F449761

General Info

Members Datasets Scaffolds Average Seq Length
466 250 932 104

Family's Representative Sequence

Representative Sequence 3300059642|Ga0587069_124449|Ga0587069_124449_120_509
Length 129
Sequence VTPGLTAAVRPFERAALQDNRRSITMHATIRRYEGVDTTRMNEVVGKVNKTLVPQLRELPGFSGFYLIEADNGVLSSFGLFETSEQDDESKTLVTKWISDENFNTVIPNAPKITSGKVVAHSDGVLALV

Samples

Sample ID Description Type Environment
1 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
172 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
173 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.35
Metatranscriptomes 6.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.73
Rhizosphere 92.06
Stem 0
Stem Tuber 0
Unclassified 36.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587069_124449 3300059642 Bacteria 550
2 Ga0058863_11903275 3300004799 Unclassified 573
3 Ga0065707_10366901 3300005295 Unclassified 895
4 Ga0070658_10005595 3300005327 Bacteria 10190
5 Ga0070683_101154443 3300005329 Unclassified 744
6 Ga0070683_101270185 3300005329 Unclassified 708
7 Ga0070680_100333566 3300005336 Bacteria 1288
8 Ga0070682_101003378 3300005337 Bacteria 693
9 Ga0068868_100094518 3300005338 Unclassified 2412
10 Ga0070660_100038994 3300005339 Bacteria 3610
11 Ga0070689_101892581 3300005340 Unclassified 545
12 Ga0070691_10377053 3300005341 Bacteria 794
13 Ga0070687_100921547 3300005343 Unclassified 628
14 Ga0070668_100015350 3300005347 Bacteria 5724
15 Ga0070668_100309563 3300005347 Bacteria 1327
16 Ga0070675_100473374 3300005354 Bacteria 1126
17 Ga0070675_100652155 3300005354 Bacteria 957
18 Ga0070675_102147980 3300005354 Unclassified 515
19 Ga0070671_100447873 3300005355 Bacteria 1108
20 Ga0070671_100713080 3300005355 Bacteria 871
21 Ga0070673_101833750 3300005364 Unclassified 575
22 Ga0070688_100521863 3300005365 Unclassified 899
23 Ga0070688_101651526 3300005365 Unclassified 524
24 Ga0070659_100265521 3300005366 Unclassified 1425
25 Ga0070703_10131550 3300005406 Bacteria 919
26 Ga0070709_10016175 3300005434 Unclassified 4254
27 Ga0070709_10039338 3300005434 Bacteria 2901
28 Ga0070709_10042512 3300005434 Unclassified 2807
29 Ga0070709_10059774 3300005434 Unclassified 2421
30 Ga0070709_10201525 3300005434 Bacteria 1410
31 Ga0070714_100029713 3300005435 Unclassified 4545
32 Ga0070714_100474700 3300005435 Bacteria 1190
33 Ga0070714_102121382 3300005435 Bacteria 548
34 Ga0070713_100001164 3300005436 Bacteria 16806
35 Ga0070713_100893195 3300005436 Bacteria 854
36 Ga0070713_100930037 3300005436 Unclassified 837
37 Ga0070713_101439018 3300005436 Bacteria 668
38 Ga0070710_10217596 3300005437 Bacteria 1214
39 Ga0070710_10236540 3300005437 Bacteria 1168
40 Ga0070710_10523840 3300005437 Unclassified 815
41 Ga0070711_100146619 3300005439 Bacteria 1776
42 Ga0070711_101151183 3300005439 Unclassified 670
43 Ga0070705_100008672 3300005440 Bacteria 5036
44 Ga0070705_100015435 3300005440 Unclassified 3950
45 Ga0070705_100017743 3300005440 Unclassified 3720
46 Ga0070705_100876720 3300005440 Unclassified 720
47 Ga0070694_100021388 3300005444 Unclassified 4132
48 Ga0070694_100062106 3300005444 Unclassified 2552
49 Ga0070708_100066024 3300005445 Unclassified 3246
50 Ga0070708_100102416 3300005445 Bacteria 2623
51 Ga0070708_100274836 3300005445 Bacteria 1585
52 Ga0070708_100595327 3300005445 Bacteria 1042
53 Ga0070708_100989755 3300005445 Unclassified 789
54 Ga0070708_101603965 3300005445 Unclassified 605
55 Ga0070678_100086656 3300005456 Bacteria 2390
56 Ga0070662_100020647 3300005457 Bacteria 4490
57 Ga0070662_100569229 3300005457 Bacteria 951
58 Ga0070681_10157722 3300005458 Bacteria 2193
59 Ga0070681_10197027 3300005458 Bacteria 1933
60 Ga0070681_10238148 3300005458 Bacteria 1734
61 Ga0068867_102103545 3300005459 Unclassified 535
62 Ga0070685_10302335 3300005466 Bacteria 1078
63 Ga0070706_100129495 3300005467 Bacteria 2355
64 Ga0070706_100168398 3300005467 Bacteria 2046
65 Ga0070706_100270611 3300005467 Bacteria 1585
66 Ga0070706_100377495 3300005467 Unclassified 1320
67 Ga0070706_100767744 3300005467 Bacteria 893
68 Ga0070707_100007253 3300005468 Bacteria 10293
69 Ga0070707_100316491 3300005468 Bacteria 1517
70 Ga0070707_100968999 3300005468 Bacteria 816
71 Ga0070698_100471020 3300005471 Bacteria 1192
72 Ga0070698_100916097 3300005471 Bacteria 822
73 Ga0070699_100150455 3300005518 Bacteria 2058
74 Ga0070699_100200875 3300005518 Unclassified 1773
75 Ga0070699_100218303 3300005518 Bacteria 1699
76 Ga0070699_100287890 3300005518 Unclassified 1472
77 Ga0070699_102051287 3300005518 Bacteria 523
78 Ga0070679_100104606 3300005530 Bacteria 2817
79 Ga0070679_100329232 3300005530 Bacteria 1476
80 Ga0070679_100462533 3300005530 Bacteria 1213
81 Ga0070684_100577683 3300005535 Bacteria 1044
82 Ga0070684_100976445 3300005535 Unclassified 795
83 Ga0070684_101064658 3300005535 Unclassified 760
84 Ga0070684_101351775 3300005535 Bacteria 671
85 Ga0070697_100084836 3300005536 Unclassified 2613
86 Ga0070697_100126308 3300005536 Bacteria 2142
87 Ga0070695_100116757 3300005545 Bacteria 1820
88 Ga0070695_100779545 3300005545 Unclassified 765
89 Ga0070696_100007704 3300005546 Bacteria 7192
90 Ga0070696_100083314 3300005546 Bacteria 2268
91 Ga0070665_100296277 3300005548 Unclassified 1620
92 Ga0070704_100027727 3300005549 Unclassified 3761
93 Ga0070704_100114128 3300005549 Bacteria 2061
94 Ga0070704_100439844 3300005549 Bacteria 1120
95 Ga0070704_100811400 3300005549 Unclassified 837
96 Ga0068855_100008162 3300005563 Bacteria 12657
97 Ga0068855_100300221 3300005563 Bacteria 1779
98 Ga0068855_100327488 3300005563 Unclassified 1692
99 Ga0068854_100715480 3300005578 Unclassified 866
100 Ga0068854_102000933 3300005578 Bacteria 534
101 Ga0068856_100034301 3300005614 Bacteria 4970
102 Ga0070702_100616501 3300005615 Bacteria 816
103 Ga0070702_100958781 3300005615 Unclassified 674
104 Ga0070702_101443515 3300005615 Unclassified 564
105 Ga0068859_100701033 3300005617 Bacteria 1103
106 Ga0068866_10882300 3300005718 Unclassified 628
107 Ga0068861_100032204 3300005719 Bacteria 3857
108 Ga0068861_101234845 3300005719 Bacteria 724
109 Ga0068870_10227598 3300005840 Bacteria 1145
110 Ga0068870_11227291 3300005840 Unclassified 544
111 Ga0068860_100998840 3300005843 Unclassified 855
112 Ga0068862_100083550 3300005844 Unclassified 2773
113 Ga0070717_10512611 3300006028 Unclassified 1085
114 Ga0075432_10052629 3300006058 Bacteria 1438
115 Ga0075432_10208902 3300006058 Unclassified 776
116 Ga0070715_10165781 3300006163 Unclassified 1096
117 Ga0070715_10179540 3300006163 Bacteria 1060
118 Ga0070716_100039164 3300006173 Bacteria 2629
119 Ga0070716_100086898 3300006173 Unclassified 1882
120 Ga0070716_100459002 3300006173 Unclassified 930
121 Ga0070716_100846892 3300006173 Bacteria 712
122 Ga0070712_100035823 3300006175 Bacteria 3371
123 Ga0070712_100132917 3300006175 Bacteria 1888
124 Ga0070712_100352689 3300006175 Unclassified 1205
125 Ga0070712_100421034 3300006175 Unclassified 1107
126 Ga0070712_101618848 3300006175 Bacteria 566
127 Ga0075428_100115266 3300006844 Bacteria 2927
128 Ga0075431_100070311 3300006847 Bacteria 3611
129 Ga0075433_10038506 3300006852 Bacteria 4130
130 Ga0075433_10154587 3300006852 Bacteria 2041
131 Ga0075433_11902348 3300006852 Unclassified 510
132 Ga0075434_100011265 3300006871 Bacteria 8423
133 Ga0075434_100297388 3300006871 Bacteria 1634
134 Ga0075434_101106464 3300006871 Unclassified 805
135 Ga0075434_101352334 3300006871 Unclassified 723
136 Ga0068865_101640634 3300006881 Unclassified 579
137 Ga0068865_102132194 3300006881 Bacteria 510
138 Ga0075436_100096183 3300006914 Bacteria 2060
139 Ga0097620_100701050 3300006931 Bacteria 1103
140 Ga0075435_100259460 3300007076 Unclassified 1480
141 Ga0075435_100427918 3300007076 Bacteria 1140
142 Ga0075435_100922780 3300007076 Unclassified 762
143 Ga0105244_10247447 3300009036 Unclassified 831
144 Ga0105250_10049396 3300009092 Bacteria 1687
145 Ga0105240_10031551 3300009093 Bacteria 6870
146 Ga0111539_10253595 3300009094 Bacteria 2049
147 Ga0111539_10384077 3300009094 Bacteria 1635
148 Ga0105245_10139350 3300009098 Bacteria 2283
149 Ga0105245_10936654 3300009098 Unclassified 909
150 Ga0105245_12752654 3300009098 Unclassified 545
151 Ga0114129_10212872 3300009147 Bacteria 2612
152 Ga0114129_10384825 3300009147 Unclassified 1852
153 Ga0114129_10544976 3300009147 Bacteria 1509
154 Ga0114129_11801051 3300009147 Unclassified 745
155 Ga0105243_10185813 3300009148 Bacteria 1811
156 Ga0105243_12139657 3300009148 Unclassified 596
157 Ga0105241_10794569 3300009174 Bacteria 871
158 Ga0105242_10139501 3300009176 Bacteria 2102
159 Ga0105242_10437173 3300009176 Unclassified 1230
160 Ga0105242_10528713 3300009176 Bacteria 1127
161 Ga0105242_10553761 3300009176 Bacteria 1103
162 Ga0105242_10669972 3300009176 Unclassified 1011
163 Ga0105242_10975481 3300009176 Bacteria 853
164 Ga0105248_10259380 3300009177 Bacteria 1957
165 Ga0105248_12764494 3300009177 Unclassified 560
166 Ga0105238_10069523 3300009551 Bacteria 3521
167 Ga0105238_10953342 3300009551 Unclassified 878
168 Ga0105249_10021492 3300009553 Bacteria 5776
169 Ga0105249_10188350 3300009553 Unclassified 2012
170 Ga0105249_12950390 3300009553 Unclassified 546
171 Ga0105239_10062857 3300010375 Bacteria 4075
172 Ga0105239_10100482 3300010375 Bacteria 3200
173 Ga0105239_10410834 3300010375 Bacteria 1533
174 Ga0105239_10755178 3300010375 Bacteria 1113
175 Ga0105239_12648165 3300010375 Bacteria 585
176 Ga0105246_11242357 3300011119 Bacteria 688
177 Ga0157373_10931193 3300013100 Unclassified 646
178 Ga0157371_10825076 3300013102 Unclassified 700
179 Ga0157371_11281912 3300013102 Unclassified 566
180 Ga0157370_10088994 3300013104 Bacteria 2900
181 Ga0157369_10157831 3300013105 Bacteria 2395
182 Ga0157369_10740842 3300013105 Bacteria 1011
183 Ga0157374_10364528 3300013296 Bacteria 1437
184 Ga0157374_11229470 3300013296 Unclassified 771
185 Ga0157378_10980471 3300013297 Bacteria 879
186 Ga0157378_12551096 3300013297 Unclassified 563
187 Ga0163162_11324992 3300013306 Bacteria 818
188 Ga0163162_11421279 3300013306 Bacteria 789
189 Ga0163162_12166603 3300013306 Bacteria 638
190 Ga0157372_10760417 3300013307 Bacteria 1127
191 Ga0157372_10961237 3300013307 Bacteria 990
192 Ga0157372_11072830 3300013307 Unclassified 932
193 Ga0157372_11088896 3300013307 Bacteria 924
194 Ga0157375_10255908 3300013308 Bacteria 1912
195 Ga0157375_10633861 3300013308 Bacteria 1226
196 Ga0157375_10949064 3300013308 Unclassified 1002
197 Ga0163163_10787439 3300014325 Bacteria 1014
198 Ga0163163_11561161 3300014325 Unclassified 721
199 Ga0163163_12585427 3300014325 Unclassified 565
200 Ga0163163_12880318 3300014325 Unclassified 537
201 Ga0182008_10137197 3300014497 Bacteria 1222
202 Ga0182008_10363071 3300014497 Bacteria 770
203 Ga0182008_10616977 3300014497 Bacteria 611
204 Ga0157377_10117553 3300014745 Bacteria 1607
205 Ga0157377_10203447 3300014745 Unclassified 1258
206 Ga0157379_11850793 3300014968 Unclassified 594
207 Ga0157376_10964440 3300014969 Unclassified 874
208 Ga0157376_11788471 3300014969 Unclassified 650
209 Ga0182006_1218308 3300015261 Unclassified 629
210 Ga0182006_1252221 3300015261 Unclassified 579
211 Ga0182007_10021205 3300015262 Bacteria 2311
212 Ga0182007_10144617 3300015262 Unclassified 806
213 Ga0182005_1094942 3300015265 Unclassified 832
214 Ga0163161_10166561 3300017792 Bacteria 1683
215 Ga0206356_11393996 3300020070 Bacteria 2215
216 Ga0224712_10452317 3300022467 Unclassified 617
217 Ga0207653_10012534 3300025885 Unclassified 2648
218 Ga0207692_10525917 3300025898 Bacteria 753
219 Ga0207699_10007586 3300025906 Bacteria 5311
220 Ga0207699_10168747 3300025906 Bacteria 1463
221 Ga0207699_10951888 3300025906 Unclassified 634
222 Ga0207643_10860752 3300025908 Unclassified 588
223 Ga0207705_10053341 3300025909 Bacteria 2912
224 Ga0207684_10035222 3300025910 Bacteria 4251
225 Ga0207684_10070152 3300025910 Bacteria 2978
226 Ga0207684_10230961 3300025910 Bacteria 1596
227 Ga0207684_10927951 3300025910 Bacteria 731
228 Ga0207654_11222501 3300025911 Bacteria 548
229 Ga0207707_10278657 3300025912 Bacteria 1448
230 Ga0207707_10400488 3300025912 Bacteria 1178
231 Ga0207707_10487023 3300025912 Unclassified 1053
232 Ga0207695_10036772 3300025913 Bacteria 5289
233 Ga0207693_10005196 3300025915 Bacteria 10898
234 Ga0207693_10073481 3300025915 Unclassified 2677
235 Ga0207693_10100745 3300025915 Bacteria 2265
236 Ga0207693_11146234 3300025915 Unclassified 589
237 Ga0207663_10034594 3300025916 Bacteria 3023
238 Ga0207663_10691878 3300025916 Bacteria 807
239 Ga0207660_10220762 3300025917 Bacteria 1487
240 Ga0207657_10022595 3300025919 Bacteria 5880
241 Ga0207657_11469659 3300025919 Unclassified 510
242 Ga0207649_10092344 3300025920 Bacteria 1984
243 Ga0207652_11036660 3300025921 Bacteria 720
244 Ga0207646_10005850 3300025922 Bacteria 12856
245 Ga0207646_10404830 3300025922 Bacteria 1232
246 Ga0207694_10109341 3300025924 Bacteria 2198
247 Ga0207687_10137072 3300025927 Bacteria 1852
248 Ga0207700_10000001 3300025928 Bacteria 1122509
249 Ga0207700_11030773 3300025928 Unclassified 736
250 Ga0207664_10030307 3300025929 Bacteria 4131
251 Ga0207706_10020010 3300025933 Bacteria 6013
252 Ga0207706_10778632 3300025933 Bacteria 814
253 Ga0207686_10247390 3300025934 Unclassified 1301
254 Ga0207686_10983414 3300025934 Bacteria 684
255 Ga0207709_10833688 3300025935 Unclassified 746
256 Ga0207669_11024648 3300025937 Unclassified 694
257 Ga0207669_11937739 3300025937 Unclassified 504
258 Ga0207704_10787566 3300025938 Viruses 793
259 Ga0207665_10000828 3300025939 Bacteria 20934
260 Ga0207665_10002812 3300025939 Bacteria 11663
261 Ga0207665_10385304 3300025939 Bacteria 1065
262 Ga0207665_11531428 3300025939 Unclassified 529
263 Ga0207661_10229940 3300025944 Bacteria 1642
264 Ga0207661_11425441 3300025944 Unclassified 635
265 Ga0207667_11244740 3300025949 Unclassified 722
266 Ga0207667_11406521 3300025949 Unclassified 671
267 Ga0207667_11621407 3300025949 Unclassified 615
268 Ga0207712_10446692 3300025961 Bacteria 1096
269 Ga0207668_10177603 3300025972 Unclassified 1676
270 Ga0207640_10677102 3300025981 Unclassified 882
271 Ga0207708_11909528 3300026075 Unclassified 520
272 Ga0207702_10005282 3300026078 Bacteria 11328
273 Ga0207641_11372142 3300026088 Bacteria 708
274 Ga0207648_10508585 3300026089 Bacteria 1103
275 Ga0207648_11530900 3300026089 Bacteria 627
276 Ga0207675_100001149 3300026118 Bacteria 26254
277 Ga0207675_102017458 3300026118 Unclassified 594
278 Ga0207683_10166453 3300026121 Bacteria 1995
279 Ga0207428_10069892 3300027907 Bacteria 2761
280 Ga0268266_11486763 3300028379 Unclassified 653
281 Ga0268264_10595068 3300028381 Bacteria 1089
282 Ga0265337_1062049 3300028556 Bacteria 1035
283 Ga0265336_10022172 3300028666 Bacteria 2023
284 Ga0265338_10015436 3300028800 Bacteria 8388
285 Ga0265338_10036185 3300028800 Bacteria 4730
286 Ga0265332_10114199 3300031238 Bacteria 1136
287 Ga0265339_10030781 3300031249 Bacteria 3036
288 Ga0265331_10316642 3300031250 Bacteria 699
289 Ga0265327_10030196 3300031251 Bacteria 3067
290 Ga0265327_10211591 3300031251 Bacteria 875
291 Ga0265316_10257311 3300031344 Bacteria 1280
292 Ga0265313_10053841 3300031595 Bacteria 1914
293 Ga0265314_10054126 3300031711 Bacteria 2778
294 Ga0265342_10221442 3300031712 Bacteria 1019
295 Ga0307415_100391919 3300032126 Bacteria 1183
296 Ga0373928_0007736 3300035084 Unclassified 2077
297 Ga0373951_0006480 3300035091 Bacteria 2677
298 Ga0373952_0000632 3300035092 Bacteria 6267
299 Ga0373945_0005403 3300035116 Bacteria 4089
300 Ga0373943_0001026 3300035170 Bacteria 12392
301 Ga0373943_0058751 3300035170 Unclassified 1915
302 Ga0373946_0015266 3300035171 Bacteria 2910
303 Ga0373946_0036466 3300035171 Bacteria 1994
304 Ga0373961_0003064 3300035241 Unclassified 4204
305 Ga0373931_0000374 3300035691 Bacteria 18399
306 Ga0373935_0033523 3300035692 Bacteria 3197
307 Ga0373933_0940739 3300035724 Unclassified 569
308 Ga0373947_0001205 3300035725 Bacteria 15889
309 Ga0373947_0131783 3300035725 Bacteria 1596
310 Ga0373937_0118773 3300036401 Unclassified 2463
311 Ga0373937_1758614 3300036401 Unclassified 567
312 Ga0373925_0019758 3300037068 Bacteria 4903
313 Ga0373925_0316861 3300037068 Unclassified 1261
314 Ga0395899_0008030 3300037312 Bacteria 8124
315 Ga0395899_0028012 3300037312 Bacteria 4242
316 Ga0395899_0244892 3300037312 Unclassified 1232
317 Ga0395900_0010880 3300037418 Bacteria 9304
318 Ga0395900_0157199 3300037418 Bacteria 2321
319 Ga0395900_0491328 3300037418 Bacteria 1179
320 Ga0395900_1780204 3300037418 Unclassified 527
321 Ga0395898_0003467 3300037466 Bacteria 17616
322 Ga0395898_0028289 3300037466 Archaea 5619
323 Ga0395898_0128425 3300037466 Bacteria 2428
324 Ga0395905_0005380 3300037471 Bacteria 13088
325 Ga0395905_0045261 3300037471 Bacteria 4127
326 Ga0395905_0154105 3300037471 Bacteria 2161
327 Ga0395901_0080076 3300038443 Bacteria 3409
328 Ga0395901_0210980 3300038443 Unclassified 2032
329 Ga0395901_0539001 3300038443 Bacteria 1184
330 Ga0395901_1110953 3300038443 Unclassified 760
331 Ga0242419_010862 3300038698 Unclassified 700
332 Ga0242420_013391 3300038996 Bacteria 1397
333 Ga0451800_1434394 3300041459 Unclassified 604
334 Ga0451853_0092449 3300041512 Bacteria 1557
335 Ga0439448_0004346 3300042005 Bacteria 3999
336 Ga0439455_0034240 3300042012 Bacteria 1277
337 Ga0439458_0025352 3300042157 Bacteria 1390
338 Ga0439459_0045868 3300042438 Bacteria 944
339 Ga0451576_0484913 3300045051 Bacteria 1299
340 Ga0495603_0086458 3300046455 Bacteria 1835
341 Ga0495603_0134574 3300046455 Bacteria 1439
342 Ga0495603_0290490 3300046455 Bacteria 939
343 Ga0495629_0000944 3300046459 Bacteria 23386
344 Ga0495641_0004819 3300046461 Bacteria 9382
345 Ga0495641_0006161 3300046461 Bacteria 7846
346 Ga0495641_0077169 3300046461 Bacteria 1493
347 Ga0495641_0097684 3300046461 Bacteria 1311
348 Ga0495653_0052345 3300046463 Bacteria 3129
349 Ga0495582_0000237 3300046473 Bacteria 30675
350 Ga0495582_0056043 3300046473 Unclassified 2172
351 Ga0495582_0115239 3300046473 Bacteria 1511
352 Ga0495582_0137313 3300046473 Bacteria 1384
353 Ga0495582_0658801 3300046473 Unclassified 606
354 Ga0495639_0000422 3300046475 Bacteria 20178
355 Ga0495662_0002410 3300046476 Bacteria 9395
356 Ga0495584_0625960 3300046491 Unclassified 549
357 Ga0495594_0014660 3300046499 Bacteria 4111
358 Ga0495594_0102733 3300046499 Bacteria 1608
359 Ga0495594_0277282 3300046499 Bacteria 955
360 Ga0495608_0061908 3300046511 Bacteria 2460
361 Ga0495630_0005692 3300046517 Bacteria 8810
362 Ga0495630_0640094 3300046517 Unclassified 814
363 Ga0495663_0158715 3300046525 Bacteria 775
364 Ga0495642_0534396 3300046528 Unclassified 520
365 Ga0495640_0019394 3300046533 Bacteria 5019
366 Ga0495667_0447274 3300046559 Unclassified 812
367 Ga0495634_0285941 3300046642 Bacteria 1000
368 Ga0495661_0443505 3300046665 Bacteria 626
369 Ga0495588_0000483 3300046674 Bacteria 19736
370 Ga0495588_0134959 3300046674 Bacteria 1302
371 Ga0495657_0091273 3300046675 Bacteria 1954
372 Ga0495646_0166577 3300046680 Bacteria 1217
373 Ga0495647_0004784 3300046681 Bacteria 4418
374 Ga0495647_0081271 3300046681 Bacteria 1315
375 Ga0495658_0001012 3300046683 Bacteria 14837
376 Ga0495613_0004390 3300046689 Bacteria 10555
377 Ga0495613_0020682 3300046689 Bacteria 4906
378 Ga0495600_0263082 3300046809 Bacteria 1095
379 Ga0495581_0003714 3300047315 Bacteria 8793
380 Ga0495581_0203283 3300047315 Unclassified 1159
381 Ga0495674_0008227 3300047319 Bacteria 9951
382 Ga0495676_0001344 3300047321 Bacteria 21112
383 Ga0495676_0009943 3300047321 Bacteria 8642
384 Ga0495676_0181566 3300047321 Bacteria 1474
385 Ga0495680_0006617 3300047322 Bacteria 10744
386 Ga0495680_0046601 3300047322 Unclassified 3417
387 Ga0495684_0029057 3300047471 Unclassified 4243
388 Ga0495684_0280494 3300047471 Unclassified 1202
389 Ga0495593_0003283 3300047673 Bacteria 9699
390 Ga0496100_0107840 3300048903 Unclassified 1930
391 Ga0496101_0032732 3300048904 Bacteria 3662
392 Ga0496101_0079814 3300048904 Bacteria 2416
393 Ga0496101_0176215 3300048904 Bacteria 1645
394 Ga0496101_0252964 3300048904 Bacteria 1373
395 Ga0496102_0184269 3300048905 Unclassified 1967
396 Ga0496102_0185281 3300048905 Bacteria 1962
397 Ga0496102_0457721 3300048905 Bacteria 1197
398 Ga0496102_1967117 3300048905 Unclassified 501
399 Ga0496104_0021932 3300048907 Bacteria 5865
400 Ga0496104_0262400 3300048907 Bacteria 1640
401 Ga0496104_0610352 3300048907 Bacteria 1001
402 Ga0496105_0006104 3300048908 Bacteria 9222
403 Ga0496105_0370559 3300048908 Unclassified 1141
404 Ga0496106_0113135 3300048909 Unclassified 2115
405 Ga0496106_0195741 3300048909 Bacteria 1608
406 Ga0496106_0320945 3300048909 Unclassified 1243
407 Ga0496107_0006711 3300048910 Bacteria 7926
408 Ga0496107_0128265 3300048910 Bacteria 1871
409 Ga0496107_0152786 3300048910 Bacteria 1708
410 Ga0496109_0101781 3300048912 Unclassified 2666
411 Ga0496109_0200658 3300048912 Unclassified 1875
412 Ga0496109_0587146 3300048912 Bacteria 1050
413 Ga0496110_0100050 3300048913 Bacteria 2599
414 Ga0496110_0166903 3300048913 Bacteria 1996
415 Ga0496110_0851456 3300048913 Bacteria 817
416 Ga0496111_0023613 3300048914 Bacteria 4319
417 Ga0496111_0066719 3300048914 Unclassified 2613
418 Ga0496111_0330868 3300048914 Unclassified 1128
419 Ga0496111_0606438 3300048914 Unclassified 801
420 Ga0496112_0034359 3300048915 Bacteria 4935
421 Ga0496112_0470226 3300048915 Unclassified 1194
422 Ga0496112_0637470 3300048915 Bacteria 996
423 Ga0496113_0114051 3300048916 Unclassified 2107
424 Ga0496113_1342557 3300048916 Bacteria 555
425 nmdc:mga05p37_210989_c1 3300050507 Bacteria 2348
426 nmdc:mga05p37_601268_c1 3300050507 Unclassified 1241
427 nmdc:mga06r32_79770_c1 3300050510 Bacteria 3184
428 nmdc:mga08y16_101491_c1 3300050511 Bacteria 1931
429 nmdc:mga0n895_2044902_c1 3300050512 Unclassified 530
430 nmdc:mga0n895_334834_c1 3300050512 Bacteria 1533
431 nmdc:mga0n895_34786_c1 3300050512 Bacteria 4853
432 nmdc:mga0n895_954325_c1 3300050512 Bacteria 841
433 nmdc:mga0rr50_1267262_c1 3300050513 Unclassified 626
434 nmdc:mga0rr50_382214_c1 3300050513 Unclassified 790
435 nmdc:mga0rr50_908919_c1 3300050513 Unclassified 751
436 nmdc:mga08x19_144053_c1 3300050514 Bacteria 1611
437 nmdc:mga0a205_19180_c1 3300050515 Bacteria 6445
438 nmdc:mga0a205_73255_c1 3300050515 Bacteria 2478
439 Ga0495619_0004862 3300053085 Bacteria 8526
440 Ga0587073_0200215 3300059492 Unclassified 598
441 Ga0587077_230706 3300059493 Unclassified 527
442 Ga0587080_173876 3300059503 Unclassified 512
443 Ga0587088_211702 3300059508 Unclassified 500
444 Ga0587089_107828 3300059509 Unclassified 511
445 Ga0587091_113854 3300059511 Unclassified 649
446 Ga0587092_100684 3300059512 Unclassified 595
447 Ga0587092_115502 3300059512 Unclassified 568
448 Ga0587094_073104 3300059513 Unclassified 621
449 Ga0587094_121506 3300059513 Unclassified 523
450 Ga0587095_035749 3300059514 Bacteria 529
451 Ga0587125_057920 3300059607 Bacteria 560
452 Ga0587131_023698 3300059609 Bacteria 519
453 Ga0587109_116813 3300059624 Unclassified 629
454 Ga0587113_020502 3300059625 Bacteria 692
455 Ga0587115_061212 3300059626 Bacteria 632
456 Ga0587115_081356 3300059626 Unclassified 574
457 Ga0587115_094363 3300059626 Unclassified 547
458 Ga0587117_070030 3300059627 Unclassified 620
459 Ga0587130_049344 3300059631 Unclassified 525
460 Ga0587067_220239 3300059640 Bacteria 514
461 Ga0587110_004146 3300059654 Bacteria 1250
462 Ga0587116_10382 3300059656 Unclassified 623
463 Ga0587119_072607 3300059658 Unclassified 549
464 Ga0587111_0094030 3300060346 Unclassified 736
465 Ga0587111_0160672 3300060346 Bacteria 610
466 Ga0587111_0208356 3300060346 Unclassified 558
467 Ga0587069_124449
468 Ga0058863_11903275
469 Ga0065707_10366901
470 Ga0070658_10005595
471 Ga0070683_101154443
472 Ga0070683_101270185
473 Ga0070680_100333566
474 Ga0070682_101003378
475 Ga0068868_100094518
476 Ga0070660_100038994
477 Ga0070689_101892581
478 Ga0070691_10377053
479 Ga0070687_100921547
480 Ga0070668_100015350
481 Ga0070668_100309563
482 Ga0070675_100473374
483 Ga0070675_100652155
484 Ga0070675_102147980
485 Ga0070671_100447873
486 Ga0070671_100713080
487 Ga0070673_101833750
488 Ga0070688_100521863
489 Ga0070688_101651526
490 Ga0070659_100265521
491 Ga0070703_10131550
492 Ga0070709_10016175
493 Ga0070709_10039338
494 Ga0070709_10042512
495 Ga0070709_10059774
496 Ga0070709_10201525
497 Ga0070714_100029713
498 Ga0070714_100474700
499 Ga0070714_102121382
500 Ga0070713_100001164
501 Ga0070713_100893195
502 Ga0070713_100930037
503 Ga0070713_101439018
504 Ga0070710_10217596
505 Ga0070710_10236540
506 Ga0070710_10523840
507 Ga0070711_100146619
508 Ga0070711_101151183
509 Ga0070705_100008672
510 Ga0070705_100015435
511 Ga0070705_100017743
512 Ga0070705_100876720
513 Ga0070694_100021388
514 Ga0070694_100062106
515 Ga0070708_100066024
516 Ga0070708_100102416
517 Ga0070708_100274836
518 Ga0070708_100595327
519 Ga0070708_100989755
520 Ga0070708_101603965
521 Ga0070678_100086656
522 Ga0070662_100020647
523 Ga0070662_100569229
524 Ga0070681_10157722
525 Ga0070681_10197027
526 Ga0070681_10238148
527 Ga0068867_102103545
528 Ga0070685_10302335
529 Ga0070706_100129495
530 Ga0070706_100168398
531 Ga0070706_100270611
532 Ga0070706_100377495
533 Ga0070706_100767744
534 Ga0070707_100007253
535 Ga0070707_100316491
536 Ga0070707_100968999
537 Ga0070698_100471020
538 Ga0070698_100916097
539 Ga0070699_100150455
540 Ga0070699_100200875
541 Ga0070699_100218303
542 Ga0070699_100287890
543 Ga0070699_102051287
544 Ga0070679_100104606
545 Ga0070679_100329232
546 Ga0070679_100462533
547 Ga0070684_100577683
548 Ga0070684_100976445
549 Ga0070684_101064658
550 Ga0070684_101351775
551 Ga0070697_100084836
552 Ga0070697_100126308
553 Ga0070695_100116757
554 Ga0070695_100779545
555 Ga0070696_100007704
556 Ga0070696_100083314
557 Ga0070665_100296277
558 Ga0070704_100027727
559 Ga0070704_100114128
560 Ga0070704_100439844
561 Ga0070704_100811400
562 Ga0068855_100008162
563 Ga0068855_100300221
564 Ga0068855_100327488
565 Ga0068854_100715480
566 Ga0068854_102000933
567 Ga0068856_100034301
568 Ga0070702_100616501
569 Ga0070702_100958781
570 Ga0070702_101443515
571 Ga0068859_100701033
572 Ga0068866_10882300
573 Ga0068861_100032204
574 Ga0068861_101234845
575 Ga0068870_10227598
576 Ga0068870_11227291
577 Ga0068860_100998840
578 Ga0068862_100083550
579 Ga0070717_10512611
580 Ga0075432_10052629
581 Ga0075432_10208902
582 Ga0070715_10165781
583 Ga0070715_10179540
584 Ga0070716_100039164
585 Ga0070716_100086898
586 Ga0070716_100459002
587 Ga0070716_100846892
588 Ga0070712_100035823
589 Ga0070712_100132917
590 Ga0070712_100352689
591 Ga0070712_100421034
592 Ga0070712_101618848
593 Ga0075428_100115266
594 Ga0075431_100070311
595 Ga0075433_10038506
596 Ga0075433_10154587
597 Ga0075433_11902348
598 Ga0075434_100011265
599 Ga0075434_100297388
600 Ga0075434_101106464
601 Ga0075434_101352334
602 Ga0068865_101640634
603 Ga0068865_102132194
604 Ga0075436_100096183
605 Ga0097620_100701050
606 Ga0075435_100259460
607 Ga0075435_100427918
608 Ga0075435_100922780
609 Ga0105244_10247447
610 Ga0105250_10049396
611 Ga0105240_10031551
612 Ga0111539_10253595
613 Ga0111539_10384077
614 Ga0105245_10139350
615 Ga0105245_10936654
616 Ga0105245_12752654
617 Ga0114129_10212872
618 Ga0114129_10384825
619 Ga0114129_10544976
620 Ga0114129_11801051
621 Ga0105243_10185813
622 Ga0105243_12139657
623 Ga0105241_10794569
624 Ga0105242_10139501
625 Ga0105242_10437173
626 Ga0105242_10528713
627 Ga0105242_10553761
628 Ga0105242_10669972
629 Ga0105242_10975481
630 Ga0105248_10259380
631 Ga0105248_12764494
632 Ga0105238_10069523
633 Ga0105238_10953342
634 Ga0105249_10021492
635 Ga0105249_10188350
636 Ga0105249_12950390
637 Ga0105239_10062857
638 Ga0105239_10100482
639 Ga0105239_10410834
640 Ga0105239_10755178
641 Ga0105239_12648165
642 Ga0105246_11242357
643 Ga0157373_10931193
644 Ga0157371_10825076
645 Ga0157371_11281912
646 Ga0157370_10088994
647 Ga0157369_10157831
648 Ga0157369_10740842
649 Ga0157374_10364528
650 Ga0157374_11229470
651 Ga0157378_10980471
652 Ga0157378_12551096
653 Ga0163162_11324992
654 Ga0163162_11421279
655 Ga0163162_12166603
656 Ga0157372_10760417
657 Ga0157372_10961237
658 Ga0157372_11072830
659 Ga0157372_11088896
660 Ga0157375_10255908
661 Ga0157375_10633861
662 Ga0157375_10949064
663 Ga0163163_10787439
664 Ga0163163_11561161
665 Ga0163163_12585427
666 Ga0163163_12880318
667 Ga0182008_10137197
668 Ga0182008_10363071
669 Ga0182008_10616977
670 Ga0157377_10117553
671 Ga0157377_10203447
672 Ga0157379_11850793
673 Ga0157376_10964440
674 Ga0157376_11788471
675 Ga0182006_1218308
676 Ga0182006_1252221
677 Ga0182007_10021205
678 Ga0182007_10144617
679 Ga0182005_1094942
680 Ga0163161_10166561
681 Ga0206356_11393996
682 Ga0224712_10452317
683 Ga0207653_10012534
684 Ga0207692_10525917
685 Ga0207699_10007586
686 Ga0207699_10168747
687 Ga0207699_10951888
688 Ga0207643_10860752
689 Ga0207705_10053341
690 Ga0207684_10035222
691 Ga0207684_10070152
692 Ga0207684_10230961
693 Ga0207684_10927951
694 Ga0207654_11222501
695 Ga0207707_10278657
696 Ga0207707_10400488
697 Ga0207707_10487023
698 Ga0207695_10036772
699 Ga0207693_10005196
700 Ga0207693_10073481
701 Ga0207693_10100745
702 Ga0207693_11146234
703 Ga0207663_10034594
704 Ga0207663_10691878
705 Ga0207660_10220762
706 Ga0207657_10022595
707 Ga0207657_11469659
708 Ga0207649_10092344
709 Ga0207652_11036660
710 Ga0207646_10005850
711 Ga0207646_10404830
712 Ga0207694_10109341
713 Ga0207687_10137072
714 Ga0207700_10000001
715 Ga0207700_11030773
716 Ga0207664_10030307
717 Ga0207706_10020010
718 Ga0207706_10778632
719 Ga0207686_10247390
720 Ga0207686_10983414
721 Ga0207709_10833688
722 Ga0207669_11024648
723 Ga0207669_11937739
724 Ga0207704_10787566
725 Ga0207665_10000828
726 Ga0207665_10002812
727 Ga0207665_10385304
728 Ga0207665_11531428
729 Ga0207661_10229940
730 Ga0207661_11425441
731 Ga0207667_11244740
732 Ga0207667_11406521
733 Ga0207667_11621407
734 Ga0207712_10446692
735 Ga0207668_10177603
736 Ga0207640_10677102
737 Ga0207708_11909528
738 Ga0207702_10005282
739 Ga0207641_11372142
740 Ga0207648_10508585
741 Ga0207648_11530900
742 Ga0207675_100001149
743 Ga0207675_102017458
744 Ga0207683_10166453
745 Ga0207428_10069892
746 Ga0268266_11486763
747 Ga0268264_10595068
748 Ga0265337_1062049
749 Ga0265336_10022172
750 Ga0265338_10015436
751 Ga0265338_10036185
752 Ga0265332_10114199
753 Ga0265339_10030781
754 Ga0265331_10316642
755 Ga0265327_10030196
756 Ga0265327_10211591
757 Ga0265316_10257311
758 Ga0265313_10053841
759 Ga0265314_10054126
760 Ga0265342_10221442
761 Ga0307415_100391919
762 Ga0373928_0007736
763 Ga0373951_0006480
764 Ga0373952_0000632
765 Ga0373945_0005403
766 Ga0373943_0001026
767 Ga0373943_0058751
768 Ga0373946_0015266
769 Ga0373946_0036466
770 Ga0373961_0003064
771 Ga0373931_0000374
772 Ga0373935_0033523
773 Ga0373933_0940739
774 Ga0373947_0001205
775 Ga0373947_0131783
776 Ga0373937_0118773
777 Ga0373937_1758614
778 Ga0373925_0019758
779 Ga0373925_0316861
780 Ga0395899_0008030
781 Ga0395899_0028012
782 Ga0395899_0244892
783 Ga0395900_0010880
784 Ga0395900_0157199
785 Ga0395900_0491328
786 Ga0395900_1780204
787 Ga0395898_0003467
788 Ga0395898_0028289
789 Ga0395898_0128425
790 Ga0395905_0005380
791 Ga0395905_0045261
792 Ga0395905_0154105
793 Ga0395901_0080076
794 Ga0395901_0210980
795 Ga0395901_0539001
796 Ga0395901_1110953
797 Ga0242419_010862
798 Ga0242420_013391
799 Ga0451800_1434394
800 Ga0451853_0092449
801 Ga0439448_0004346
802 Ga0439455_0034240
803 Ga0439458_0025352
804 Ga0439459_0045868
805 Ga0451576_0484913
806 Ga0495603_0086458
807 Ga0495603_0134574
808 Ga0495603_0290490
809 Ga0495629_0000944
810 Ga0495641_0004819
811 Ga0495641_0006161
812 Ga0495641_0077169
813 Ga0495641_0097684
814 Ga0495653_0052345
815 Ga0495582_0000237
816 Ga0495582_0056043
817 Ga0495582_0115239
818 Ga0495582_0137313
819 Ga0495582_0658801
820 Ga0495639_0000422
821 Ga0495662_0002410
822 Ga0495584_0625960
823 Ga0495594_0014660
824 Ga0495594_0102733
825 Ga0495594_0277282
826 Ga0495608_0061908
827 Ga0495630_0005692
828 Ga0495630_0640094
829 Ga0495663_0158715
830 Ga0495642_0534396
831 Ga0495640_0019394
832 Ga0495667_0447274
833 Ga0495634_0285941
834 Ga0495661_0443505
835 Ga0495588_0000483
836 Ga0495588_0134959
837 Ga0495657_0091273
838 Ga0495646_0166577
839 Ga0495647_0004784
840 Ga0495647_0081271
841 Ga0495658_0001012
842 Ga0495613_0004390
843 Ga0495613_0020682
844 Ga0495600_0263082
845 Ga0495581_0003714
846 Ga0495581_0203283
847 Ga0495674_0008227
848 Ga0495676_0001344
849 Ga0495676_0009943
850 Ga0495676_0181566
851 Ga0495680_0006617
852 Ga0495680_0046601
853 Ga0495684_0029057
854 Ga0495684_0280494
855 Ga0495593_0003283
856 Ga0496100_0107840
857 Ga0496101_0032732
858 Ga0496101_0079814
859 Ga0496101_0176215
860 Ga0496101_0252964
861 Ga0496102_0184269
862 Ga0496102_0185281
863 Ga0496102_0457721
864 Ga0496102_1967117
865 Ga0496104_0021932
866 Ga0496104_0262400
867 Ga0496104_0610352
868 Ga0496105_0006104
869 Ga0496105_0370559
870 Ga0496106_0113135
871 Ga0496106_0195741
872 Ga0496106_0320945
873 Ga0496107_0006711
874 Ga0496107_0128265
875 Ga0496107_0152786
876 Ga0496109_0101781
877 Ga0496109_0200658
878 Ga0496109_0587146
879 Ga0496110_0100050
880 Ga0496110_0166903
881 Ga0496110_0851456
882 Ga0496111_0023613
883 Ga0496111_0066719
884 Ga0496111_0330868
885 Ga0496111_0606438
886 Ga0496112_0034359
887 Ga0496112_0470226
888 Ga0496112_0637470
889 Ga0496113_0114051
890 Ga0496113_1342557
891 nmdc:mga05p37_210989_c1
892 nmdc:mga05p37_601268_c1
893 nmdc:mga06r32_79770_c1
894 nmdc:mga08y16_101491_c1
895 nmdc:mga0n895_2044902_c1
896 nmdc:mga0n895_334834_c1
897 nmdc:mga0n895_34786_c1
898 nmdc:mga0n895_954325_c1
899 nmdc:mga0rr50_1267262_c1
900 nmdc:mga0rr50_382214_c1
901 nmdc:mga0rr50_908919_c1
902 nmdc:mga08x19_144053_c1
903 nmdc:mga0a205_19180_c1
904 nmdc:mga0a205_73255_c1
905 Ga0495619_0004862
906 Ga0587073_0200215
907 Ga0587077_230706
908 Ga0587080_173876
909 Ga0587088_211702
910 Ga0587089_107828
911 Ga0587091_113854
912 Ga0587092_100684
913 Ga0587092_115502
914 Ga0587094_073104
915 Ga0587094_121506
916 Ga0587095_035749
917 Ga0587125_057920
918 Ga0587131_023698
919 Ga0587109_116813
920 Ga0587113_020502
921 Ga0587115_061212
922 Ga0587115_081356
923 Ga0587115_094363
924 Ga0587117_070030
925 Ga0587130_049344
926 Ga0587067_220239
927 Ga0587110_004146
928 Ga0587116_10382
929 Ga0587119_072607
930 Ga0587111_0094030
931 Ga0587111_0160672
932 Ga0587111_0208356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ecp-assembly1.cif.gz_B r16a pa0709 with bme modifications 0.8 1 95
2od4-assembly1.cif.gz_B crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096665735785) from uncultured marine organism at 1.70 a resolution 0.7995 2 98
3tvz-assembly2.cif.gz_B structure of bacillus subtilis hmob 0.7991 2 64
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.7898 2 94
1iuj-assembly1.cif.gz_B the structure of tt1380 protein from thermus thermophilus 0.7888 1 99
ID Description Score Start End Superfamily
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8576 5 67 3.10.450.240
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8006 5 67 3.10.450.240
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7808 2 95 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7732 2 95 3.30.70.100
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7662 2 90 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A538BMS3-F1-model_v4 ABM domain-containing protein 0.9929 1 99
AF-A0A429EZT5-F1-model_v4 ABM domain-containing protein 0.9677 1 97
AF-A0A1Q5JYU7-F1-model_v4 ABM domain-containing protein 0.9675 1 97
AF-A0A7W9II64-F1-model_v4 Quinol monooxygenase YgiN 0.9634 2 97 GO:0004497
AF-A0A429EZT5-F1-model_v4 ABM domain-containing protein 0.9578 1 97

Map