Ga0501077_0063885 3300049593 Bacteria 2335
400 Ga0501077_0089974 3300049593 Bacteria 1945
401 Ga0501077_0101665 3300049593 Bacteria 1822
402 Ga0501077_0102968 3300049593 Bacteria 1809
403 Ga0501077_0287929 3300049593 Bacteria 1046
404 Ga0501077_0578890 3300049593 Bacteria 721
405 Ga0501079_0047975 3300049741 Bacteria 3295
406 Ga0501079_0087718 3300049741 Unclassified 2409
407 Ga0501079_0146392 3300049741 Bacteria 1841
408 Ga0501079_0169990 3300049741 Bacteria 1700
409 Ga0501079_0190563 3300049741 Bacteria 1600
410 Ga0501079_0309099 3300049741 Bacteria 1237
411 Ga0501079_0357454 3300049741 Bacteria 1144
412 Ga0501079_0357845 3300049741 Bacteria 1144
413 Ga0501080_0041370 3300049742 Bacteria 4295
414 Ga0501080_0041780 3300049742 Bacteria 4271
415 Ga0501080_0509091 3300049742 Bacteria 1075
416 Ga0501080_0656330 3300049742 Bacteria 928
417 Ga0501081_0015916 3300049743 Bacteria 4966
418 Ga0501081_0042678 3300049743 Bacteria 3109
419 Ga0501081_0061065 3300049743 Bacteria 2613
420 Ga0501081_0275833 3300049743 Bacteria 1230
421 Ga0501083_0068977 3300049744 Unclassified 2353
422 Ga0501083_0101153 3300049744 Bacteria 1901
423 Ga0501035_0064941 3300049822 Bacteria 3243
424 Ga0501035_0248842 3300049822 Bacteria 1510
425 Ga0501035_0282719 3300049822 Unclassified 1402
426 Ga0501044_0396701 3300049823 Bacteria 1293
427 Ga0501045_0041834 3300049824 Bacteria 3335
428 Ga0501045_0536383 3300049824 Bacteria 868
429 Ga0501045_0640949 3300049824 Unclassified 785
430 nmdc:mga0yw44_314703_c1 3300050492 Bacteria 1050
431 nmdc:mga05p37_133923_c1 3300050507 Bacteria 3040
432 nmdc:mga05p37_227692_c1 3300050507 Bacteria 2247
433 nmdc:mga05p37_59417_c1 3300050507 Bacteria 4708
434 nmdc:mga05p37_851_c1 3300050507 Bacteria 34350
435 nmdc:mga09592_213060_c1 3300050508 Bacteria 1674
436 nmdc:mga08y16_111064_c1 3300050511 Bacteria 2854
437 nmdc:mga08y16_171935_c1 3300050511 Bacteria 2250
438 nmdc:mga08y16_366884_c1 3300050511 Bacteria 1477
439 nmdc:mga08y16_545147_c1 3300050511 Bacteria 1174
440 nmdc:mga08y16_57385_c1 3300050511 Bacteria 4069
441 nmdc:mga0n895_31553_c1 3300050512 Bacteria 5074
442 nmdc:mga0n895_418597_c1 3300050512 Bacteria 1354
443 nmdc:mga0n895_438769_c1 3300050512 Bacteria 1319
444 nmdc:mga0n895_85069_c1 3300050512 Bacteria 3156
445 nmdc:mga0rr50_57956_c1 3300050513 Archaea 2900
446 nmdc:mga0a205_478935_c1 3300050515 Bacteria 1103
447 nmdc:mga0a205_64224_c1 3300050515 Bacteria 3546
448 Ga0495601_0114863 3300053077 Bacteria 1745
449 Ga0495601_0184130 3300053077 Bacteria 1365
450 Ga0495612_0003231 3300053078 Bacteria 6758
451 Ga0495619_0058014 3300053085 Bacteria 2569
452 Ga0495619_0559218 3300053085 Bacteria 784
453 Ga0501084_0037336 3300054114 Bacteria 4058
454 Ga0501084_0098868 3300054114 Bacteria 2450
455 Ga0501084_0162638 3300054114 Bacteria 1883
456 Ga0501084_0262726 3300054114 Bacteria 1457
457 Ga0590071_005672 3300059421 Bacteria 2996
458 Ga0501082_0037703 3300060353 Bacteria 4168
459 Ga0501082_0058599 3300060353 Bacteria 3318
460 Ga0501082_0163208 3300060353 Bacteria 1936
461 Ga0501082_0368882 3300060353 Bacteria 1252
462 Ga0501082_1061739 3300060353 Bacteria 708
463 Ga0530510_0008218 3300061734 Bacteria 7279
464 Ga0530510_0072556 3300061734 Bacteria 2499
465 Ga0530510_0077415 3300061734 Bacteria 2417
466 Ga0530510_0142482 3300061734 Bacteria 1767
467 Ga0530510_0189307 3300061734 Bacteria 1527
468 Ga0070690_100012801
469 rootH2_10233166
470 Ga0070676_10347284
471 Ga0070670_100027412
472 Ga0070680_100562159
473 Ga0070682_100012307
474 Ga0068868_100474299
475 Ga0070660_100097250
476 Ga0070689_100004080
477 Ga0070691_10112874
478 Ga0070687_100031387
479 Ga0070661_100101245
480 Ga0070692_10007184
481 Ga0070692_10020318
482 Ga0070692_10117130
483 Ga0070668_100127462
484 Ga0070668_100878498
485 Ga0070669_100098704
486 Ga0070675_100004579
487 Ga0070675_100167227
488 Ga0070675_100654512
489 Ga0070675_100737726
490 Ga0070671_100285879
491 Ga0070674_100006330
492 Ga0070674_100028591
493 Ga0070688_100009340
494 Ga0070701_10006207
495 Ga0070701_10053000
496 Ga0070705_100075369
497 Ga0070705_100089793
498 Ga0070705_100092988
499 Ga0070705_100131011
500 Ga0070705_100147597
501 Ga0070700_100002416
502 Ga0070700_100030916
503 Ga0070694_100026865
504 Ga0070694_100029226
505 Ga0070694_100333965
506 Ga0070708_100008200
507 Ga0070708_100137573
508 Ga0070708_100153438
509 Ga0070708_100169140
510 Ga0070708_100769249
511 Ga0070663_100283057
512 Ga0070663_100358583
513 Ga0070678_100037130
514 Ga0070678_100331818
515 Ga0070662_100010425
516 Ga0070662_100011301
517 Ga0070681_10705644
518 Ga0068867_100013600
519 Ga0070706_100002794
520 Ga0070706_100118826
521 Ga0070706_100235712
522 Ga0070707_100004371
523 Ga0070707_100011078
524 Ga0070707_100087222
525 Ga0070707_100192276
526 Ga0070707_100893466
527 Ga0070698_100069793
528 Ga0070698_100449712
529 Ga0070699_100065357
530 Ga0070699_100323903
531 Ga0070679_100284818
532 Ga0070684_100005556
533 Ga0070697_100002158
534 Ga0070697_100103143
535 Ga0070697_100220454
536 Ga0068853_100077859
537 Ga0068853_100567338
538 Ga0070672_100058752
539 Ga0070686_100237740
540 Ga0070686_100300063
541 Ga0070695_100035673
542 Ga0070695_100141335
543 Ga0070695_100235525
544 Ga0070696_100005510
545 Ga0070696_100009480
546 Ga0070696_100020350
547 Ga0070696_100401067
548 Ga0070696_100457866
549 Ga0070665_100728108
550 Ga0070704_100027580
551 Ga0070704_100113424
552 Ga0068855_100463487
553 Ga0070664_100243473
554 Ga0068857_100166660
555 Ga0068857_100243330
556 Ga0068854_100795112
557 Ga0068856_100224952
558 Ga0068852_100065153
559 Ga0068859_100050200
560 Ga0068864_100019060
561 Ga0068861_100099114
562 Ga0068861_100256388
563 Ga0068870_10029608
564 Ga0068863_100128560
565 Ga0068858_100296491
566 Ga0068860_100008502
567 Ga0068860_100048968
568 Ga0068862_100302325
569 Ga0068862_100838629
570 Ga0081455_10098050
571 Ga0081539_10009195
572 Ga0070717_10710787
573 Ga0070716_100346519
574 Ga0097621_100082185
575 Ga0097621_100384517
576 Ga0068871_100276319
577 Ga0075428_100001431
578 Ga0075433_10016411
579 Ga0075434_100034478
580 Ga0075429_100173823
581 Ga0075429_100448010
582 Ga0068865_100002642
583 Ga0097620_100050201
584 Ga0075435_100509324
585 Ga0111539_10023130
586 Ga0111539_10049441
587 Ga0111539_10109350
588 Ga0111539_10250163
589 Ga0105245_10017767
590 Ga0105245_10170577
591 Ga0105245_10324390
592 Ga0105245_10449937
593 Ga0105245_11190141
594 Ga0114129_10001927
595 Ga0114129_10116850
596 Ga0114129_10156505
597 Ga0114129_10290035
598 Ga0114129_10837807
599 Ga0114129_10909240
600 Ga0105243_10066945
601 Ga0105243_10109854
602 Ga0105243_10425373
603 Ga0105242_10282108
604 Ga0105242_10871872
605 Ga0105248_10634188
606 Ga0105238_10075788
607 Ga0105249_10003799
608 Ga0105239_10008935
609 Ga0105239_10996222
610 Ga0157373_10460024
611 Ga0157378_10007754
612 Ga0157378_10392399
613 Ga0163162_10027318
614 Ga0157375_10027384
615 Ga0157375_10086655
616 Ga0163163_10121755
617 Ga0163163_10198242
618 Ga0163163_10424365
619 Ga0163163_10749288
620 Ga0157380_10044423
621 Ga0157380_10058302
622 Ga0157380_10077846
623 Ga0157380_10122992
624 Ga0157377_10008485
625 Ga0157377_10049952
626 Ga0157377_10121602
627 Ga0157379_10056399
628 Ga0157379_10079611
629 Ga0157379_10163417
630 Ga0157376_10607321
631 Ga0163161_10005304
632 Ga0207688_10003628
633 Ga0207643_10025527
634 Ga0207684_10002777
635 Ga0207684_10088569
636 Ga0207707_10647957
637 Ga0207660_10513701
638 Ga0207662_10001585
639 Ga0207657_10103759
640 Ga0207652_10112111
641 Ga0207652_10810149
642 Ga0207652_10865950
643 Ga0207646_10012780
644 Ga0207646_10020121
645 Ga0207646_10061318
646 Ga0207646_10089623
647 Ga0207681_10398282
648 Ga0207694_10047133
649 Ga0207650_10188325
650 Ga0207659_10020560
651 Ga0207687_10029420
652 Ga0207644_10330812
653 Ga0207706_10005959
654 Ga0207706_10026181
655 Ga0207706_10456511
656 Ga0207709_10088532
657 Ga0207709_10250469
658 Ga0207709_10428908
659 Ga0207670_10039467
660 Ga0207669_10071046
661 Ga0207669_10213542
662 Ga0207704_10101611
663 Ga0207691_10037929
664 Ga0207711_10174087
665 Ga0207711_10233332
666 Ga0207711_10421116
667 Ga0207661_10274505
668 Ga0207667_10409244
669 Ga0207712_10008577
670 Ga0207668_10147515
671 Ga0207668_10287525
672 Ga0207658_10931227
673 Ga0207677_10748767
674 Ga0207703_10734343
675 Ga0207639_10169858
676 Ga0207678_10009395
677 Ga0207678_10231105
678 Ga0207708_10009990
679 Ga0207708_10023539
680 Ga0207708_10176425
681 Ga0207648_10006662
682 Ga0207648_10363114
683 Ga0207676_10375289
684 Ga0207674_10014503
685 Ga0207674_10689227
686 Ga0207675_100133564
687 Ga0207675_100812725
688 Ga0207683_10033577
689 Ga0207683_10625737
690 Ga0207683_11068356
691 Ga0207683_11084341
692 Ga0207698_10106583
693 Ga0209983_1030883
694 Ga0209998_10005817
695 Ga0209998_10025652
696 Ga0209974_10014463
697 Ga0207428_10057613
698 Ga0207428_10059857
699 Ga0268266_10761210
700 Ga0268265_10182291
701 Ga0268265_10264543
702 Ga0268265_10269617
703 Ga0268264_10013364
704 Ga0268264_10114715
705 Ga0268264_10205779
706 Ga0265334_10005903
707 Ga0265318_10007659
708 Ga0265318_10194144
709 Ga0265322_10022968
710 Ga0265322_10077851
711 Ga0265336_10028168
712 Ga0265338_10113426
713 Ga0265324_10053857
714 Ga0265320_10074625
715 Ga0265320_10210708
716 Ga0265325_10038913
717 Ga0265329_10031101
718 Ga0265340_10003605
719 Ga0265339_10090397
720 Ga0307408_100038362
721 Ga0265314_10035420
722 Ga0316578_10104228
723 Ga0307405_10059568
724 Ga0307410_10704005
725 Ga0307406_10367276
726 Ga0307409_100633797
727 Ga0307409_100878091
728 Ga0307416_100008327
729 Ga0307415_101082159
730 Ga0373939_0042328
731 Ga0373941_0103474
732 Ga0316574_0047956
733 Ga0316574_0142352
734 Ga0373931_0381726
735 Ga0373947_0036209
736 Ga0373947_0230885
737 Ga0373947_0391112
738 Ga0373937_0620680
739 Ga0373925_0089887
740 Ga0373925_0395074
741 Ga0395898_0728997
742 Ga0395901_1380334
743 Ga0439465_0015783
744 Ga0451845_0822257
745 Ga0451853_3019481
746 Ga0450910_001606
747 Ga0450910_013458
748 Ga0439446_0049338
749 Ga0439434_0099786
750 Ga0451577_0025844
751 Ga0451577_0144471
752 Ga0451577_0658879
753 Ga0453683_0163159
754 Ga0466964_0302908
755 Ga0451576_0261923
756 Ga0495629_0172871
757 Ga0495651_0049756
758 Ga0495628_0112638
759 Ga0495630_0387974
760 Ga0495630_0411966
761 Ga0495666_0302999
762 Ga0495640_0051608
763 Ga0495647_0086359
764 Ga0495658_0406826
765 Ga0495602_0055407
766 Ga0496101_0330904
767 Ga0496102_0104321
768 Ga0496102_0154153
769 Ga0496103_0020044
770 Ga0496103_0055185
771 Ga0496103_0597990
772 Ga0496104_0003954
773 Ga0496104_0006810
774 Ga0496104_0211988
775 Ga0496104_0528485
776 Ga0496105_0030778
777 Ga0496105_0358813
778 Ga0496105_0532129
779 Ga0496106_0023810
780 Ga0496106_0046832
781 Ga0496106_0411944
782 Ga0496107_0490236
783 Ga0496108_0012166
784 Ga0496108_0027207
785 Ga0496108_0067515
786 Ga0496108_0105589
787 Ga0496109_0003970
788 Ga0496109_0004962
789 Ga0496109_0006804
790 Ga0496109_0047311
791 Ga0496109_0178381
792 Ga0496109_0271798
793 Ga0496110_0031586
794 Ga0496110_0390438
795 Ga0496111_0018383
796 Ga0496111_0019483
797 Ga0496111_0192594
798 Ga0496112_0000005
799 Ga0496112_0018894
800 Ga0496112_0564973
801 Ga0496113_0005532
802 Ga0496113_0006076
803 Ga0496113_0008015
804 Ga0496114_0020078
805 Ga0496114_0047811
806 Ga0496114_0200961
807 Ga0501031_0081840
808 Ga0501031_0118779
809 Ga0501031_0193354
810 Ga0501032_0033891
811 Ga0501036_0189508
812 Ga0501036_0225749
813 Ga0501036_0463288
814 Ga0501036_0772093
815 Ga0501037_0050640
816 Ga0501039_0131830
817 Ga0501039_0177636
818 Ga0501039_0318772
819 Ga0501039_0340391
820 Ga0501040_0084018
821 Ga0501040_0532782
822 Ga0501041_0030966
823 Ga0501041_0088037
824 Ga0501041_0131154
825 Ga0501041_0507394
826 Ga0501042_0140753
827 Ga0501042_0177219
828 Ga0501046_0165041
829 Ga0501046_0301323
830 Ga0501046_0466946
831 Ga0501048_0030597
832 Ga0501048_0049921
833 Ga0501048_0086116
834 Ga0501048_0098322
835 Ga0501048_0296070
836 Ga0501067_0019084
837 Ga0501067_0043212
838 Ga0501067_0100820
839 Ga0501068_0035767
840 Ga0501068_0077167
841 Ga0501068_0302840
842 Ga0501068_0502953
843 Ga0501069_0050333
844 Ga0501069_0153334
845 Ga0501069_0191376
846 Ga0501070_0575259
847 Ga0501071_0050167
848 Ga0501071_0157797
849 Ga0501072_0019864
850 Ga0501072_0093184
851 Ga0501072_0274758
852 Ga0501073_0615779
853 Ga0501074_0005907
854 Ga0501074_0309946
855 Ga0501075_0024061
856 Ga0501075_0028688
857 Ga0501075_0073374
858 Ga0501075_0099753
859 Ga0501075_0128214
860 Ga0501075_0291542
861 Ga0501076_0062824
862 Ga0501076_0111879
863 Ga0501076_0127675
864 Ga0501076_0301185
865 Ga0501077_0061319
866 Ga0501077_0063885
867 Ga0501077_0089974
868 Ga0501077_0101665
869 Ga0501077_0102968
870 Ga0501077_0287929
871 Ga0501077_0578890
872 Ga0501079_0047975
873 Ga0501079_0087718
874 Ga0501079_0146392
875 Ga0501079_0169990
876 Ga0501079_0190563
877 Ga0501079_0309099
878 Ga0501079_0357454
879 Ga0501079_0357845
880 Ga0501080_0041370
881 Ga0501080_0041780
882 Ga0501080_0509091
883 Ga0501080_0656330
884 Ga0501081_0015916
885 Ga0501081_0042678
886 Ga0501081_0061065
887 Ga0501081_0275833
888 Ga0501083_0068977
889 Ga0501083_0101153
890 Ga0501035_0064941
891 Ga0501035_0248842
892 Ga0501035_0282719
893 Ga0501044_0396701
894 Ga0501045_0041834
895 Ga0501045_0536383
896 Ga0501045_0640949
897 nmdc:mga0yw44_314703_c1
898 nmdc:mga05p37_133923_c1
899 nmdc:mga05p37_227692_c1
900 nmdc:mga05p37_59417_c1
901 nmdc:mga05p37_851_c1
902 nmdc:mga09592_213060_c1
903 nmdc:mga08y16_111064_c1
904 nmdc:mga08y16_171935_c1
905 nmdc:mga08y16_366884_c1
906 nmdc:mga08y16_545147_c1
907 nmdc:mga08y16_57385_c1
908 nmdc:mga0n895_31553_c1
909 nmdc:mga0n895_418597_c1
910 nmdc:mga0n895_438769_c1
911 nmdc:mga0n895_85069_c1
912 nmdc:mga0rr50_57956_c1
913 nmdc:mga0a205_478935_c1
914 nmdc:mga0a205_64224_c1
915 Ga0495601_0114863
916 Ga0495601_0184130
917 Ga0495612_0003231
918 Ga0495619_0058014
919 Ga0495619_0559218
920 Ga0501084_0037336
921 Ga0501084_0098868
922 Ga0501084_0162638
923 Ga0501084_0262726
924 Ga0590071_005672
925 Ga0501082_0037703
926 Ga0501082_0058599
927 Ga0501082_0163208
928 Ga0501082_0368882
929 Ga0501082_1061739
930 Ga0530510_0008218
931 Ga0530510_0072556
932 Ga0530510_0077415
933 Ga0530510_0142482
934 Ga0530510_0189307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

8

187

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.9288 1 201
7ev5-assembly1.cif.gz_A crystal structure of bleg-1 b3 metallo-beta-lactamase 0.9182 2 201
2zzi-assembly1.cif.gz_A crystal structure of ttha1623 in a di-iron-bound form 0.912 4 199
7l0b-assembly4.cif.gz_D crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.9074 2 201
7l0b-assembly3.cif.gz_C crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.8979 2 201
ID Description Score Start End Superfamily
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9288 1 201 3.60.15.10
af_Q4D0L0_259_399_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.919 113 206 3.60.15.10
af_P9WMW3_3_221_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9101 4 201 3.60.15.10
af_Q86PD3_43_273_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8935 3 208 3.60.15.10
af_Q2FY29_1_207_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8933 1 201 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A536ND25-F1-model_v4 MBL fold metallo-hydrolase 0.9972 3 212 GO:0016787
AF-A0A3L7YLE2-F1-model_v4 MBL fold metallo-hydrolase 0.986 3 212 GO:0016787
AF-A0A536ND25-F1-model_v4 MBL fold metallo-hydrolase 0.9832 3 212 GO:0016787
AF-A0A3L7YLE2-F1-model_v4 MBL fold metallo-hydrolase 0.9722 3 212 GO:0016787
AF-A0A7T9QH44-F1-model_v4 deleted 0.971 2 201

Map