F449729

General Info

Members Datasets Scaffolds Average Seq Length
466 308 932 197

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0050722|Ga0495668_0050722_17_688
Length 223
Sequence MHSSGLRSPPPPSFFSLSQDSNVEASQAGTRKVRKNERWKLWAVILVCAAPAIASYLSYYVIKPQGRTNYGELIDPRSHPMPQLKMSTLDGKPAALSDYKGKWLLVALGSADCDQACQNRLYYMRQLRLAQGKEMERIERVWLILDDKPLDTMLMRQYDGMHMLRVDAAGANAWLPADAGSTPSDHMYMLDPLGNLMMRFPRDADPNKVKKDIAKLLRASRIG

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
94 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
239 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
240 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
274 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
280 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
281 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
282 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
283 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
288 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
289 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
290 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
291 2643221638 Duganella sp. Root336D2 Isolate Unclassified
292 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
293 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
294 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
295 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
296 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
297 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
298 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
299 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
300 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
301 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
302 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
303 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
304 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
305 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
306 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
307 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
308 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.06
Metatranscriptomes 0.21
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.88
Nodule 1.5
Rhizoplane 1.93
Rhizosphere 69.1
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0050722 3300046616 Bacteria 2299
2 JGI25155J39150_1000388 3300002704 Bacteria 12532
3 JGI25156J39149_1000503 3300002705 Bacteria 22887
4 JGI25156J39149_1001960 3300002705 Bacteria 7932
5 JGI25156J39149_1007564 3300002705 Bacteria 2835
6 JGI25162J39368_1008759 3300002737 Bacteria 1418
7 JGI25154J39366_1001102 3300002738 Bacteria 10545
8 JGI25154J39366_1001460 3300002738 Bacteria 8372
9 JGI25158J39367_1007834 3300002739 Bacteria 1497
10 JGI25157J39369_1000171 3300002741 Bacteria 54600
11 JGI25159J45721_1004313 3300002987 Bacteria 4754
12 Ga0006759J45824_1176469 3300003163 Bacteria 779
13 JGI25165J46597_1000051 3300003214 Bacteria 241012
14 rootH1_10153745 3300003323 Bacteria 1814
15 JGI25160J50197_1000049 3300003354 Bacteria 135107
16 JGI25161J50226_1000801 3300003374 Bacteria 11848
17 Ga0055538_1000025 3300003751 Bacteria 241012
18 Ga0055538_1000038 3300003751 Bacteria 186588
19 Ga0055539_1000032 3300003752 Bacteria 241012
20 Ga0055539_1000049 3300003752 Bacteria 186588
21 Ga0055533_1000042 3300003756 Bacteria 241012
22 Ga0055533_1000060 3300003756 Bacteria 186588
23 Ga0055532_1000044 3300003758 Bacteria 191110
24 Ga0055525_1000050 3300003759 Bacteria 241012
25 Ga0055525_1000068 3300003759 Bacteria 186588
26 Ga0055526_1012110 3300003771 Bacteria 3800
27 Ga0055526_1018414 3300003771 Bacteria 2605
28 Ga0055537_1020486 3300003773 Bacteria 1003
29 Ga0055524_1000022 3300003775 Bacteria 224103
30 Ga0055524_1003986 3300003775 Bacteria 6977
31 Ga0055524_1010036 3300003775 Bacteria 3800
32 Ga0055534_1015182 3300003784 Bacteria 1418
33 Ga0055528_1001743 3300003790 Bacteria 12557
34 Ga0055530_10006582 3300003791 Bacteria 5150
35 Ga0055530_10014182 3300003791 Bacteria 2670
36 Ga0055530_10022352 3300003791 Bacteria 1842
37 Ga0055531_10023549 3300003794 Bacteria 2303
38 Ga0055531_10055835 3300003794 Bacteria 1001
39 Ga0055541_1000023 3300003841 Bacteria 241012
40 Ga0055541_1000036 3300003841 Bacteria 186588
41 Ga0055543_1004271 3300004625 Bacteria 3938
42 Ga0065165_1076506 3300005262 Bacteria 877
43 Ga0065714_10136193 3300005288 Bacteria 1191
44 Ga0065712_10008140 3300005290 Bacteria 2278
45 Ga0070676_10100072 3300005328 Bacteria 1789
46 Ga0070690_100005225 3300005330 Bacteria 7274
47 Ga0070670_100098795 3300005331 Bacteria 2512
48 Ga0070670_100191955 3300005331 Bacteria 1774
49 Ga0070677_10212278 3300005333 Bacteria 940
50 Ga0068869_100912865 3300005334 Bacteria 760
51 Ga0070682_100040281 3300005337 Bacteria 2874
52 Ga0068868_100061321 3300005338 Bacteria 2979
53 Ga0070689_100393897 3300005340 Unclassified 1169
54 Ga0070668_100085132 3300005347 Bacteria 2484
55 Ga0070671_100018231 3300005355 Bacteria 5699
56 Ga0070674_100035433 3300005356 Bacteria 3342
57 Ga0070673_100354145 3300005364 Bacteria 1303
58 Ga0070688_100107138 3300005365 Bacteria 1852
59 Ga0070667_100159536 3300005367 Bacteria 1985
60 Ga0070667_100674094 3300005367 Bacteria 956
61 Ga0070705_100070191 3300005440 Bacteria 2115
62 Ga0070700_100022287 3300005441 Bacteria 3691
63 Ga0070678_100476524 3300005456 Bacteria 1097
64 Ga0070681_10004831 3300005458 Bacteria 12913
65 Ga0068867_100095536 3300005459 Bacteria 2261
66 Ga0070706_100035208 3300005467 Bacteria 4624
67 Ga0070697_100117921 3300005536 Bacteria 2217
68 Ga0070696_100287828 3300005546 Bacteria 1254
69 Ga0070665_100025779 3300005548 Bacteria 5922
70 Ga0070704_100019636 3300005549 Bacteria 4346
71 Ga0068855_100000702 3300005563 Bacteria 40994
72 Ga0068855_100012982 3300005563 Bacteria 10051
73 Ga0068856_100218504 3300005614 Bacteria 1921
74 Ga0070702_100059360 3300005615 Bacteria 2219
75 Ga0068852_100020009 3300005616 Bacteria 5314
76 Ga0068852_100300453 3300005616 Unclassified 1554
77 Ga0068859_100402522 3300005617 Bacteria 1465
78 Ga0068864_100205449 3300005618 Bacteria 1811
79 Ga0068861_100093843 3300005719 Bacteria 2373
80 Ga0068870_10048667 3300005840 Bacteria 2233
81 Ga0068870_10388072 3300005840 Bacteria 905
82 Ga0068863_100222616 3300005841 Unclassified 1818
83 Ga0068863_100259278 3300005841 Unclassified 1680
84 Ga0068860_100532504 3300005843 Bacteria 1175
85 Ga0068862_100109959 3300005844 Bacteria 2418
86 Ga0097621_100022728 3300006237 Bacteria 4871
87 Ga0068871_100211519 3300006358 Unclassified 1677
88 Ga0075434_100598450 3300006871 Bacteria 1122
89 Ga0068865_100212141 3300006881 Unclassified 1509
90 Ga0097620_100402538 3300006931 Bacteria 1465
91 Ga0079104_1016532 3300006946 Bacteria 2154
92 Ga0105240_10008038 3300009093 Bacteria 15180
93 Ga0105240_10068872 3300009093 Bacteria 4382
94 Ga0105240_10370670 3300009093 Bacteria 1619
95 Ga0111539_10268384 3300009094 Unclassified 1987
96 Ga0105245_10032831 3300009098 Bacteria 4597
97 Ga0105243_10013626 3300009148 Bacteria 6150
98 Ga0105248_10178601 3300009177 Bacteria 2392
99 Ga0105237_10010922 3300009545 Bacteria 9635
100 Ga0105237_10252926 3300009545 Bacteria 1764
101 Ga0105249_10211776 3300009553 Bacteria 1902
102 Ga0105239_10604228 3300010375 Bacteria 1251
103 Ga0105246_10346284 3300011119 Unclassified 1216
104 Ga0157373_10197127 3300013100 Bacteria 1419
105 Ga0157374_10018042 3300013296 Bacteria 6223
106 Ga0157378_10017927 3300013297 Bacteria 6214
107 Ga0163162_10634024 3300013306 Bacteria 1193
108 Ga0163162_10941202 3300013306 Bacteria 975
109 Ga0157375_10156810 3300013308 Bacteria 2416
110 Ga0163163_11686828 3300014325 Bacteria 694
111 Ga0182008_10040253 3300014497 Bacteria 2334
112 Ga0182008_10184201 3300014497 Bacteria 1057
113 Ga0157379_10593434 3300014968 Bacteria 1033
114 Ga0157376_10058235 3300014969 Bacteria 3235
115 Ga0182006_1007985 3300015261 Bacteria 4810
116 Ga0182007_10012641 3300015262 Bacteria 3241
117 Ga0213872_10004671 3300021361 Bacteria 7202
118 Ga0209435_100004 3300025206 Bacteria 633417
119 Ga0209435_100212 3300025206 Bacteria 16554
120 Ga0209436_100114 3300025208 Bacteria 39835
121 Ga0209436_100129 3300025208 Bacteria 37378
122 Ga0209784_100010 3300025224 Bacteria 683664
123 Ga0209784_100021 3300025224 Bacteria 408534
124 Ga0209566_100008 3300025225 Bacteria 683664
125 Ga0209566_100039 3300025225 Bacteria 303368
126 Ga0209674_100019 3300025226 Bacteria 683664
127 Ga0209674_100036 3300025226 Bacteria 408534
128 Ga0209147_100011 3300025229 Bacteria 702140
129 Ga0209563_100021 3300025230 Bacteria 683764
130 Ga0209563_100040 3300025230 Bacteria 408534
131 Ga0207427_100412 3300025231 Bacteria 24713
132 Ga0209437_100019 3300025233 Bacteria 683764
133 Ga0209437_100207 3300025233 Bacteria 112147
134 Ga0209258_100279 3300025242 Bacteria 86008
135 Ga0207425_1000145 3300025245 Bacteria 60718
136 Ga0209646_1000140 3300025246 Bacteria 111155
137 Ga0209646_1000141 3300025246 Bacteria 107030
138 Ga0209026_1000066 3300025250 Bacteria 207691
139 Ga0209026_1002135 3300025250 Bacteria 7723
140 Ga0209677_100011 3300025253 Bacteria 683664
141 Ga0209677_100023 3300025253 Bacteria 408534
142 Ga0209759_1000072 3300025256 Bacteria 178206
143 Ga0209759_1000114 3300025256 Bacteria 142233
144 Ga0209233_1000025 3300025261 Bacteria 683764
145 Ga0209233_1045024 3300025261 Bacteria 930
146 Ga0209565_1000035 3300025263 Bacteria 298125
147 Ga0209565_1000205 3300025263 Bacteria 69314
148 Ga0209565_1004729 3300025263 Bacteria 4085
149 Ga0209565_1006114 3300025263 Bacteria 3417
150 Ga0209565_1008415 3300025263 Bacteria 2699
151 Ga0209565_1017337 3300025263 Bacteria 1580
152 Ga0209455_1001794 3300025272 Bacteria 9049
153 Ga0209673_1000006 3300025273 Bacteria 650600
154 Ga0209673_1007825 3300025273 Bacteria 4847
155 Ga0209130_1000149 3300025284 Bacteria 108821
156 Ga0209130_1000554 3300025284 Bacteria 37233
157 Ga0209130_1002729 3300025284 Bacteria 8364
158 Ga0209130_1003175 3300025284 Bacteria 7256
159 Ga0209675_1000005 3300025291 Bacteria 849192
160 Ga0209675_1001331 3300025291 Bacteria 14614
161 Ga0209675_1008683 3300025291 Bacteria 3692
162 Ga0209564_1000083 3300025295 Bacteria 259272
163 Ga0209564_1000088 3300025295 Bacteria 250268
164 Ga0209564_1002421 3300025295 Bacteria 14806
165 Ga0209050_1000078 3300025298 Bacteria 278409
166 Ga0209050_1000899 3300025298 Bacteria 39427
167 Ga0209256_1000035 3300025299 Bacteria 386754
168 Ga0209256_1000141 3300025299 Bacteria 152280
169 Ga0209256_1000798 3300025299 Bacteria 40339
170 Ga0209256_1001186 3300025299 Bacteria 29235
171 Ga0209256_1006766 3300025299 Bacteria 5928
172 Ga0207426_1015652 3300025302 Bacteria 2746
173 Ga0209051_1004280 3300025303 Bacteria 8886
174 Ga0209257_1000097 3300025304 Bacteria 259243
175 Ga0209257_1026029 3300025304 Bacteria 1983
176 Ga0207697_10007661 3300025315 Bacteria 4791
177 Ga0207656_10095549 3300025321 Bacteria 1355
178 Ga0207682_10035595 3300025893 Bacteria 2011
179 Ga0207688_10016723 3300025901 Bacteria 3982
180 Ga0207680_10114252 3300025903 Bacteria 1756
181 Ga0207645_10008183 3300025907 Bacteria 7324
182 Ga0207643_10108499 3300025908 Bacteria 1633
183 Ga0207643_10369033 3300025908 Bacteria 903
184 Ga0207684_10228130 3300025910 Bacteria 1607
185 Ga0207707_10441419 3300025912 Unclassified 1114
186 Ga0207695_10031442 3300025913 Bacteria 5821
187 Ga0207695_10070893 3300025913 Bacteria 3560
188 Ga0207671_10074818 3300025914 Bacteria 2532
189 Ga0207652_10202403 3300025921 Bacteria 1787
190 Ga0207681_10097995 3300025923 Bacteria 2108
191 Ga0207659_10189732 3300025926 Unclassified 1635
192 Ga0207659_10219725 3300025926 Bacteria 1527
193 Ga0207687_10860243 3300025927 Bacteria 775
194 Ga0207644_10328748 3300025931 Bacteria 1237
195 Ga0207644_10514596 3300025931 Bacteria 988
196 Ga0207709_10230026 3300025935 Unclassified 1343
197 Ga0207704_10111230 3300025938 Unclassified 1852
198 Ga0207691_10223215 3300025940 Bacteria 1633
199 Ga0207711_10581095 3300025941 Bacteria 1045
200 Ga0207689_10025843 3300025942 Bacteria 4919
201 Ga0207689_10909973 3300025942 Bacteria 742
202 Ga0207679_10599461 3300025945 Bacteria 992
203 Ga0207667_10048321 3300025949 Bacteria 4500
204 Ga0207667_10082990 3300025949 Bacteria 3319
205 Ga0207651_10324194 3300025960 Bacteria 1288
206 Ga0207651_10894515 3300025960 Bacteria 790
207 Ga0207712_10101210 3300025961 Bacteria 2143
208 Ga0207640_10049539 3300025981 Bacteria 2720
209 Ga0207658_10512823 3300025986 Bacteria 1069
210 Ga0207658_10539945 3300025986 Bacteria 1042
211 Ga0207677_10529746 3300026023 Bacteria 1023
212 Ga0207708_10003225 3300026075 Bacteria 12013
213 Ga0207702_10028447 3300026078 Bacteria 4646
214 Ga0207702_10286017 3300026078 Bacteria 1560
215 Ga0207641_10059698 3300026088 Bacteria 3248
216 Ga0207641_10105631 3300026088 Bacteria 2487
217 Ga0207676_10031964 3300026095 Bacteria 3961
218 Ga0207676_10327013 3300026095 Unclassified 1409
219 Ga0207674_10469962 3300026116 Bacteria 1215
220 Ga0207675_100031605 3300026118 Bacteria 4932
221 Ga0207683_10021144 3300026121 Bacteria 5568
222 Ga0207698_10012744 3300026142 Bacteria 5518
223 Ga0207698_10526234 3300026142 Bacteria 1155
224 Ga0209281_1017009 3300027111 Bacteria 1483
225 Ga0268265_10092876 3300028380 Bacteria 2416
226 Ga0268264_10623441 3300028381 Bacteria 1065
227 Ga0265318_10005877 3300028577 Bacteria 5711
228 Ga0265338_10135407 3300028800 Bacteria 1938
229 Ga0316180_1140403 3300030736 Bacteria 2720
230 Ga0316182_1352530 3300030745 Bacteria 1582
231 Ga0265330_10009890 3300031235 Bacteria 4515
232 Ga0265332_10007689 3300031238 Bacteria 4867
233 Ga0265328_10002441 3300031239 Bacteria 8340
234 Ga0265320_10055118 3300031240 Bacteria 1915
235 Ga0265329_10008824 3300031242 Bacteria 3800
236 Ga0265331_10001012 3300031250 Bacteria 21969
237 Ga0307408_100001254 3300031548 Bacteria 19051
238 Ga0307408_100001718 3300031548 Bacteria 16039
239 Ga0307408_100017534 3300031548 Bacteria 4792
240 Ga0265314_10001026 3300031711 Bacteria 32561
241 Ga0265314_10500663 3300031711 Unclassified 639
242 Ga0265342_10029875 3300031712 Bacteria 3381
243 Ga0373947_0462452 3300035725 Unclassified 860
244 Ga0395900_0073331 3300037418 Bacteria 3519
245 Ga0395905_0000014 3300037471 Bacteria 394209
246 Ga0395901_0010285 3300038443 Bacteria 9476
247 Ga0436361_0676044 3300039447 Bacteria 14437
248 Ga0451577_0163681 3300042876 Bacteria 2004
249 Ga0466959_0013197 3300045049 Bacteria 5986
250 Ga0495590_0028568 3300046457 Bacteria 1955
251 Ga0495638_0022545 3300046460 Bacteria 4133
252 Ga0495651_0125759 3300046462 Bacteria 1877
253 Ga0495653_0026107 3300046463 Bacteria 4687
254 Ga0495582_0770350 3300046473 Unclassified 557
255 Ga0495605_0066852 3300046474 Bacteria 1706
256 Ga0495605_0172569 3300046474 Bacteria 954
257 Ga0495584_0039962 3300046491 Bacteria 2369
258 Ga0495584_0040773 3300046491 Bacteria 2344
259 Ga0495584_0103627 3300046491 Bacteria 1438
260 Ga0495585_0030812 3300046492 Bacteria 3049
261 Ga0495594_0040999 3300046499 Bacteria 2535
262 Ga0495596_0015978 3300046500 Bacteria 3125
263 Ga0495596_0019076 3300046500 Bacteria 2821
264 Ga0495596_0039985 3300046500 Bacteria 1851
265 Ga0495596_0203830 3300046500 Bacteria 768
266 Ga0495607_0043392 3300046501 Bacteria 2659
267 Ga0495607_0071637 3300046501 Bacteria 1931
268 Ga0495607_0148200 3300046501 Bacteria 1203
269 Ga0495583_0000102 3300046506 Bacteria 143105
270 Ga0495583_0007646 3300046506 Bacteria 6739
271 Ga0495583_0017005 3300046506 Bacteria 3879
272 Ga0495583_0020179 3300046506 Bacteria 3459
273 Ga0495583_0025135 3300046506 Bacteria 2980
274 Ga0495583_0063558 3300046506 Bacteria 1640
275 Ga0495583_0100755 3300046506 Bacteria 1233
276 Ga0495606_0007881 3300046507 Bacteria 9397
277 Ga0495606_0039966 3300046507 Bacteria 3155
278 Ga0495606_0171789 3300046507 Bacteria 1257
279 Ga0495608_0004824 3300046511 Bacteria 9639
280 Ga0495616_0015603 3300046513 Bacteria 4221
281 Ga0495616_0023498 3300046513 Bacteria 3315
282 Ga0495616_0043101 3300046513 Bacteria 2293
283 Ga0495618_0053210 3300046514 Bacteria 2560
284 Ga0495631_0001510 3300046518 Bacteria 14030
285 Ga0495631_0008327 3300046518 Bacteria 5224
286 Ga0495631_0032268 3300046518 Bacteria 2362
287 Ga0495631_0043634 3300046518 Bacteria 1977
288 Ga0495637_0016814 3300046520 Bacteria 3417
289 Ga0495637_0018426 3300046520 Bacteria 3238
290 Ga0495643_0001304 3300046522 Bacteria 23706
291 Ga0495643_0032015 3300046522 Bacteria 2922
292 Ga0495643_0060546 3300046522 Bacteria 2009
293 Ga0495643_0196273 3300046522 Bacteria 972
294 Ga0495644_0054442 3300046523 Bacteria 1502
295 Ga0495644_0063341 3300046523 Bacteria 1389
296 Ga0495648_0019081 3300046524 Bacteria 4835
297 Ga0495648_0038281 3300046524 Bacteria 3069
298 Ga0495648_0046349 3300046524 Bacteria 2695
299 Ga0495648_0175694 3300046524 Bacteria 1093
300 Ga0495663_0020859 3300046525 Bacteria 1883
301 Ga0495663_0038136 3300046525 Bacteria 1451
302 Ga0495663_0095881 3300046525 Bacteria 972
303 Ga0495642_0002752 3300046528 Bacteria 7055
304 Ga0495642_0048132 3300046528 Bacteria 1747
305 Ga0495642_0103920 3300046528 Bacteria 1211
306 Ga0495652_0018481 3300046529 Bacteria 6213
307 Ga0495652_0079065 3300046529 Bacteria 2720
308 Ga0495654_0075103 3300046530 Bacteria 1595
309 Ga0495654_0168155 3300046530 Bacteria 958
310 Ga0495586_0063439 3300046535 Bacteria 2013
311 Ga0495598_0053843 3300046537 Bacteria 1220
312 Ga0495609_0004318 3300046538 Bacteria 7811
313 Ga0495609_0029125 3300046538 Bacteria 2516
314 Ga0495609_0051633 3300046538 Bacteria 1830
315 Ga0495609_0194175 3300046538 Bacteria 850
316 Ga0495621_0237857 3300046539 Bacteria 741
317 Ga0495597_0013019 3300046542 Bacteria 3995
318 Ga0495597_0026987 3300046542 Bacteria 2636
319 Ga0495597_0065920 3300046542 Bacteria 1570
320 Ga0495645_0051300 3300046543 Bacteria 3002
321 Ga0495633_0232450 3300046558 Bacteria 843
322 Ga0495656_0131018 3300046615 Bacteria 1193
323 Ga0495656_0132037 3300046615 Bacteria 1189
324 Ga0495668_0001176 3300046616 Bacteria 26639
325 Ga0495668_0005773 3300046616 Bacteria 8275
326 Ga0495668_0018700 3300046616 Bacteria 4004
327 Ga0495668_0035126 3300046616 Bacteria 2809
328 Ga0495668_0104577 3300046616 Bacteria 1549
329 Ga0495611_0012797 3300046648 Bacteria 3565
330 Ga0495611_0109325 3300046648 Bacteria 1286
331 Ga0495625_0025798 3300046660 Bacteria 4450
332 Ga0495625_0027556 3300046660 Bacteria 4275
333 Ga0495625_0041097 3300046660 Bacteria 3367
334 Ga0495625_0090935 3300046660 Bacteria 2110
335 Ga0495625_0125691 3300046660 Bacteria 1741
336 Ga0495635_0020175 3300046663 Bacteria 4645
337 Ga0495659_0043126 3300046664 Bacteria 1617
338 Ga0495659_0292639 3300046664 Bacteria 686
339 Ga0495661_0002798 3300046665 Bacteria 13216
340 Ga0495661_0056506 3300046665 Bacteria 2347
341 Ga0495661_0174269 3300046665 Bacteria 1144
342 Ga0495588_0026125 3300046674 Bacteria 2913
343 Ga0495588_0048356 3300046674 Bacteria 2184
344 Ga0495588_0059483 3300046674 Bacteria 1977
345 Ga0495657_0050372 3300046675 Bacteria 2800
346 Ga0495599_0017037 3300046678 Bacteria 4514
347 Ga0495646_0012789 3300046680 Bacteria 5334
348 Ga0495647_0210006 3300046681 Unclassified 856
349 Ga0495658_0027367 3300046683 Bacteria 3068
350 Ga0495669_0000095 3300046684 Bacteria 57161
351 Ga0495669_0000287 3300046684 Bacteria 28730
352 Ga0495613_0049360 3300046689 Bacteria 3106
353 Ga0495624_0021962 3300046690 Bacteria 4225
354 Ga0495670_0016703 3300046691 Bacteria 3609
355 Ga0495670_0136299 3300046691 Bacteria 1282
356 Ga0495671_0020190 3300046692 Bacteria 3512
357 Ga0495671_0202582 3300046692 Bacteria 962
358 Ga0495649_0015403 3300046694 Bacteria 4353
359 Ga0495649_0078010 3300046694 Bacteria 1773
360 Ga0495649_0167802 3300046694 Bacteria 1149
361 Ga0495600_0002933 3300046809 Bacteria 9942
362 Ga0495660_0032082 3300046810 Bacteria 2950
363 Ga0495660_0081882 3300046810 Bacteria 1691
364 Ga0495660_0233525 3300046810 Bacteria 860
365 Ga0495581_0058120 3300047315 Bacteria 2232
366 Ga0495636_0004232 3300047318 Bacteria 5632
367 Ga0495636_0046052 3300047318 Bacteria 1819
368 Ga0495674_0033796 3300047319 Bacteria 4628
369 Ga0495672_0018032 3300047320 Bacteria 4701
370 Ga0495672_0026679 3300047320 Bacteria 3682
371 Ga0495676_0052107 3300047321 Bacteria 3269
372 Ga0495676_0213091 3300047321 Bacteria 1335
373 Ga0495683_0053778 3300047323 Bacteria 2007
374 Ga0495687_000637 3300047443 Bacteria 40184
375 Ga0495687_038138 3300047443 Bacteria 2134
376 Ga0495687_064972 3300047443 Bacteria 1487
377 Ga0495677_0000318 3300047445 Bacteria 20836
378 Ga0495677_0128885 3300047445 Bacteria 968
379 Ga0495679_006778 3300047446 Bacteria 4875
380 Ga0495679_020857 3300047446 Bacteria 2275
381 Ga0495679_044378 3300047446 Bacteria 1362
382 Ga0495679_053215 3300047446 Bacteria 1209
383 Ga0495685_016680 3300047447 Bacteria 2511
384 Ga0495685_021655 3300047447 Bacteria 2212
385 Ga0495685_026328 3300047447 Bacteria 2000
386 Ga0495685_045949 3300047447 Bacteria 1486
387 Ga0495685_109370 3300047447 Bacteria 910
388 Ga0495673_0036710 3300047469 Bacteria 2244
389 Ga0495681_0000632 3300047470 Bacteria 26818
390 Ga0495681_0004601 3300047470 Bacteria 9384
391 Ga0495681_0211147 3300047470 Bacteria 782
392 Ga0495602_0107108 3300048088 Bacteria 2279
393 Ga0495626_0008813 3300048091 Bacteria 5488
394 Ga0495626_0039662 3300048091 Bacteria 2227
395 Ga0495626_0100027 3300048091 Bacteria 1265
396 Ga0495626_0134404 3300048091 Bacteria 1053
397 Ga0496100_0117368 3300048903 Bacteria 1858
398 Ga0496102_0000202 3300048905 Bacteria 80040
399 Ga0496102_0770590 3300048905 Bacteria 885
400 Ga0496102_0840543 3300048905 Bacteria 840
401 Ga0496103_0028077 3300048906 Bacteria 3413
402 Ga0496104_0110089 3300048907 Bacteria 2640
403 Ga0496106_0000071 3300048909 Bacteria 82296
404 Ga0496108_0623508 3300048911 Bacteria 939
405 Ga0496109_0814442 3300048912 Bacteria 872
406 Ga0496116_0023448 3300048919 Bacteria 4594
407 Ga0496121_0151723 3300048924 Bacteria 1704
408 Ga0496121_0153566 3300048924 Bacteria 1691
409 Ga0496121_0223571 3300048924 Bacteria 1324
410 Ga0496122_0003152 3300048925 Bacteria 22065
411 Ga0496123_0020210 3300048926 Bacteria 5216
412 Ga0496125_0008330 3300048928 Bacteria 10876
413 Ga0496125_0023713 3300048928 Bacteria 5657
414 Ga0496126_1205579 3300048929 Bacteria 556
415 Ga0495678_000368 3300049459 Bacteria 46143
416 Ga0495678_068555 3300049459 Bacteria 1307
417 Ga0495682_0044091 3300049460 Bacteria 1632
418 Ga0501037_0036609 3300049573 Bacteria 3616
419 Ga0501039_0161804 3300049575 Bacteria 1759
420 Ga0501040_0026443 3300049576 Bacteria 3903
421 Ga0501041_0008934 3300049577 Bacteria 5896
422 Ga0501042_0031885 3300049578 Bacteria 3729
423 Ga0501048_0071224 3300049582 Bacteria 2454
424 Ga0501068_0019821 3300049584 Bacteria 3911
425 Ga0501075_0298461 3300049591 Bacteria 1227
426 Ga0501076_0004065 3300049592 Bacteria 10346
427 Ga0501077_0065004 3300049593 Bacteria 2314
428 Ga0501227_001713 3300049665 Bacteria 4867
429 Ga0501079_0000783 3300049741 Bacteria 21708
430 Ga0501080_0058086 3300049742 Bacteria 3602
431 Ga0501263_009139 3300049760 Bacteria 1196
432 Ga0501279_004218 3300049775 Bacteria 1886
433 Ga0501035_0093441 3300049822 Bacteria 2646
434 nmdc:mga08y16_220648_c1 3300050511 Bacteria 1963
435 Ga0495601_0074511 3300053077 Bacteria 2171
436 Ga0500595_005237 3300053119 Bacteria 5683
437 Ga0500618_003628 3300053125 Bacteria 5226
438 Ga0500573_0183033 3300053140 Bacteria 1125
439 Ga0500574_002210 3300053141 Bacteria 3148
440 Ga0500619_000448 3300053154 Bacteria 7395
441 Ga0500634_0210946 3300053161 Bacteria 843
442 Ga0501084_0165670 3300054114 Bacteria 1865
443 Ga0501082_0001650 3300060353 Bacteria 19660
444 Ga0530510_0063499 3300061734 Bacteria 2674
445 2511249656 2511231003 Bacteria 5606035
446 2514048039 2513237166 Bacteria 10373764
447 2643789845 2643221554 Bacteria 6603920
448 2644027106 2643221603 Bacteria 6147767
449 2644214430 2643221638 Bacteria 6579467
450 2819592810 2818991445 Bacteria 4955017
451 2819616481 2818991449 Bacteria 5518009
452 2839099118 2839094727 Bacteria 5534556
453 2884815635 2884811622 Bacteria 5552861
454 2884838623 2884836552 Bacteria 5219991
455 2884854914 2884852848 Bacteria 5221161
456 2885278532 2885270888 Bacteria 9831543
457 2896156417 2896154374 Bacteria 5221518
458 2904535447 2904530477 Bacteria 5876334
459 2904588413 2904584206 Bacteria 6028872
460 2904594699 2904589729 Bacteria 6113573
461 2904605928 2904601388 Bacteria 5884906
462 2919049017 2919046199 Bacteria 5567169
463 2919084620 2919079590 Bacteria 5946433
464 2921644117 2921643360 Bacteria 11448031
465 2928134299 2928130867 Bacteria 5467269
466 8055268149 8055266321 Bacteria 7999742
467 Ga0495668_0050722
468 JGI25155J39150_1000388
469 JGI25156J39149_1000503
470 JGI25156J39149_1001960
471 JGI25156J39149_1007564
472 JGI25162J39368_1008759
473 JGI25154J39366_1001102
474 JGI25154J39366_1001460
475 JGI25158J39367_1007834
476 JGI25157J39369_1000171
477 JGI25159J45721_1004313
478 Ga0006759J45824_1176469
479 JGI25165J46597_1000051
480 rootH1_10153745
481 JGI25160J50197_1000049
482 JGI25161J50226_1000801
483 Ga0055538_1000025
484 Ga0055538_1000038
485 Ga0055539_1000032
486 Ga0055539_1000049
487 Ga0055533_1000042
488 Ga0055533_1000060
489 Ga0055532_1000044
490 Ga0055525_1000050
491 Ga0055525_1000068
492 Ga0055526_1012110
493 Ga0055526_1018414
494 Ga0055537_1020486
495 Ga0055524_1000022
496 Ga0055524_1003986
497 Ga0055524_1010036
498 Ga0055534_1015182
499 Ga0055528_1001743
500 Ga0055530_10006582
501 Ga0055530_10014182
502 Ga0055530_10022352
503 Ga0055531_10023549
504 Ga0055531_10055835
505 Ga0055541_1000023
506 Ga0055541_1000036
507 Ga0055543_1004271
508 Ga0065165_1076506
509 Ga0065714_10136193
510 Ga0065712_10008140
511 Ga0070676_10100072
512 Ga0070690_100005225
513 Ga0070670_100098795
514 Ga0070670_100191955
515 Ga0070677_10212278
516 Ga0068869_100912865
517 Ga0070682_100040281
518 Ga0068868_100061321
519 Ga0070689_100393897
520 Ga0070668_100085132
521 Ga0070671_100018231
522 Ga0070674_100035433
523 Ga0070673_100354145
524 Ga0070688_100107138
525 Ga0070667_100159536
526 Ga0070667_100674094
527 Ga0070705_100070191
528 Ga0070700_100022287
529 Ga0070678_100476524
530 Ga0070681_10004831
531 Ga0068867_100095536
532 Ga0070706_100035208
533 Ga0070697_100117921
534 Ga0070696_100287828
535 Ga0070665_100025779
536 Ga0070704_100019636
537 Ga0068855_100000702
538 Ga0068855_100012982
539 Ga0068856_100218504
540 Ga0070702_100059360
541 Ga0068852_100020009
542 Ga0068852_100300453
543 Ga0068859_100402522
544 Ga0068864_100205449
545 Ga0068861_100093843
546 Ga0068870_10048667
547 Ga0068870_10388072
548 Ga0068863_100222616
549 Ga0068863_100259278
550 Ga0068860_100532504
551 Ga0068862_100109959
552 Ga0097621_100022728
553 Ga0068871_100211519
554 Ga0075434_100598450
555 Ga0068865_100212141
556 Ga0097620_100402538
557 Ga0079104_1016532
558 Ga0105240_10008038
559 Ga0105240_10068872
560 Ga0105240_10370670
561 Ga0111539_10268384
562 Ga0105245_10032831
563 Ga0105243_10013626
564 Ga0105248_10178601
565 Ga0105237_10010922
566 Ga0105237_10252926
567 Ga0105249_10211776
568 Ga0105239_10604228
569 Ga0105246_10346284
570 Ga0157373_10197127
571 Ga0157374_10018042
572 Ga0157378_10017927
573 Ga0163162_10634024
574 Ga0163162_10941202
575 Ga0157375_10156810
576 Ga0163163_11686828
577 Ga0182008_10040253
578 Ga0182008_10184201
579 Ga0157379_10593434
580 Ga0157376_10058235
581 Ga0182006_1007985
582 Ga0182007_10012641
583 Ga0213872_10004671
584 Ga0209435_100004
585 Ga0209435_100212
586 Ga0209436_100114
587 Ga0209436_100129
588 Ga0209784_100010
589 Ga0209784_100021
590 Ga0209566_100008
591 Ga0209566_100039
592 Ga0209674_100019
593 Ga0209674_100036
594 Ga0209147_100011
595 Ga0209563_100021
596 Ga0209563_100040
597 Ga0207427_100412
598 Ga0209437_100019
599 Ga0209437_100207
600 Ga0209258_100279
601 Ga0207425_1000145
602 Ga0209646_1000140
603 Ga0209646_1000141
604 Ga0209026_1000066
605 Ga0209026_1002135
606 Ga0209677_100011
607 Ga0209677_100023
608 Ga0209759_1000072
609 Ga0209759_1000114
610 Ga0209233_1000025
611 Ga0209233_1045024
612 Ga0209565_1000035
613 Ga0209565_1000205
614 Ga0209565_1004729
615 Ga0209565_1006114
616 Ga0209565_1008415
617 Ga0209565_1017337
618 Ga0209455_1001794
619 Ga0209673_1000006
620 Ga0209673_1007825
621 Ga0209130_1000149
622 Ga0209130_1000554
623 Ga0209130_1002729
624 Ga0209130_1003175
625 Ga0209675_1000005
626 Ga0209675_1001331
627 Ga0209675_1008683
628 Ga0209564_1000083
629 Ga0209564_1000088
630 Ga0209564_1002421
631 Ga0209050_1000078
632 Ga0209050_1000899
633 Ga0209256_1000035
634 Ga0209256_1000141
635 Ga0209256_1000798
636 Ga0209256_1001186
637 Ga0209256_1006766
638 Ga0207426_1015652
639 Ga0209051_1004280
640 Ga0209257_1000097
641 Ga0209257_1026029
642 Ga0207697_10007661
643 Ga0207656_10095549
644 Ga0207682_10035595
645 Ga0207688_10016723
646 Ga0207680_10114252
647 Ga0207645_10008183
648 Ga0207643_10108499
649 Ga0207643_10369033
650 Ga0207684_10228130
651 Ga0207707_10441419
652 Ga0207695_10031442
653 Ga0207695_10070893
654 Ga0207671_10074818
655 Ga0207652_10202403
656 Ga0207681_10097995
657 Ga0207659_10189732
658 Ga0207659_10219725
659 Ga0207687_10860243
660 Ga0207644_10328748
661 Ga0207644_10514596
662 Ga0207709_10230026
663 Ga0207704_10111230
664 Ga0207691_10223215
665 Ga0207711_10581095
666 Ga0207689_10025843
667 Ga0207689_10909973
668 Ga0207679_10599461
669 Ga0207667_10048321
670 Ga0207667_10082990
671 Ga0207651_10324194
672 Ga0207651_10894515
673 Ga0207712_10101210
674 Ga0207640_10049539
675 Ga0207658_10512823
676 Ga0207658_10539945
677 Ga0207677_10529746
678 Ga0207708_10003225
679 Ga0207702_10028447
680 Ga0207702_10286017
681 Ga0207641_10059698
682 Ga0207641_10105631
683 Ga0207676_10031964
684 Ga0207676_10327013
685 Ga0207674_10469962
686 Ga0207675_100031605
687 Ga0207683_10021144
688 Ga0207698_10012744
689 Ga0207698_10526234
690 Ga0209281_1017009
691 Ga0268265_10092876
692 Ga0268264_10623441
693 Ga0265318_10005877
694 Ga0265338_10135407
695 Ga0316180_1140403
696 Ga0316182_1352530
697 Ga0265330_10009890
698 Ga0265332_10007689
699 Ga0265328_10002441
700 Ga0265320_10055118
701 Ga0265329_10008824
702 Ga0265331_10001012
703 Ga0307408_100001254
704 Ga0307408_100001718
705 Ga0307408_100017534
706 Ga0265314_10001026
707 Ga0265314_10500663
708 Ga0265342_10029875
709 Ga0373947_0462452
710 Ga0395900_0073331
711 Ga0395905_0000014
712 Ga0395901_0010285
713 Ga0436361_0676044
714 Ga0451577_0163681
715 Ga0466959_0013197
716 Ga0495590_0028568
717 Ga0495638_0022545
718 Ga0495651_0125759
719 Ga0495653_0026107
720 Ga0495582_0770350
721 Ga0495605_0066852
722 Ga0495605_0172569
723 Ga0495584_0039962
724 Ga0495584_0040773
725 Ga0495584_0103627
726 Ga0495585_0030812
727 Ga0495594_0040999
728 Ga0495596_0015978
729 Ga0495596_0019076
730 Ga0495596_0039985
731 Ga0495596_0203830
732 Ga0495607_0043392
733 Ga0495607_0071637
734 Ga0495607_0148200
735 Ga0495583_0000102
736 Ga0495583_0007646
737 Ga0495583_0017005
738 Ga0495583_0020179
739 Ga0495583_0025135
740 Ga0495583_0063558
741 Ga0495583_0100755
742 Ga0495606_0007881
743 Ga0495606_0039966
744 Ga0495606_0171789
745 Ga0495608_0004824
746 Ga0495616_0015603
747 Ga0495616_0023498
748 Ga0495616_0043101
749 Ga0495618_0053210
750 Ga0495631_0001510
751 Ga0495631_0008327
752 Ga0495631_0032268
753 Ga0495631_0043634
754 Ga0495637_0016814
755 Ga0495637_0018426
756 Ga0495643_0001304
757 Ga0495643_0032015
758 Ga0495643_0060546
759 Ga0495643_0196273
760 Ga0495644_0054442
761 Ga0495644_0063341
762 Ga0495648_0019081
763 Ga0495648_0038281
764 Ga0495648_0046349
765 Ga0495648_0175694
766 Ga0495663_0020859
767 Ga0495663_0038136
768 Ga0495663_0095881
769 Ga0495642_0002752
770 Ga0495642_0048132
771 Ga0495642_0103920
772 Ga0495652_0018481
773 Ga0495652_0079065
774 Ga0495654_0075103
775 Ga0495654_0168155
776 Ga0495586_0063439
777 Ga0495598_0053843
778 Ga0495609_0004318
779 Ga0495609_0029125
780 Ga0495609_0051633
781 Ga0495609_0194175
782 Ga0495621_0237857
783 Ga0495597_0013019
784 Ga0495597_0026987
785 Ga0495597_0065920
786 Ga0495645_0051300
787 Ga0495633_0232450
788 Ga0495656_0131018
789 Ga0495656_0132037
790 Ga0495668_0001176
791 Ga0495668_0005773
792 Ga0495668_0018700
793 Ga0495668_0035126
794 Ga0495668_0104577
795 Ga0495611_0012797
796 Ga0495611_0109325
797 Ga0495625_0025798
798 Ga0495625_0027556
799 Ga0495625_0041097
800 Ga0495625_0090935
801 Ga0495625_0125691
802 Ga0495635_0020175
803 Ga0495659_0043126
804 Ga0495659_0292639
805 Ga0495661_0002798
806 Ga0495661_0056506
807 Ga0495661_0174269
808 Ga0495588_0026125
809 Ga0495588_0048356
810 Ga0495588_0059483
811 Ga0495657_0050372
812 Ga0495599_0017037
813 Ga0495646_0012789
814 Ga0495647_0210006
815 Ga0495658_0027367
816 Ga0495669_0000095
817 Ga0495669_0000287
818 Ga0495613_0049360
819 Ga0495624_0021962
820 Ga0495670_0016703
821 Ga0495670_0136299
822 Ga0495671_0020190
823 Ga0495671_0202582
824 Ga0495649_0015403
825 Ga0495649_0078010
826 Ga0495649_0167802
827 Ga0495600_0002933
828 Ga0495660_0032082
829 Ga0495660_0081882
830 Ga0495660_0233525
831 Ga0495581_0058120
832 Ga0495636_0004232
833 Ga0495636_0046052
834 Ga0495674_0033796
835 Ga0495672_0018032
836 Ga0495672_0026679
837 Ga0495676_0052107
838 Ga0495676_0213091
839 Ga0495683_0053778
840 Ga0495687_000637
841 Ga0495687_038138
842 Ga0495687_064972
843 Ga0495677_0000318
844 Ga0495677_0128885
845 Ga0495679_006778
846 Ga0495679_020857
847 Ga0495679_044378
848 Ga0495679_053215
849 Ga0495685_016680
850 Ga0495685_021655
851 Ga0495685_026328
852 Ga0495685_045949
853 Ga0495685_109370
854 Ga0495673_0036710
855 Ga0495681_0000632
856 Ga0495681_0004601
857 Ga0495681_0211147
858 Ga0495602_0107108
859 Ga0495626_0008813
860 Ga0495626_0039662
861 Ga0495626_0100027
862 Ga0495626_0134404
863 Ga0496100_0117368
864 Ga0496102_0000202
865 Ga0496102_0770590
866 Ga0496102_0840543
867 Ga0496103_0028077
868 Ga0496104_0110089
869 Ga0496106_0000071
870 Ga0496108_0623508
871 Ga0496109_0814442
872 Ga0496116_0023448
873 Ga0496121_0151723
874 Ga0496121_0153566
875 Ga0496121_0223571
876 Ga0496122_0003152
877 Ga0496123_0020210
878 Ga0496125_0008330
879 Ga0496125_0023713
880 Ga0496126_1205579
881 Ga0495678_000368
882 Ga0495678_068555
883 Ga0495682_0044091
884 Ga0501037_0036609
885 Ga0501039_0161804
886 Ga0501040_0026443
887 Ga0501041_0008934
888 Ga0501042_0031885
889 Ga0501048_0071224
890 Ga0501068_0019821
891 Ga0501075_0298461
892 Ga0501076_0004065
893 Ga0501077_0065004
894 Ga0501227_001713
895 Ga0501079_0000783
896 Ga0501080_0058086
897 Ga0501263_009139
898 Ga0501279_004218
899 Ga0501035_0093441
900 nmdc:mga08y16_220648_c1
901 Ga0495601_0074511
902 Ga0500595_005237
903 Ga0500618_003628
904 Ga0500573_0183033
905 Ga0500574_002210
906 Ga0500619_000448
907 Ga0500634_0210946
908 Ga0501084_0165670
909 Ga0501082_0001650
910 Ga0530510_0063499
911 2511249656
912 2514048039
913 2643789845
914 2644027106
915 2644214430
916 2819592810
917 2819616481
918 2839099118
919 2884815635
920 2884838623
921 2884854914
922 2885278532
923 2896156417
924 2904535447
925 2904588413
926 2904594699
927 2904605928
928 2919049017
929 2919084620
930 2921644117
931 2928134299
932 8055268149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b7k-assembly3.cif.gz_C crystal structure of yeast sco1 0.7412 64 208
2b7k-assembly4.cif.gz_D crystal structure of yeast sco1 0.7317 64 208
4bpy-assembly1.cif.gz_A crystal structure of the c90a mutant of the sco copper chaperone protein from streptomyces lividans 0.7262 54 209
2gt6-assembly1.cif.gz_A solution structure of human cu(i) sco1 0.7207 66 207
1wp0-assembly1.cif.gz_A human sco1 0.7182 69 204
ID Description Score Start End Superfamily
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.764 66 207 3.40.30.10
af_P38072_102_285_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7374 64 208 3.40.30.10
af_K7MTL0_161_316_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7215 83 207 3.40.30.10
4bpyA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7182 54 209 3.40.30.10
af_Q4D9Q9_96_284_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.717 64 212 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A418X5S6-F1-model_v4 Cytochrome C oxidase subunit I 0.9694 37 212
AF-A0A6L6PXH2-F1-model_v4 Redoxin domain-containing protein 0.9684 37 212
AF-A0A536VIA3-F1-model_v4 Cytochrome C oxidase subunit I 0.9661 75 212
AF-A0A418X5S6-F1-model_v4 Cytochrome C oxidase subunit I 0.9639 37 212
AF-A0A6L6PXH2-F1-model_v4 Redoxin domain-containing protein 0.9629 37 212

Map