F449773

General Info

Members Datasets Scaffolds Average Seq Length
466 336 348 417

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935675223|2935680058
Length 463
Sequence RSRGRSPSILSTITRHTAKAGMPVGRRCRNHLEVCQMAQRANQNRQANHALDAANFFLADVRDGLGPYLAIYLLTEQKWDEARIGMVMSIAGLAGVVAQTPAGALIDTTKAKRLVMVTAALVVTLASLLLPMFPSFWAVAISQGAAHAAGVIFPPAIAAVSLGVVGHRAFTARIGRNETFNHAGNATAAAIAGLSAYLFGPTVVFYLLAMMSLASIVSVWAIPESAIDHDLARGLHDVGPGTAQVQDQPAGLNVLLTCRPLLIFAVCVTLFHLSNAAMLPLVGQKLALQDKNLGTSLMSACIIAAQIMMVPMAMLVGAKADDWGHRRLFLAALLILPIRGALYTLSDNPAWLVGVQLLDGVGAGIFGAIFPVIVADLMRNTGRFNVAQGAVITAQSIGAALSTSLSGLVVVGAGYSAAFLTLGAVAAIGAAICFLTLPETRNFSRRSRRWQRVAGSTTGVAAE

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
10 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
11 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
12 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
13 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
14 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
15 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
16 2643221594 Achromobacter sp. Root170 Isolate Unclassified
17 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
18 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
19 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
20 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
21 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
22 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
23 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
24 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
25 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
26 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
27 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
28 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
29 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
30 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
31 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
32 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
33 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
34 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
35 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
36 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
37 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
38 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
39 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
40 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
41 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
42 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
43 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
44 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
45 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
46 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
47 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
48 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
49 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
50 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
51 2904699407
52 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
53 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
54 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
55 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
56 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
57 2922368715
58 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
59 2922425934
60 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
61 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
62 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
63 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
64 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
65 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
66 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
67 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
68 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
69 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
70 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
71 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
72 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
73 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
74 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
75 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
76 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
77 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
78 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
79 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
80 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
81 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
82 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
83 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
84 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
85 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
86 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
87 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
88 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
89 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
90 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
91 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
92 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
93 2941479691
94 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
95 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
96 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
97 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
98 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
99 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
100 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
101 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
102 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
103 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
104 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
107 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
108 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
109 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
110 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
111 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
112 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
113 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
114 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
115 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
116 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
123 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
124 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
127 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
136 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
139 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
140 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
156 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
158 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
192 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
193 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
194 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
197 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
198 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
292 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
295 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
296 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
297 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
298 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
299 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
300 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
301 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
302 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
310 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
311 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
312 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
315 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
316 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
317 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
318 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
319 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
320 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
321 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
322 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
323 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
324 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
325 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
326 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
327 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
328 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
329 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
330 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
331 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
332 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
333 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
334 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
335 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
336 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.16
Metatranscriptomes 0
Isolates 24.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.96
Nodule 19.74
Rhizoplane 3
Rhizosphere 37.34
Stem 0
Stem Tuber 0
Unclassified 19.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001946 3300003215 Bacteria 12244
2 JGI25153J46596_10004061 3300003215 Bacteria 7971
3 JGI25160J50197_1002244 3300003354 Bacteria 9076
4 Ga0055543_1001918 3300004625 Bacteria 7460
5 Ga0065165_1001964 3300005262 Bacteria 19484
6 Ga0065165_1002049 3300005262 Bacteria 18679
7 Ga0065165_1008770 3300005262 Bacteria 4660
8 Ga0068869_100043227 3300005334 Bacteria 3235
9 Ga0068868_100218513 3300005338 Bacteria 1595
10 Ga0070660_100070845 3300005339 Bacteria 2721
11 Ga0070668_100076386 3300005347 Bacteria 2616
12 Ga0070667_100166424 3300005367 Bacteria 1945
13 Ga0070709_10002327 3300005434 Bacteria 10299
14 Ga0070709_10012136 3300005434 Bacteria 4816
15 Ga0070709_10030380 3300005434 Bacteria 3242
16 Ga0070714_100023123 3300005435 Bacteria 5102
17 Ga0070713_100011577 3300005436 Bacteria 6430
18 Ga0070713_100036595 3300005436 Bacteria 3962
19 Ga0070713_100128972 3300005436 Bacteria 2228
20 Ga0070710_10000243 3300005437 Bacteria 25537
21 Ga0070710_10005387 3300005437 Bacteria 6072
22 Ga0070710_10104723 3300005437 Bacteria 1690
23 Ga0070711_100005047 3300005439 Bacteria 7857
24 Ga0070711_100023909 3300005439 Bacteria 3980
25 Ga0070711_100163411 3300005439 Bacteria 1690
26 Ga0070663_100000924 3300005455 Bacteria 15940
27 Ga0070663_100048150 3300005455 Bacteria 3021
28 Ga0070678_100055060 3300005456 Bacteria 2902
29 Ga0070685_10085967 3300005466 Bacteria 1895
30 Ga0070706_100041015 3300005467 Bacteria 4274
31 Ga0070698_100085668 3300005471 Bacteria 3137
32 Ga0070679_100080633 3300005530 Bacteria 3244
33 Ga0070665_100021790 3300005548 Bacteria 6443
34 Ga0070665_100050431 3300005548 Bacteria 4176
35 Ga0070665_100078885 3300005548 Bacteria 3299
36 Ga0070665_100225017 3300005548 Bacteria 1876
37 Ga0068855_100154691 3300005563 Bacteria 2606
38 Ga0068857_100046311 3300005577 Bacteria 3859
39 Ga0068859_100099818 3300005617 Bacteria 2958
40 Ga0068863_100231685 3300005841 Bacteria 1782
41 Ga0068860_100071325 3300005843 Bacteria 3301
42 Ga0081540_1003760 3300005983 Bacteria 11893
43 Ga0070717_10002844 3300006028 Bacteria 12270
44 Ga0070717_10189197 3300006028 Bacteria 1798
45 Ga0075365_10003658 3300006038 Bacteria 7976
46 Ga0075365_10035290 3300006038 Bacteria 3234
47 Ga0075365_10070098 3300006038 Bacteria 2357
48 Ga0075368_10042462 3300006042 Bacteria 1789
49 Ga0075363_100017762 3300006048 Bacteria 3533
50 Ga0075364_10047562 3300006051 Bacteria 2795
51 Ga0070716_100004129 3300006173 Bacteria 6890
52 Ga0070712_100005787 3300006175 Bacteria 7642
53 Ga0070712_100012116 3300006175 Bacteria 5479
54 Ga0075367_10028585 3300006178 Bacteria 3182
55 Ga0075367_10038267 3300006178 Bacteria 2792
56 Ga0075367_10055497 3300006178 Bacteria 2351
57 Ga0075367_10079376 3300006178 Bacteria 1983
58 Ga0075369_10077669 3300006186 Bacteria 1469
59 Ga0075366_10078936 3300006195 Bacteria 1964
60 Ga0075366_10091838 3300006195 Bacteria 1819
61 Ga0075370_10017942 3300006353 Bacteria 3831
62 Ga0075370_10036147 3300006353 Bacteria 2774
63 Ga0075370_10075582 3300006353 Bacteria 1931
64 Ga0068871_100035845 3300006358 Bacteria 3945
65 Ga0075434_100041351 3300006871 Bacteria 4567
66 Ga0097620_100099818 3300006931 Bacteria 2958
67 Ga0099824_1011728 3300006942 Bacteria 9798
68 Ga0099824_1028675 3300006942 Bacteria 2487
69 Ga0099822_1003331 3300006943 Bacteria 20558
70 Ga0099794_10008353 3300007265 Bacteria 4297
71 Ga0105240_10033003 3300009093 Bacteria 6694
72 Ga0105240_10291183 3300009093 Bacteria 1872
73 Ga0105245_10103373 3300009098 Bacteria 2639
74 Ga0105241_10018648 3300009174 Bacteria 5108
75 Ga0105241_10019468 3300009174 Bacteria 5005
76 Ga0105248_10340878 3300009177 Bacteria 1687
77 Ga0105237_10001286 3300009545 Bacteria 33400
78 Ga0105237_10162728 3300009545 Bacteria 2230
79 Ga0105238_10011696 3300009551 Bacteria 8846
80 Ga0105238_10205362 3300009551 Bacteria 1946
81 Ga0105239_10061496 3300010375 Bacteria 4122
82 Ga0105239_10062604 3300010375 Bacteria 4084
83 Ga0157369_10002440 3300013105 Bacteria 22333
84 Ga0157378_10320331 3300013297 Bacteria 1506
85 Ga0163162_10184305 3300013306 Bacteria 2214
86 Ga0163163_10082045 3300014325 Bacteria 3227
87 Ga0157379_10130981 3300014968 Bacteria 2258
88 Ga0213874_10013512 3300021377 Bacteria 2117
89 Ga0213876_10014284 3300021384 Bacteria 4209
90 Ga0213875_10004662 3300021388 Bacteria 7470
91 Ga0209677_100648 3300025253 Bacteria 18413
92 Ga0209233_1008305 3300025261 Bacteria 3223
93 Ga0209455_1016512 3300025272 Bacteria 1583
94 Ga0209676_1002272 3300025292 Bacteria 14115
95 Ga0209758_1000216 3300025297 Bacteria 125352
96 Ga0209758_1018214 3300025297 Bacteria 3455
97 Ga0209758_1027796 3300025297 Bacteria 2409
98 Ga0209050_1004144 3300025298 Bacteria 10048
99 Ga0209256_1003514 3300025299 Bacteria 10913
100 Ga0207426_1000611 3300025302 Bacteria 46127
101 Ga0207426_1001360 3300025302 Bacteria 20729
102 Ga0207426_1019852 3300025302 Bacteria 2343
103 Ga0209257_1001630 3300025304 Bacteria 25715
104 Ga0207692_10000577 3300025898 Bacteria 13067
105 Ga0207692_10006885 3300025898 Bacteria 4632
106 Ga0207688_10013193 3300025901 Bacteria 4491
107 Ga0207688_10070454 3300025901 Bacteria 1983
108 Ga0207680_10095946 3300025903 Bacteria 1896
109 Ga0207699_10000577 3300025906 Bacteria 18050
110 Ga0207699_10001804 3300025906 Bacteria 10060
111 Ga0207705_10185590 3300025909 Bacteria 1571
112 Ga0207654_10051067 3300025911 Bacteria 2378
113 Ga0207654_10076574 3300025911 Bacteria 2003
114 Ga0207695_10000342 3300025913 Bacteria 108393
115 Ga0207671_10048883 3300025914 Bacteria 3130
116 Ga0207693_10010254 3300025915 Bacteria 7606
117 Ga0207693_10019843 3300025915 Bacteria 5345
118 Ga0207663_10001790 3300025916 Bacteria 10133
119 Ga0207663_10010860 3300025916 Bacteria 4864
120 Ga0207663_10121875 3300025916 Bacteria 1787
121 Ga0207657_10094145 3300025919 Bacteria 2495
122 Ga0207652_10030606 3300025921 Bacteria 4509
123 Ga0207700_10027974 3300025928 Bacteria 3956
124 Ga0207700_10034010 3300025928 Bacteria 3654
125 Ga0207664_10002857 3300025929 Bacteria 11472
126 Ga0207664_10087477 3300025929 Bacteria 2547
127 Ga0207706_10201231 3300025933 Bacteria 1747
128 Ga0207709_10110278 3300025935 Bacteria 1838
129 Ga0207665_10018413 3300025939 Bacteria 4589
130 Ga0207665_10052813 3300025939 Bacteria 2738
131 Ga0207689_10098312 3300025942 Bacteria 2404
132 Ga0207677_10201054 3300026023 Bacteria 1584
133 Ga0207678_10000808 3300026067 Bacteria 28722
134 Ga0207678_10035964 3300026067 Bacteria 4311
135 Ga0207678_10044806 3300026067 Bacteria 3825
136 Ga0207708_10215450 3300026075 Bacteria 1536
137 Ga0207641_10145885 3300026088 Bacteria 2140
138 Ga0207676_10102217 3300026095 Bacteria 2379
139 Ga0207674_10057473 3300026116 Bacteria 3943
140 Ga0207675_100202567 3300026118 Bacteria 1906
141 Ga0207683_10110237 3300026121 Bacteria 2464
142 Ga0209389_1000196 3300027296 Bacteria 43831
143 Ga0209389_1000284 3300027296 Bacteria 31998
144 Ga0209589_1000003 3300027357 Bacteria 629130
145 Ga0209589_1001029 3300027357 Bacteria 43810
146 Ga0209489_100003 3300027361 Bacteria 663105
147 Ga0209489_101824 3300027361 Bacteria 43831
148 Ga0209700_100003 3300027363 Bacteria 663105
149 Ga0209700_103273 3300027363 Bacteria 31313
150 Ga0268266_10003236 3300028379 Bacteria 16447
151 Ga0268266_10039251 3300028379 Bacteria 4032
152 Ga0268266_10168214 3300028379 Bacteria 1988
153 Ga0265337_1001969 3300028556 Bacteria 9766
154 Ga0265334_10001941 3300028573 Bacteria 9811
155 Ga0265336_10000322 3300028666 Bacteria 32476
156 Ga0265338_10001338 3300028800 Bacteria 40180
157 Ga0265324_10006069 3300029957 Bacteria 5105
158 Ga0265340_10045050 3300031247 Bacteria 2156
159 Ga0307509_10001966 3300031507 Bacteria 33940
160 Ga0307408_100075483 3300031548 Bacteria 2505
161 Ga0315911_1000005 3300033442 Bacteria 426255
162 Ga0373926_0020886 3300035083 Bacteria 2264
163 Ga0373934_0039102 3300035086 Bacteria 1869
164 Ga0373923_0001456 3300035111 Bacteria 6795
165 Ga0373936_0008712 3300035113 Bacteria 3820
166 Ga0373956_0005465 3300035119 Bacteria 5090
167 Ga0373943_0018435 3300035170 Bacteria 3207
168 Ga0373946_0010700 3300035171 Bacteria 3405
169 Ga0373927_0101679 3300035695 Bacteria 1869
170 Ga0373925_0201036 3300037068 Bacteria 1584
171 Ga0395900_0031878 3300037418 Bacteria 5418
172 Ga0395898_0003145 3300037466 Bacteria 18639
173 Ga0395898_0032607 3300037466 Bacteria 5201
174 Ga0395905_0012493 3300037471 Bacteria 8173
175 Ga0436364_0293754 3300037853 Bacteria 44649
176 Ga0436364_0753756 3300037853 Bacteria 2025
177 Ga0395901_0335247 3300038443 Bacteria 1563
178 Ga0436365_0007077 3300039437 Bacteria 42426
179 Ga0436365_0110080 3300039437 Bacteria 8767
180 Ga0436365_1367297 3300039437 Bacteria 3904
181 Ga0436365_1382877 3300039437 Bacteria 4774
182 Ga0436365_1582582 3300039437 Bacteria 2062
183 Ga0436360_0156797 3300039438 Bacteria 1381
184 Ga0436360_0461655 3300039438 Bacteria 4164
185 Ga0436360_0504339 3300039438 Bacteria 2274
186 Ga0436361_0578065 3300039447 Bacteria 2832
187 Ga0436363_1111134 3300039450 Bacteria 7025
188 Ga0436362_1080124 3300039453 Bacteria 2600
189 Ga0466972_0000149 3300044658 Bacteria 56799
190 Ga0466972_0001784 3300044658 Bacteria 10536
191 Ga0466972_0003999 3300044658 Bacteria 7345
192 Ga0466961_0042155 3300044693 Bacteria 2926
193 Ga0495629_0088117 3300046459 Bacteria 2165
194 Ga0495629_0101904 3300046459 Bacteria 2003
195 Ga0495638_0004117 3300046460 Bacteria 11125
196 Ga0495638_0005756 3300046460 Bacteria 9127
197 Ga0495638_0015848 3300046460 Bacteria 5050
198 Ga0495638_0016377 3300046460 Bacteria 4966
199 Ga0495638_0119798 3300046460 Bacteria 1556
200 Ga0495580_0012067 3300046472 Bacteria 6650
201 Ga0495662_0100887 3300046476 Bacteria 1412
202 Ga0495664_0015855 3300046477 Bacteria 4287
203 Ga0495596_0032780 3300046500 Bacteria 2070
204 Ga0495607_0020105 3300046501 Bacteria 4227
205 Ga0495608_0144207 3300046511 Bacteria 1519
206 Ga0495616_0062889 3300046513 Bacteria 1816
207 Ga0495618_0021343 3300046514 Bacteria 3992
208 Ga0495620_0027521 3300046515 Bacteria 2659
209 Ga0495630_0051706 3300046517 Bacteria 3075
210 Ga0495632_0050593 3300046519 Bacteria 2048
211 Ga0495643_0061691 3300046522 Bacteria 1987
212 Ga0495644_0042139 3300046523 Bacteria 1719
213 Ga0495648_0074874 3300046524 Bacteria 1949
214 Ga0495665_0016517 3300046531 Bacteria 3977
215 Ga0495640_0017387 3300046533 Bacteria 5362
216 Ga0495645_0088934 3300046543 Bacteria 2208
217 Ga0495625_0124350 3300046660 Bacteria 1752
218 Ga0495661_0019835 3300046665 Bacteria 4398
219 Ga0495588_0055737 3300046674 Bacteria 2040
220 Ga0495588_0080550 3300046674 Bacteria 1699
221 Ga0495599_0055384 3300046678 Bacteria 2484
222 Ga0495624_0065711 3300046690 Bacteria 2265
223 Ga0495581_0020687 3300047315 Bacteria 3816
224 Ga0495672_0000153 3300047320 Bacteria 100183
225 Ga0495673_0023779 3300047469 Bacteria 2973
226 Ga0495684_0010100 3300047471 Bacteria 7300
227 Ga0495686_0049612 3300047472 Bacteria 2640
228 Ga0496102_0234296 3300048905 Bacteria 1731
229 Ga0496103_0036389 3300048906 Bacteria 3015
230 Ga0496104_0007905 3300048907 Bacteria 9429
231 Ga0496105_0233249 3300048908 Bacteria 1495
232 Ga0496106_0141901 3300048909 Bacteria 1890
233 Ga0496108_0043667 3300048911 Bacteria 3744
234 Ga0496108_0089358 3300048911 Bacteria 2618
235 Ga0496109_0011738 3300048912 Bacteria 7538
236 Ga0496110_0127779 3300048913 Bacteria 2294
237 Ga0496112_0236650 3300048915 Bacteria 1780
238 Ga0496115_0033706 3300048918 Bacteria 4044
239 Ga0496115_0098752 3300048918 Bacteria 2392
240 Ga0496115_0189382 3300048918 Bacteria 1700
241 Ga0496116_0002393 3300048919 Bacteria 19774
242 Ga0496116_0016305 3300048919 Bacteria 5818
243 Ga0496116_0016496 3300048919 Bacteria 5775
244 Ga0496116_0020008 3300048919 Bacteria 5099
245 Ga0496116_0035626 3300048919 Bacteria 3492
246 Ga0496117_0045577 3300048920 Bacteria 3165
247 Ga0496117_0057053 3300048920 Bacteria 2715
248 Ga0496118_0011416 3300048921 Bacteria 8672
249 Ga0496118_0023940 3300048921 Bacteria 5286
250 Ga0496118_0051532 3300048921 Bacteria 3148
251 Ga0496118_0111024 3300048921 Bacteria 1819
252 Ga0496119_0018836 3300048922 Bacteria 5114
253 Ga0496119_0095173 3300048922 Bacteria 1683
254 Ga0496120_0042401 3300048923 Bacteria 2657
255 Ga0496120_0046208 3300048923 Bacteria 2517
256 Ga0496121_0000094 3300048924 Bacteria 212726
257 Ga0496121_0000214 3300048924 Bacteria 127349
258 Ga0496121_0002554 3300048924 Bacteria 27574
259 Ga0496121_0008280 3300048924 Bacteria 12300
260 Ga0496121_0016222 3300048924 Bacteria 7708
261 Ga0496121_0031776 3300048924 Bacteria 4815
262 Ga0496121_0042304 3300048924 Bacteria 3966
263 Ga0496121_0066096 3300048924 Bacteria 2938
264 Ga0496121_0069934 3300048924 Bacteria 2830
265 Ga0496122_0000077 3300048925 Bacteria 218099
266 Ga0496122_0015290 3300048925 Bacteria 7342
267 Ga0496122_0034894 3300048925 Bacteria 4106
268 Ga0496123_0000526 3300048926 Bacteria 65966
269 Ga0496123_0016472 3300048926 Bacteria 5999
270 Ga0496123_0025210 3300048926 Bacteria 4490
271 Ga0496123_0106139 3300048926 Bacteria 1619
272 Ga0496124_0070795 3300048927 Bacteria 2892
273 Ga0496124_0077903 3300048927 Bacteria 2733
274 Ga0496124_0083494 3300048927 Bacteria 2620
275 Ga0496125_0000259 3300048928 Bacteria 109184
276 Ga0496125_0000904 3300048928 Bacteria 46904
277 Ga0496125_0026703 3300048928 Bacteria 5250
278 Ga0496125_0077064 3300048928 Bacteria 2572
279 Ga0496126_0004022 3300048929 Bacteria 17912
280 Ga0496126_0005193 3300048929 Bacteria 15036
281 Ga0496126_0012423 3300048929 Bacteria 8726
282 Ga0496126_0017791 3300048929 Bacteria 7075
283 Ga0496126_0060551 3300048929 Bacteria 3404
284 Ga0496126_0151024 3300048929 Bacteria 1991
285 Ga0501070_0055735 3300049586 Bacteria 3276
286 Ga0501073_0071669 3300049589 Bacteria 2414
287 Ga0501074_0102014 3300049590 Bacteria 2054
288 nmdc:mga03n38_25837_c1 3300050490 Bacteria 2418
289 nmdc:mga00v17_16554_c1 3300050491 Bacteria 4155
290 nmdc:mga0yw44_57322_c1 3300050492 Bacteria 2376
291 nmdc:mga0yw44_80968_c1 3300050492 Bacteria 2035
292 nmdc:mga0yw44_8327_c1 3300050492 Bacteria 5156
293 nmdc:mga0k408_76410_c1 3300050493 Bacteria 1957
294 nmdc:mga06z11_58983_c1 3300050494 Bacteria 1993
295 nmdc:mga04h51_21991_c1 3300050495 Bacteria 1924
296 nmdc:mga07m45_1913_c3 3300050496 Bacteria 7218
297 nmdc:mga07m45_78149_c1 3300050496 Bacteria 1888
298 nmdc:mga0n895_42638_c1 3300050512 Bacteria 4415
299 nmdc:mga0rr50_46539_c1 3300050513 Bacteria 3194
300 nmdc:mga0sz30_70694_c1 3300050516 Bacteria 1502
301 Ga0495601_0142383 3300053077 Bacteria 1564
302 Ga0495612_0016968 3300053078 Bacteria 2917
303 Ga0500635_0000728 3300053080 Bacteria 8254
304 Ga0500635_0002189 3300053080 Bacteria 4805
305 Ga0500581_026256 3300053089 Bacteria 2966
306 Ga0500651_0048062 3300053093 Bacteria 2682
307 Ga0500651_0120092 3300053093 Bacteria 1596
308 Ga0500566_0000017 3300053094 Bacteria 93636
309 Ga0500566_0018903 3300053094 Bacteria 4045
310 Ga0500640_000030 3300053095 Bacteria 21521
311 Ga0500556_0000051 3300053104 Bacteria 119031
312 Ga0500557_000001 3300053105 Bacteria 241298
313 Ga0500562_007506 3300053108 Bacteria 2750
314 Ga0500569_020920 3300053109 Bacteria 1723
315 Ga0500572_000051 3300053111 Bacteria 35133
316 Ga0500572_000209 3300053111 Bacteria 20713
317 Ga0500592_001249 3300053116 Bacteria 4143
318 Ga0500595_002354 3300053119 Bacteria 9447
319 Ga0500608_027410 3300053122 Bacteria 2685
320 Ga0500614_000403 3300053123 Bacteria 11258
321 Ga0500642_0000077 3300053130 Bacteria 53422
322 Ga0500642_0000218 3300053130 Bacteria 22730
323 Ga0500652_007408 3300053131 Bacteria 3593
324 Ga0500559_0000217 3300053136 Bacteria 46155
325 Ga0500559_0000419 3300053136 Bacteria 30438
326 Ga0500559_0000767 3300053136 Bacteria 21035
327 Ga0500568_0002115 3300053139 Bacteria 11995
328 Ga0500586_025794 3300053145 Bacteria 1898
329 Ga0500590_032261 3300053148 Bacteria 2717
330 Ga0500603_000079 3300053150 Bacteria 22213
331 Ga0500603_000265 3300053150 Bacteria 13804
332 Ga0500604_0002537 3300053151 Bacteria 4983
333 Ga0500616_0000150 3300053153 Bacteria 117918
334 Ga0500622_0000277 3300053156 Bacteria 52401
335 Ga0500622_0002661 3300053156 Bacteria 12677
336 Ga0500630_000137 3300053159 Bacteria 25742
337 Ga0500639_000015 3300053163 Bacteria 119636
338 Ga0500636_0025308 3300053177 Bacteria 3506
339 Ga0500637_0005671 3300053178 Bacteria 6068
340 Ga0500637_0029224 3300053178 Bacteria 3056
341 Ga0500637_0094955 3300053178 Bacteria 1727
342 Ga0500570_080169 3300053724 Bacteria 1475
343 Ga0500625_000230 3300053729 Bacteria 12911
344 Ga0500645_008399 3300053730 Bacteria 3531
345 Ga0500596_000046 3300053735 Bacteria 16367
346 Ga0500596_000203 3300053735 Bacteria 9886
347 Ga0500601_001042 3300053737 Bacteria 3155
348 Ga0500601_002202 3300053737 Bacteria 2094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025916 Ga0207663_10010860 Ga0207663_100108602 335
2 3300048905 Ga0496102_0234296 Ga0496102_0234296_38_1126 341
3 3300048923 Ga0496120_0046208 Ga0496120_0046208_1432_2481 343
4 3300048911 Ga0496108_0089358 Ga0496108_0089358_1452_2588 348
5 3300026075 Ga0207708_10215450 Ga0207708_102154501 350
6 iso_pu_bacteria 2643221594 2643982535 354
7 iso_pu_bacteria 2935769743 2935776325 358
8 iso_pu_bacteria 2935785616 2935790314 358
9 iso_pu_bacteria 2935793552 2935798897 358
10 3300005338 Ga0068868_100218513 Ga0068868_1002185132 364
11 3300026023 Ga0207677_10201054 Ga0207677_102010542 367
12 3300005436 Ga0070713_100011577 Ga0070713_1000115776 369
13 3300006028 Ga0070717_10189197 Ga0070717_101891973 369
14 3300025928 Ga0207700_10027974 Ga0207700_100279743 369
15 3300048919 Ga0496116_0020008 Ga0496116_0020008_1238_2440 373
16 3300035083 Ga0373926_0020886 Ga0373926_0020886_272_1564 375
17 3300035086 Ga0373934_0039102 Ga0373934_0039102_498_1790 375
18 3300035111 Ga0373923_0001456 Ga0373923_0001456_3971_5263 375
19 3300035113 Ga0373936_0008712 Ga0373936_0008712_600_1892 375
20 3300035119 Ga0373956_0005465 Ga0373956_0005465_3729_5021 375
21 3300035170 Ga0373943_0018435 Ga0373943_0018435_498_1790 375
22 3300035171 Ga0373946_0010700 Ga0373946_0010700_2085_3377 375
23 3300035695 Ga0373927_0101679 Ga0373927_0101679_316_1608 375
24 3300037068 Ga0373925_0201036 Ga0373925_0201036_177_1469 375
25 3300046459 Ga0495629_0088117 Ga0495629_0088117_173_1465 375
26 3300046472 Ga0495580_0012067 Ga0495580_0012067_2520_3812 375
27 3300046476 Ga0495662_0100887 Ga0495662_0100887_106_1398 375
28 3300046511 Ga0495608_0144207 Ga0495608_0144207_10_1302 375
29 3300046514 Ga0495618_0021343 Ga0495618_0021343_2398_3690 375
30 3300046517 Ga0495630_0051706 Ga0495630_0051706_1286_2578 375
31 3300046531 Ga0495665_0016517 Ga0495665_0016517_600_1892 375
32 3300046533 Ga0495640_0017387 Ga0495640_0017387_3711_5003 375
33 3300046690 Ga0495624_0065711 Ga0495624_0065711_153_1445 375
34 3300047315 Ga0495581_0020687 Ga0495581_0020687_403_1695 375
35 3300047471 Ga0495684_0010100 Ga0495684_0010100_4103_5395 375
36 3300005456 Ga0070678_100055060 Ga0070678_1000550601 377
37 3300048919 Ga0496116_0016305 Ga0496116_0016305_4426_5625 378
38 3300048924 Ga0496121_0066096 Ga0496121_0066096_1536_2735 378
39 3300048925 Ga0496122_0000077 Ga0496122_0000077_140858_142057 378
40 3300048926 Ga0496123_0000526 Ga0496123_0000526_46678_47877 378
41 3300048927 Ga0496124_0083494 Ga0496124_0083494_77_1276 378
42 3300048928 Ga0496125_0026703 Ga0496125_0026703_1245_2444 378
43 3300005577 Ga0068857_100046311 Ga0068857_1000463112 379
44 3300026116 Ga0207674_10057473 Ga0207674_100574732 379
45 3300039438 Ga0436360_0156797 Ga0436360_0156797_44_1297 379
46 3300005467 Ga0070706_100041015 Ga0070706_1000410154 380
47 3300006028 Ga0070717_10002844 Ga0070717_100028445 380
48 3300013306 Ga0163162_10184305 Ga0163162_101843052 381
49 3300006038 Ga0075365_10035290 Ga0075365_100352902 382
50 3300025933 Ga0207706_10201231 Ga0207706_102012312 382
51 3300025935 Ga0207709_10110278 Ga0207709_101102781 382
52 3300050492 nmdc:mga0yw44_57322_c1 nmdc:mga0yw44_57322_c1_729_1997 382
53 3300006038 Ga0075365_10070098 Ga0075365_100700982 383
54 3300006042 Ga0075368_10042462 Ga0075368_100424622 383
55 3300006178 Ga0075367_10079376 Ga0075367_100793762 383
56 3300048924 Ga0496121_0042304 Ga0496121_0042304_2368_3660 383
57 3300048929 Ga0496126_0017791 Ga0496126_0017791_846_2138 383
58 3300050492 nmdc:mga0yw44_80968_c1 nmdc:mga0yw44_80968_c1_261_1505 383
59 3300006178 Ga0075367_10055497 Ga0075367_100554972 384
60 3300025292 Ga0209676_1002272 Ga0209676_10022726 384
61 3300025298 Ga0209050_1004144 Ga0209050_10041448 384
62 3300048919 Ga0496116_0035626 Ga0496116_0035626_61_1296 384
63 3300048921 Ga0496118_0023940 Ga0496118_0023940_4023_5258 384
64 3300048922 Ga0496119_0018836 Ga0496119_0018836_648_1883 384
65 3300048923 Ga0496120_0042401 Ga0496120_0042401_685_1920 384
66 3300048924 Ga0496121_0000094 Ga0496121_0000094_42234_43469 384
67 3300048925 Ga0496122_0034894 Ga0496122_0034894_2404_3639 384
68 3300048926 Ga0496123_0025210 Ga0496123_0025210_472_1707 384
69 3300048927 Ga0496124_0077903 Ga0496124_0077903_240_1553 384
70 3300048928 Ga0496125_0000259 Ga0496125_0000259_50966_52201 384
71 3300048929 Ga0496126_0005193 Ga0496126_0005193_2373_3608 384
72 3300050494 nmdc:mga06z11_58983_c1 nmdc:mga06z11_58983_c1_91_1404 384
73 3300005439 Ga0070711_100005047 Ga0070711_1000050478 385
74 3300006175 Ga0070712_100012116 Ga0070712_1000121164 385
75 3300025939 Ga0207665_10018413 Ga0207665_100184135 385
76 3300005334 Ga0068869_100043227 Ga0068869_1000432272 388
77 3300005843 Ga0068860_100071325 Ga0068860_1000713252 388
78 3300025942 Ga0207689_10098312 Ga0207689_100983122 388
79 3300048929 Ga0496126_0004022 Ga0496126_0004022_13945_15192 388
80 3300053148 Ga0500590_032261 Ga0500590_032261_1031_2278 388
81 3300031548 Ga0307408_100075483 Ga0307408_1000754832 389
82 3300037471 Ga0395905_0012493 Ga0395905_0012493_3534_4817 389
83 3300026067 Ga0207678_10044806 Ga0207678_100448063 390
84 3300005455 Ga0070663_100000924 Ga0070663_1000009246 391
85 3300005548 Ga0070665_100021790 Ga0070665_1000217903 391
86 3300006038 Ga0075365_10003658 Ga0075365_100036583 391
87 3300006048 Ga0075363_100017762 Ga0075363_1000177623 391
88 3300006353 Ga0075370_10017942 Ga0075370_100179422 391
89 3300014325 Ga0163163_10082045 Ga0163163_100820452 391
90 3300026067 Ga0207678_10000808 Ga0207678_100008089 391
91 3300026095 Ga0207676_10102217 Ga0207676_101022172 391
92 3300026121 Ga0207683_10110237 Ga0207683_101102371 391
93 3300028379 Ga0268266_10039251 Ga0268266_100392513 391
94 3300048908 Ga0496105_0233249 Ga0496105_0233249_97_1335 391
95 3300048918 Ga0496115_0033706 Ga0496115_0033706_2460_3698 391
96 3300048924 Ga0496121_0069934 Ga0496121_0069934_161_1429 391
97 3300050490 nmdc:mga03n38_25837_c1 nmdc:mga03n38_25837_c1_96_1334 391
98 3300050491 nmdc:mga00v17_16554_c1 nmdc:mga00v17_16554_c1_2263_3501 391
99 3300050495 nmdc:mga04h51_21991_c1 nmdc:mga04h51_21991_c1_58_1296 391
100 3300050496 nmdc:mga07m45_1913_c3 nmdc:mga07m45_1913_c3_5453_6691 391
101 3300005983 Ga0081540_1003760 Ga0081540_10037604 392
102 3300005436 Ga0070713_100036595 Ga0070713_1000365952 393
103 3300039437 Ga0436365_0110080 Ga0436365_0110080_5600_6949 393
104 3300053724 Ga0500570_080169 Ga0500570_080169_55_1302 393
105 3300046543 Ga0495645_0088934 Ga0495645_0088934_100_1356 394
106 3300046678 Ga0495599_0055384 Ga0495599_0055384_378_1634 394
107 3300025915 Ga0207693_10019843 Ga0207693_100198433 395
108 3300048909 Ga0496106_0141901 Ga0496106_0141901_493_1743 395
109 3300048919 Ga0496116_0002393 Ga0496116_0002393_18238_19488 395
110 3300048929 Ga0496126_0151024 Ga0496126_0151024_718_1935 395
111 3300021377 Ga0213874_10013512 Ga0213874_100135122 396
112 3300039450 Ga0436363_1111134 Ga0436363_1111134_3547_4842 396
113 3300005530 Ga0070679_100080633 Ga0070679_1000806332 397
114 3300009093 Ga0105240_10291183 Ga0105240_102911831 397
115 3300025921 Ga0207652_10030606 Ga0207652_100306064 397
116 3300050513 nmdc:mga0rr50_46539_c1 nmdc:mga0rr50_46539_c1_1361_2656 397
117 3300006353 Ga0075370_10036147 Ga0075370_100361472 398
118 3300009177 Ga0105248_10340878 Ga0105248_103408781 398
119 3300009545 Ga0105237_10162728 Ga0105237_101627282 398
120 3300048907 Ga0496104_0007905 Ga0496104_0007905_3733_5064 398
121 3300048912 Ga0496109_0011738 Ga0496109_0011738_982_2313 398
122 3300050516 nmdc:mga0sz30_70694_c1 nmdc:mga0sz30_70694_c1_244_1473 398
123 3300005347 Ga0070668_100076386 Ga0070668_1000763862 399
124 3300005367 Ga0070667_100166424 Ga0070667_1001664242 399
125 3300005466 Ga0070685_10085967 Ga0070685_100859671 399
126 3300005548 Ga0070665_100050431 Ga0070665_1000504312 399
127 3300005617 Ga0068859_100099818 Ga0068859_1000998183 399
128 3300006051 Ga0075364_10047562 Ga0075364_100475622 399
129 3300006931 Ga0097620_100099818 Ga0097620_1000998183 399
130 3300007265 Ga0099794_10008353 Ga0099794_100083535 399
131 3300025901 Ga0207688_10013193 Ga0207688_100131935 399
132 3300025903 Ga0207680_10095946 Ga0207680_100959461 399
133 3300028379 Ga0268266_10003236 Ga0268266_1000323618 399
134 3300046500 Ga0495596_0032780 Ga0495596_0032780_776_2005 399
135 3300048924 Ga0496121_0000214 Ga0496121_0000214_45321_46586 399
136 3300053077 Ga0495601_0142383 Ga0495601_0142383_197_1453 399
137 3300028556 Ga0265337_1001969 Ga0265337_10019698 400
138 3300028573 Ga0265334_10001941 Ga0265334_100019415 400
139 3300028666 Ga0265336_10000322 Ga0265336_1000032217 400
140 3300028800 Ga0265338_10001338 Ga0265338_1000133822 400
141 3300029957 Ga0265324_10006069 Ga0265324_100060695 400
142 iso_pu_bacteria 2941479691 2941484432 400
143 3300009174 Ga0105241_10018648 Ga0105241_100186483 401
144 3300021384 Ga0213876_10014284 Ga0213876_100142842 401
145 3300039437 Ga0436365_0007077 Ga0436365_0007077_13702_14997 401
146 3300039437 Ga0436365_1382877 Ga0436365_1382877_1455_2732 401
147 iso_pu_bacteria 2808606395 2809034645 401
148 3300005434 Ga0070709_10030380 Ga0070709_100303802 402
149 3300006942 Ga0099824_1011728 Ga0099824_10117282 402
150 3300006943 Ga0099822_1003331 Ga0099822_100333124 402
151 3300027357 Ga0209589_1000003 Ga0209589_1000003432 402
152 3300027361 Ga0209489_100003 Ga0209489_100003483 402
153 3300027363 Ga0209700_100003 Ga0209700_100003483 402
154 3300039447 Ga0436361_0578065 Ga0436361_0578065_1302_2573 402
155 3300048906 Ga0496103_0036389 Ga0496103_0036389_1281_2519 402
156 iso_pu_bacteria 2791355197 2793070268 402
157 iso_pu_bacteria 2922425934 2922426593 402
158 3300037853 Ga0436364_0753756 Ga0436364_0753756_24_1301 403
159 iso_pu_bacteria 8056689827 8056694171 403
160 3300005437 Ga0070710_10000243 Ga0070710_1000024312 404
161 3300005439 Ga0070711_100023909 Ga0070711_1000239092 404
162 3300005548 Ga0070665_100225017 Ga0070665_1002250171 404
163 3300005841 Ga0068863_100231685 Ga0068863_1002316852 404
164 3300006173 Ga0070716_100004129 Ga0070716_1000041297 404
165 3300006178 Ga0075367_10028585 Ga0075367_100285853 404
166 3300006186 Ga0075369_10077669 Ga0075369_100776691 404
167 3300006195 Ga0075366_10078936 Ga0075366_100789362 404
168 3300006353 Ga0075370_10075582 Ga0075370_100755821 404
169 3300006358 Ga0068871_100035845 Ga0068871_1000358451 404
170 3300013297 Ga0157378_10320331 Ga0157378_103203311 404
171 3300025297 Ga0209758_1018214 Ga0209758_10182142 404
172 3300025898 Ga0207692_10000577 Ga0207692_1000057712 404
173 3300025901 Ga0207688_10070454 Ga0207688_100704542 404
174 3300025906 Ga0207699_10000577 Ga0207699_1000057718 404
175 3300025916 Ga0207663_10001790 Ga0207663_100017902 404
176 3300025929 Ga0207664_10002857 Ga0207664_100028575 404
177 3300025939 Ga0207665_10052813 Ga0207665_100528133 404
178 3300026088 Ga0207641_10145885 Ga0207641_101458852 404
179 3300026118 Ga0207675_100202567 Ga0207675_1002025672 404
180 3300046523 Ga0495644_0042139 Ga0495644_0042139_274_1536 404
181 3300048911 Ga0496108_0043667 Ga0496108_0043667_671_1939 404
182 3300048913 Ga0496110_0127779 Ga0496110_0127779_126_1388 404
183 3300048915 Ga0496112_0236650 Ga0496112_0236650_277_1545 404
184 3300048918 Ga0496115_0189382 Ga0496115_0189382_400_1668 404
185 3300050493 nmdc:mga0k408_76410_c1 nmdc:mga0k408_76410_c1_634_1881 404
186 3300050496 nmdc:mga07m45_78149_c1 nmdc:mga07m45_78149_c1_346_1614 404
187 iso_pu_bacteria 2842333319 2842337328 404
188 iso_pu_bacteria 2893066018 2893067917 404
189 3300005436 Ga0070713_100128972 Ga0070713_1001289722 405
190 3300005471 Ga0070698_100085668 Ga0070698_1000856683 405
191 3300005548 Ga0070665_100078885 Ga0070665_1000788851 405
192 3300014968 Ga0157379_10130981 Ga0157379_101309812 405
193 3300046459 Ga0495629_0101904 Ga0495629_0101904_660_1907 405
194 3300046519 Ga0495632_0050593 Ga0495632_0050593_696_1943 405
195 3300046660 Ga0495625_0124350 Ga0495625_0124350_361_1608 405
196 3300046674 Ga0495588_0080550 Ga0495588_0080550_309_1556 405
197 iso_pu_bacteria 2513237096 2513657587 405
198 iso_pu_bacteria 2513237137 2513861637 405
199 iso_pu_bacteria 2513237145 2513916840 405
200 iso_pu_bacteria 2524023228 2524533085 405
201 iso_pu_bacteria 2602042107 2603862321 405
202 iso_pu_bacteria 2857524615 2857525792 405
203 iso_pu_bacteria 2897803580 2897809845 405
204 iso_pu_bacteria 2904699407 2904707491 405
205 iso_pu_bacteria 2908739725 2908746444 405
206 iso_pu_bacteria 2919073203 2919074346 405
207 iso_pu_bacteria 8006933436 8006937246 405
208 iso_pu_bacteria 8006973647 8006977257 405
209 iso_pu_bacteria 8019565922 8019571483 405
210 3300025272 Ga0209455_1016512 Ga0209455_10165122 406
211 3300033442 Ga0315911_1000005 Ga0315911_1000005137 406
212 3300046460 Ga0495638_0016377 Ga0495638_0016377_1923_3170 406
213 3300046522 Ga0495643_0061691 Ga0495643_0061691_139_1386 406
214 3300053093 Ga0500651_0048062 Ga0500651_0048062_929_2176 406
215 3300053094 Ga0500566_0018903 Ga0500566_0018903_1610_2857 406
216 3300053136 Ga0500559_0000419 Ga0500559_0000419_1685_2932 406
217 3300053139 Ga0500568_0002115 Ga0500568_0002115_8361_9608 406
218 3300053151 Ga0500604_0002537 Ga0500604_0002537_1961_3208 406
219 3300053153 Ga0500616_0000150 Ga0500616_0000150_1739_2986 406
220 3300053177 Ga0500636_0025308 Ga0500636_0025308_1990_3237 406
221 3300046460 Ga0495638_0015848 Ga0495638_0015848_2003_3253 407
222 3300046460 Ga0495638_0119798 Ga0495638_0119798_63_1313 407
223 3300046501 Ga0495607_0020105 Ga0495607_0020105_2242_3492 407
224 3300046513 Ga0495616_0062889 Ga0495616_0062889_432_1682 407
225 3300046515 Ga0495620_0027521 Ga0495620_0027521_1118_2368 407
226 3300046665 Ga0495661_0019835 Ga0495661_0019835_1005_2255 407
227 3300047472 Ga0495686_0049612 Ga0495686_0049612_88_1338 407
228 3300048920 Ga0496117_0045577 Ga0496117_0045577_1895_3145 407
229 3300048921 Ga0496118_0111024 Ga0496118_0111024_28_1278 407
230 3300048924 Ga0496121_0002554 Ga0496121_0002554_8824_10074 407
231 3300048925 Ga0496122_0015290 Ga0496122_0015290_4115_5365 407
232 3300048926 Ga0496123_0016472 Ga0496123_0016472_4708_5958 407
233 3300048927 Ga0496124_0070795 Ga0496124_0070795_280_1530 407
234 3300048928 Ga0496125_0000904 Ga0496125_0000904_40732_41982 407
235 3300053089 Ga0500581_026256 Ga0500581_026256_1671_2921 407
236 3300053093 Ga0500651_0120092 Ga0500651_0120092_24_1274 407
237 3300053104 Ga0500556_0000051 Ga0500556_0000051_2004_3254 407
238 3300053109 Ga0500569_020920 Ga0500569_020920_70_1320 407
239 3300053116 Ga0500592_001249 Ga0500592_001249_1686_2936 407
240 3300053130 Ga0500642_0000218 Ga0500642_0000218_19473_20723 407
241 3300053131 Ga0500652_007408 Ga0500652_007408_2250_3500 407
242 3300053145 Ga0500586_025794 Ga0500586_025794_154_1404 407
243 3300053156 Ga0500622_0002661 Ga0500622_0002661_2002_3252 407
244 3300028379 Ga0268266_10168214 Ga0268266_101682142 408
245 3300044658 Ga0466972_0001784 Ga0466972_0001784_8098_9507 408
246 3300046477 Ga0495664_0015855 Ga0495664_0015855_1503_2759 408
247 3300053078 Ga0495612_0016968 Ga0495612_0016968_1501_2757 408
248 iso_pu_bacteria 2508501114 2509078329 408
249 iso_pu_bacteria 2922386360 2922392292 408
250 3300021388 Ga0213875_10004662 Ga0213875_100046625 409
251 3300037853 Ga0436364_0293754 Ga0436364_0293754_16923_18275 409
252 3300039437 Ga0436365_1367297 Ga0436365_1367297_1806_3065 409
253 3300039438 Ga0436360_0461655 Ga0436360_0461655_2363_3622 409
254 3300039453 Ga0436362_1080124 Ga0436362_1080124_1265_2524 409
255 3300053119 Ga0500595_002354 Ga0500595_002354_3749_5059 409
256 3300005434 Ga0070709_10012136 Ga0070709_100121365 411
257 3300005437 Ga0070710_10104723 Ga0070710_101047232 411
258 3300025928 Ga0207700_10034010 Ga0207700_100340104 411
259 3300053111 Ga0500572_000051 Ga0500572_000051_29967_31301 411
260 3300053136 Ga0500559_0000217 Ga0500559_0000217_28912_30246 411
261 3300053735 Ga0500596_000203 Ga0500596_000203_4720_6054 411
262 3300005439 Ga0070711_100163411 Ga0070711_1001634112 412
263 3300025916 Ga0207663_10121875 Ga0207663_101218752 412
264 3300039437 Ga0436365_1582582 Ga0436365_1582582_305_1570 412
265 3300053080 Ga0500635_0000728 Ga0500635_0000728_6012_7367 412
266 3300053150 Ga0500603_000079 Ga0500603_000079_9763_11118 412
267 3300053178 Ga0500637_0005671 Ga0500637_0005671_3810_5165 412
268 3300005435 Ga0070714_100023123 Ga0070714_1000231233 413
269 3300009551 Ga0105238_10011696 Ga0105238_100116962 413
270 3300009551 Ga0105238_10205362 Ga0105238_102053621 413
271 3300010375 Ga0105239_10061496 Ga0105239_100614963 413
272 3300025909 Ga0207705_10185590 Ga0207705_101855901 413
273 3300025929 Ga0207664_10087477 Ga0207664_100874772 413
274 3300046460 Ga0495638_0005756 Ga0495638_0005756_5029_6330 413
275 3300044658 Ga0466972_0003999 Ga0466972_0003999_4366_5655 414
276 iso_pu_bacteria 2824600985 2824602227 414
277 iso_pu_bacteria 2922361189 2922367804 414
278 iso_pu_bacteria 2935684952 2935693863 414
279 iso_pu_bacteria 2935713505 2935721985 414
280 iso_pu_bacteria 8016583857 8016592308 414
281 3300006871 Ga0075434_100041351 Ga0075434_1000413512 415
282 3300006942 Ga0099824_1028675 Ga0099824_10286752 415
283 3300027296 Ga0209389_1000196 Ga0209389_100019628 415
284 3300027357 Ga0209589_1001029 Ga0209589_100102928 415
285 3300027361 Ga0209489_101824 Ga0209489_10182428 415
286 3300039438 Ga0436360_0504339 Ga0436360_0504339_860_2125 415
287 3300044658 Ga0466972_0000149 Ga0466972_0000149_35675_36946 415
288 3300044693 Ga0466961_0042155 Ga0466961_0042155_94_1374 415
289 3300048926 Ga0496123_0106139 Ga0496123_0106139_124_1428 415
290 3300048929 Ga0496126_0012423 Ga0496126_0012423_3260_4564 415
291 3300050512 nmdc:mga0n895_42638_c1 nmdc:mga0n895_42638_c1_2479_3765 415
292 iso_pu_bacteria 2508501128 2509149122 415
293 iso_pu_bacteria 2513237094 2513641917 415
294 iso_pu_bacteria 2513237098 2513671892 415
295 iso_pu_bacteria 2513237141 2513894401 415
296 iso_pu_bacteria 2791355196 2793060375 415
297 iso_pu_bacteria 2876761206 2876762550 415
298 iso_pu_bacteria 2881665667 2881672966 415
299 iso_pu_bacteria 2906643746 2906649848 415
300 iso_pu_bacteria 3005718088 3005721369 415
301 iso_pu_bacteria 8019648815 8019657137 415
302 3300005434 Ga0070709_10002327 Ga0070709_100023276 416
303 3300005437 Ga0070710_10005387 Ga0070710_100053873 416
304 3300006175 Ga0070712_100005787 Ga0070712_1000057875 416
305 3300025253 Ga0209677_100648 Ga0209677_10064817 416
306 3300025898 Ga0207692_10006885 Ga0207692_100068853 416
307 3300025906 Ga0207699_10001804 Ga0207699_100018046 416
308 3300025915 Ga0207693_10010254 Ga0207693_100102544 416
309 3300031507 Ga0307509_10001966 Ga0307509_1000196628 416
310 3300037466 Ga0395898_0032607 Ga0395898_0032607_372_1700 416
311 3300046460 Ga0495638_0004117 Ga0495638_0004117_9307_10590 416
312 3300047320 Ga0495672_0000153 Ga0495672_0000153_79066_80349 416
313 3300047469 Ga0495673_0023779 Ga0495673_0023779_473_1756 416
314 3300048920 Ga0496117_0057053 Ga0496117_0057053_165_1463 416
315 3300048921 Ga0496118_0011416 Ga0496118_0011416_3545_4843 416
316 3300048924 Ga0496121_0008280 Ga0496121_0008280_7771_9069 416
317 3300048928 Ga0496125_0077064 Ga0496125_0077064_1242_2540 416
318 3300049586 Ga0501070_0055735 Ga0501070_0055735_318_1601 416
319 3300049589 Ga0501073_0071669 Ga0501073_0071669_908_2191 416
320 3300049590 Ga0501074_0102014 Ga0501074_0102014_453_1736 416
321 3300053108 Ga0500562_007506 Ga0500562_007506_456_1739 416
322 3300053156 Ga0500622_0000277 Ga0500622_0000277_18158_19441 416
323 3300053178 Ga0500637_0094955 Ga0500637_0094955_123_1406 416
324 iso_pu_bacteria 2935675223 2935680058 416
325 iso_pu_bacteria 2935694250 2935700697 416
326 iso_pu_bacteria 2935722832 2935731370 416
327 iso_pu_bacteria 2935732158 2935741070 416
328 iso_pu_bacteria 2935741537 2935750446 416
329 iso_pu_bacteria 2935750917 2935759701 416
330 iso_pu_bacteria 2940556831 2940565606 416
331 3300005563 Ga0068855_100154691 Ga0068855_1001546912 417
332 3300013105 Ga0157369_10002440 Ga0157369_100024402 417
333 3300037418 Ga0395900_0031878 Ga0395900_0031878_3498_4784 417
334 3300037466 Ga0395898_0003145 Ga0395898_0003145_9200_10486 417
335 3300038443 Ga0395901_0335247 Ga0395901_0335247_225_1511 417
336 3300048921 Ga0496118_0051532 Ga0496118_0051532_100_1377 417
337 3300048922 Ga0496119_0095173 Ga0496119_0095173_279_1556 417
338 3300053094 Ga0500566_0000017 Ga0500566_0000017_37440_38738 417
339 3300053095 Ga0500640_000030 Ga0500640_000030_17689_18987 417
340 3300053111 Ga0500572_000209 Ga0500572_000209_14611_15909 417
341 3300053122 Ga0500608_027410 Ga0500608_027410_1187_2485 417
342 3300053123 Ga0500614_000403 Ga0500614_000403_5160_6458 417
343 3300053136 Ga0500559_0000767 Ga0500559_0000767_8193_9491 417
344 3300053150 Ga0500603_000265 Ga0500603_000265_1185_2483 417
345 3300053159 Ga0500630_000137 Ga0500630_000137_17994_19292 417
346 3300053163 Ga0500639_000015 Ga0500639_000015_83400_84698 417
347 3300053730 Ga0500645_008399 Ga0500645_008399_2029_3306 417
348 3300053735 Ga0500596_000046 Ga0500596_000046_4815_6113 417
349 3300053737 Ga0500601_002202 Ga0500601_002202_458_1756 417
350 iso_pu_bacteria 2513237092 2513628298 417
351 iso_pu_bacteria 2513237095 2513646280 417
352 iso_pu_bacteria 2513237102 2513700304 417
353 iso_pu_bacteria 2517093001 2517103639 417
354 iso_pu_bacteria 2824609381 2824610215 417
355 iso_pu_bacteria 2824617872 2824623570 417
356 iso_pu_bacteria 2824626560 2824630932 417
357 iso_pu_bacteria 2824635225 2824640044 417
358 iso_pu_bacteria 2824644064 2824647808 417
359 iso_pu_bacteria 2824704595 2824710058 417
360 iso_pu_bacteria 2824714736 2824717663 417
361 iso_pu_bacteria 2824723954 2824727830 417
362 iso_pu_bacteria 2824753945 2824758139 417
363 iso_pu_bacteria 2824763712 2824766605 417
364 iso_pu_bacteria 2824773399 2824773914 417
365 iso_pu_bacteria 2841957949 2841962360 417
366 iso_pu_bacteria 2844315083 2844318133 417
367 iso_pu_bacteria 2847930680 2847934942 417
368 iso_pu_bacteria 2847939898 2847945523 417
369 iso_pu_bacteria 2849076700 2849080288 417
370 iso_pu_bacteria 2874628541 2874636531 417
371 iso_pu_bacteria 2879083081 2879086333 417
372 iso_pu_bacteria 2881364244 2881366339 417
373 iso_pu_bacteria 2888378607 2888382942 417
374 iso_pu_bacteria 2904711408 2904716778 417
375 iso_pu_bacteria 3005506211 3005507834 417
376 iso_pu_bacteria 8016583857 8016591400 417
377 iso_pu_bacteria 8056967851 8056972485 417
378 3300005339 Ga0070660_100070845 Ga0070660_1000708452 418
379 3300010375 Ga0105239_10062604 Ga0105239_100626042 418
380 3300025919 Ga0207657_10094145 Ga0207657_100941452 418
381 3300048924 Ga0496121_0031776 Ga0496121_0031776_1572_2891 418
382 iso_pu_bacteria 2824653114 2824656198 418
383 3300003215 JGI25153J46596_10001946 JGI25153J46596_100019464 419
384 3300003215 JGI25153J46596_10004061 JGI25153J46596_100040614 419
385 3300003354 JGI25160J50197_1002244 JGI25160J50197_10022444 419
386 3300004625 Ga0055543_1001918 Ga0055543_10019185 419
387 3300005262 Ga0065165_1001964 Ga0065165_10019646 419
388 3300005262 Ga0065165_1002049 Ga0065165_10020496 419
389 3300005262 Ga0065165_1008770 Ga0065165_10087703 419
390 3300005455 Ga0070663_100048150 Ga0070663_1000481503 419
391 3300006178 Ga0075367_10038267 Ga0075367_100382672 419
392 3300006195 Ga0075366_10091838 Ga0075366_100918382 419
393 3300009093 Ga0105240_10033003 Ga0105240_100330035 419
394 3300009098 Ga0105245_10103373 Ga0105245_101033732 419
395 3300009174 Ga0105241_10019468 Ga0105241_100194684 419
396 3300009545 Ga0105237_10001286 Ga0105237_1000128616 419
397 3300025261 Ga0209233_1008305 Ga0209233_10083052 419
398 3300025297 Ga0209758_1000216 Ga0209758_10002168 419
399 3300025297 Ga0209758_1027796 Ga0209758_10277962 419
400 3300025299 Ga0209256_1003514 Ga0209256_10035146 419
401 3300025302 Ga0207426_1000611 Ga0207426_10006115 419
402 3300025302 Ga0207426_1001360 Ga0207426_10013605 419
403 3300025302 Ga0207426_1019852 Ga0207426_10198522 419
404 3300025304 Ga0209257_1001630 Ga0209257_10016306 419
405 3300025911 Ga0207654_10051067 Ga0207654_100510673 419
406 3300025911 Ga0207654_10076574 Ga0207654_100765743 419
407 3300025913 Ga0207695_10000342 Ga0207695_1000034221 419
408 3300025914 Ga0207671_10048883 Ga0207671_100488833 419
409 3300026067 Ga0207678_10035964 Ga0207678_100359642 419
410 3300027296 Ga0209389_1000284 Ga0209389_10002845 419
411 3300027363 Ga0209700_103273 Ga0209700_1032735 419
412 3300031247 Ga0265340_10045050 Ga0265340_100450501 419
413 3300046524 Ga0495648_0074874 Ga0495648_0074874_521_1843 419
414 3300046674 Ga0495588_0055737 Ga0495588_0055737_727_2013 419
415 3300048918 Ga0496115_0098752 Ga0496115_0098752_298_1584 419
416 3300048919 Ga0496116_0016496 Ga0496116_0016496_3439_4725 419
417 3300048924 Ga0496121_0016222 Ga0496121_0016222_3928_5214 419
418 3300048929 Ga0496126_0060551 Ga0496126_0060551_644_1939 419
419 3300050492 nmdc:mga0yw44_8327_c1 nmdc:mga0yw44_8327_c1_2212_3498 419
420 3300053080 Ga0500635_0002189 Ga0500635_0002189_3414_4706 419
421 3300053105 Ga0500557_000001 Ga0500557_000001_212338_213621 419
422 3300053130 Ga0500642_0000077 Ga0500642_0000077_1881_3164 419
423 3300053178 Ga0500637_0029224 Ga0500637_0029224_131_1423 419
424 3300053729 Ga0500625_000230 Ga0500625_000230_11121_12404 419
425 3300053737 Ga0500601_001042 Ga0500601_001042_615_1889 419
426 iso_pu_bacteria 2528768022 2528855525 419
427 iso_pu_bacteria 2824661429 2824666959 419
428 iso_pu_bacteria 2879099564 2879109445 419
429 iso_pu_bacteria 2888419890 2888423407 419
430 iso_pu_bacteria 2922368715 2922373144 419
431 iso_pu_bacteria 2929615660 2929615794 419
432 iso_pu_bacteria 2929624759 2929630407 419
433 iso_pu_bacteria 2932784394 2932792055 419
434 iso_pu_bacteria 2932809354 2932814078 419
435 iso_pu_bacteria 2932818245 2932819434 419
436 iso_pu_bacteria 2932828146 2932833857 419
437 iso_pu_bacteria 2933577622 2933578920 419
438 iso_pu_bacteria 2935616580 2935618613 419
439 iso_pu_bacteria 2935638405 2935644544 419
440 iso_pu_bacteria 2935665750 2935673565 419
441 iso_pu_bacteria 2935675223 2935678452 419
442 iso_pu_bacteria 2935684952 2935688119 419
443 iso_pu_bacteria 2935713505 2935715138 419
444 iso_pu_bacteria 2935722832 2935726297 419
445 iso_pu_bacteria 2935732158 2935733957 419
446 iso_pu_bacteria 2935741537 2935743336 419
447 iso_pu_bacteria 2935750917 2935754626 419
448 iso_pu_bacteria 2935760218 2935765405 419
449 iso_pu_bacteria 2935801545 2935805356 419
450 iso_pu_bacteria 2935810662 2935816654 419
451 iso_pu_bacteria 2935827899 2935833707 419
452 iso_pu_bacteria 2935837841 2935839607 419
453 iso_pu_bacteria 2935855204 2935856978 419
454 iso_pu_bacteria 2935864058 2935871194 419
455 iso_pu_bacteria 2935873716 2935876303 419
456 iso_pu_bacteria 2935992306 2935997734 419
457 iso_pu_bacteria 2936002035 2936007246 419
458 iso_pu_bacteria 2936037263 2936043084 419
459 iso_pu_bacteria 2940556831 2940559997 419
460 iso_pu_bacteria 2941538514 2941540296 419
461 iso_pu_bacteria 8016511872 8016514576 419
462 iso_pu_bacteria 8017057580 8017061854 419
463 iso_pu_bacteria 8019586578 8019589011 419
464 iso_pu_bacteria 8019597564 8019602223 419
465 iso_pu_bacteria 8019608314 8019616339 419
466 iso_pu_bacteria 8055742211 8055747441 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

264

459

0.89

PF07690

MFS_1

Major Facilitator Superfamily

51

336

0.86

PF12832

MFS_1_like

MFS_1 like family

50

421

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.844 10 398
6lz0-assembly1.cif.gz_A cryo-em structure of human mct1 in complex with basigin-2 in the presence of lactate 0.8338 10 398
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8227 10 398
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8205 6 399
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.819 6 395
ID Description Score Start End Superfamily
af_P9WJX1_217_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9908 219 404 1.20.1250.20
af_P9WJX1_16_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9876 15 192 1.20.1250.20
af_P9WJX1_16_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9767 15 192 1.20.1250.20
af_P9WJX1_217_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.965 219 404 1.20.1250.20
af_Q5NC32_214_410_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8948 9 190 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0S9CJH1-F1-model_v4 MFS transporter 0.9847 8 403 GO:0016020
GO:0022857
AF-A0A127F5R8-F1-model_v4 Major facilitator superfamily transporter 0.9783 1 404 GO:0016020
GO:0022857
AF-A0A098LFD5-F1-model_v4 Major facilitator transporter 0.9777 9 401 GO:0016020
GO:0016747
GO:0022857
AF-H0T719-F1-model_v4 Major Facilitator Superfamily (MFS) transporter 0.9772 1 411 GO:0016020
GO:0022857
AF-A0A2N7X8N4-F1-model_v4 MFS transporter 0.977 9 400 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
86.94 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map