F449725

General Info

Members Datasets Scaffolds Average Seq Length
466 271 433 260

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0047390|Ga0495642_0047390_669_1562
Length 297
Sequence VQHFPTRQLRFFLTAPSPCPYLPDRFERKVFAHLPLSEGASVNDSLTQVGFRRSQNIAYRPACEACTACVSARIPAEDYIFSRSERRTLARNDDLERHLVEAEATMEQFDLLRRYLTTRHADGGMAEMTWPDFVAMVEDTAVRTHLIEYRLRSKDGGPGDLIACALVDLMSDGLSLVYSFYDPTMGRRSLGSYVILDHVIQACLTNLPYVYLGYWVRGSMKMDYKVRFSPIELLKPEGWTLLSARDNEAGAIPTRGRGQSVRPQHSRLRSSTAASVLARLAGVFPMAGQGVWPDSCG

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
8 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
12 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
13 2643221640 Caulobacter sp. Root342 Isolate Unclassified
14 2643221642 Caulobacter sp. Root343 Isolate Unclassified
15 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
16 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
17 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
18 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
19 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2818991435 Caulobacter henricii 536 Isolate Unclassified
22 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
23 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
24 2849560528 Caulobacter zeae 410 Isolate Unclassified
25 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
26 2851153111 Caulobacter radicis 736 Isolate Unclassified
27 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
28 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
29 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
30 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
31 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
32 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
33 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
189 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
240 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
241 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
242 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
243 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
244 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
245 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
246 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
247 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
248 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
249 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
250 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
251 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
254 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
255 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
256 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
258 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
259 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
265 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
266 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
267 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
270 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
271 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 0
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.24
Nodule 0
Rhizoplane 2.36
Rhizosphere 67.81
Stem 0
Stem Tuber 0
Unclassified 8.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055537_1002613 3300003773 Bacteria 5897
2 Ga0055536_1000689 3300003781 Bacteria 22680
3 Ga0055536_1000750 3300003781 Bacteria 21664
4 Ga0055528_1006429 3300003790 Bacteria 5329
5 Ga0055530_10005161 3300003791 Bacteria 6364
6 Ga0055530_10015291 3300003791 Bacteria 2513
7 Ga0055531_10000307 3300003794 Bacteria 48396
8 Ga0055531_10003562 3300003794 Bacteria 9886
9 Ga0055531_10005109 3300003794 Bacteria 7751
10 Ga0055531_10008569 3300003794 Bacteria 5367
11 Ga0065165_1004073 3300005262 Bacteria 9473
12 Ga0070658_10042597 3300005327 Bacteria 3667
13 Ga0070658_10134358 3300005327 Bacteria 2063
14 Ga0070670_100263779 3300005331 Bacteria 1502
15 Ga0070666_10026098 3300005335 Bacteria 3814
16 Ga0070680_100003919 3300005336 Bacteria 11125
17 Ga0070680_100028058 3300005336 Bacteria 4513
18 Ga0070660_100006139 3300005339 Bacteria 8312
19 Ga0070660_100115582 3300005339 Bacteria 2139
20 Ga0070691_10002909 3300005341 Bacteria 7679
21 Ga0070668_100001314 3300005347 Bacteria 17796
22 Ga0070668_100002513 3300005347 Bacteria 13506
23 Ga0070668_100003794 3300005347 Bacteria 11167
24 Ga0070669_100310191 3300005353 Bacteria 1271
25 Ga0070671_100000153 3300005355 Bacteria 45037
26 Ga0070671_100180578 3300005355 Bacteria 1786
27 Ga0070673_100301168 3300005364 Bacteria 1411
28 Ga0070659_100103099 3300005366 Bacteria 2297
29 Ga0070667_100000164 3300005367 Bacteria 82930
30 Ga0070667_100010779 3300005367 Bacteria 7553
31 Ga0070667_100030589 3300005367 Bacteria 4490
32 Ga0070667_100621948 3300005367 Bacteria 996
33 Ga0070663_100184566 3300005455 Bacteria 1620
34 Ga0070663_100277774 3300005455 Bacteria 1334
35 Ga0070662_100104822 3300005457 Bacteria 2146
36 Ga0070681_10006236 3300005458 Bacteria 11594
37 Ga0070681_10008777 3300005458 Bacteria 9922
38 Ga0070698_100187674 3300005471 Bacteria 2005
39 Ga0070679_100007723 3300005530 Bacteria 10071
40 Ga0070679_100018512 3300005530 Bacteria 6760
41 Ga0068853_100253714 3300005539 Bacteria 1615
42 Ga0068853_100290302 3300005539 Bacteria 1510
43 Ga0070665_100000327 3300005548 Bacteria 73382
44 Ga0070665_100000435 3300005548 Bacteria 60967
45 Ga0070665_100000489 3300005548 Bacteria 56677
46 Ga0070665_100065040 3300005548 Bacteria 3659
47 Ga0068855_100010643 3300005563 Bacteria 11094
48 Ga0068855_100222206 3300005563 Bacteria 2117
49 Ga0068855_100305905 3300005563 Bacteria 1760
50 Ga0070664_100014357 3300005564 Bacteria 6458
51 Ga0070664_100197692 3300005564 Bacteria 1793
52 Ga0068854_100452923 3300005578 Bacteria 1072
53 Ga0068856_100409386 3300005614 Bacteria 1376
54 Ga0068852_100022666 3300005616 Bacteria 5041
55 Ga0068859_100028356 3300005617 Bacteria 5612
56 Ga0068859_100081503 3300005617 Bacteria 3278
57 Ga0068859_100124405 3300005617 Bacteria 2647
58 Ga0068864_100000068 3300005618 Bacteria 115507
59 Ga0068864_100028069 3300005618 Bacteria 4756
60 Ga0068864_100044149 3300005618 Bacteria 3819
61 Ga0068864_100266967 3300005618 Bacteria 1593
62 Ga0068861_100054639 3300005719 Bacteria 3043
63 Ga0068861_100274876 3300005719 Bacteria 1448
64 Ga0068863_100000036 3300005841 Bacteria 164593
65 Ga0068863_100006128 3300005841 Bacteria 11793
66 Ga0068863_100047211 3300005841 Bacteria 4086
67 Ga0068863_100161659 3300005841 Bacteria 2146
68 Ga0068863_100182443 3300005841 Bacteria 2015
69 Ga0068858_100000030 3300005842 Bacteria 144357
70 Ga0068858_100013333 3300005842 Bacteria 7754
71 Ga0068858_100015350 3300005842 Bacteria 7204
72 Ga0068858_100206843 3300005842 Bacteria 1857
73 Ga0068860_100000625 3300005843 Bacteria 41833
74 Ga0068860_100111096 3300005843 Bacteria 2620
75 Ga0068862_100014236 3300005844 Bacteria 6597
76 Ga0068862_100057559 3300005844 Bacteria 3334
77 Ga0068862_100070631 3300005844 Bacteria 3014
78 Ga0068862_100141605 3300005844 Bacteria 2135
79 Ga0070717_10211147 3300006028 Bacteria 1703
80 Ga0075365_10297554 3300006038 Bacteria 1135
81 Ga0075363_100192315 3300006048 Bacteria 1164
82 Ga0075364_10002360 3300006051 Bacteria 10606
83 Ga0075367_10009950 3300006178 Bacteria 4983
84 Ga0075369_10008571 3300006186 Bacteria 3939
85 Ga0075369_10108666 3300006186 Bacteria 1249
86 Ga0068865_100001535 3300006881 Bacteria 13468
87 Ga0097620_100028357 3300006931 Bacteria 5612
88 Ga0097620_100081509 3300006931 Bacteria 3278
89 Ga0097620_100124402 3300006931 Bacteria 2647
90 Ga0105250_10086630 3300009092 Bacteria 1272
91 Ga0105240_10003668 3300009093 Bacteria 23753
92 Ga0105240_10053244 3300009093 Bacteria 5082
93 Ga0105240_10061003 3300009093 Bacteria 4701
94 Ga0105240_10075728 3300009093 Bacteria 4150
95 Ga0105240_10300397 3300009093 Bacteria 1837
96 Ga0105248_10000335 3300009177 Bacteria 55396
97 Ga0105248_10002814 3300009177 Bacteria 19315
98 Ga0105248_10007227 3300009177 Bacteria 12181
99 Ga0105248_10278223 3300009177 Bacteria 1884
100 Ga0105237_10396359 3300009545 Bacteria 1385
101 Ga0105238_10041512 3300009551 Bacteria 4658
102 Ga0105238_10270735 3300009551 Bacteria 1679
103 Ga0105238_10705269 3300009551 Bacteria 1021
104 Ga0105249_10005313 3300009553 Bacteria 11117
105 Ga0105249_10260535 3300009553 Bacteria 1723
106 Ga0105239_10623687 3300010375 Bacteria 1231
107 Ga0157373_10006647 3300013100 Bacteria 8614
108 Ga0157370_10087240 3300013104 Bacteria 2931
109 Ga0157369_10122069 3300013105 Bacteria 2763
110 Ga0157369_11018101 3300013105 Bacteria 848
111 Ga0157374_10586004 3300013296 Bacteria 1125
112 Ga0163162_10048692 3300013306 Bacteria 4247
113 Ga0157372_10056415 3300013307 Bacteria 4389
114 Ga0157375_10396527 3300013308 Bacteria 1547
115 Ga0163163_10000698 3300014325 Bacteria 28545
116 Ga0163163_10056830 3300014325 Bacteria 3868
117 Ga0163163_10089961 3300014325 Bacteria 3083
118 Ga0163163_10096786 3300014325 Bacteria 2972
119 Ga0163163_10173294 3300014325 Bacteria 2204
120 Ga0163163_10275445 3300014325 Bacteria 1734
121 Ga0157380_11142772 3300014326 Bacteria 820
122 Ga0157379_10000956 3300014968 Bacteria 23412
123 Ga0157379_10031414 3300014968 Bacteria 4730
124 Ga0157379_10217580 3300014968 Bacteria 1730
125 Ga0163161_10217141 3300017792 Bacteria 1479
126 Ga0163161_10420839 3300017792 Bacteria 1075
127 Ga0213872_10144069 3300021361 Bacteria 1044
128 Ga0209026_1000780 3300025250 Bacteria 17661
129 Ga0209148_1009461 3300025254 Bacteria 1896
130 Ga0209565_1000354 3300025263 Bacteria 40069
131 Ga0209673_1000961 3300025273 Bacteria 35930
132 Ga0209675_1010151 3300025291 Bacteria 3244
133 Ga0209676_1000061 3300025292 Bacteria 332674
134 Ga0209676_1000136 3300025292 Bacteria 181860
135 Ga0209676_1000200 3300025292 Bacteria 133793
136 Ga0209676_1007843 3300025292 Bacteria 4908
137 Ga0209564_1000667 3300025295 Bacteria 50734
138 Ga0209564_1011737 3300025295 Bacteria 3893
139 Ga0209758_1002676 3300025297 Bacteria 17601
140 Ga0209758_1002962 3300025297 Bacteria 16286
141 Ga0209050_1000057 3300025298 Bacteria 326289
142 Ga0209050_1000431 3300025298 Bacteria 76895
143 Ga0209050_1000568 3300025298 Bacteria 59952
144 Ga0209256_1000707 3300025299 Bacteria 44360
145 Ga0209051_1000836 3300025303 Bacteria 31706
146 Ga0209257_1000142 3300025304 Bacteria 200756
147 Ga0209257_1000199 3300025304 Bacteria 148045
148 Ga0209257_1000572 3300025304 Bacteria 61910
149 Ga0209257_1001049 3300025304 Bacteria 36732
150 Ga0209257_1001182 3300025304 Bacteria 33003
151 Ga0207696_1045901 3300025711 Bacteria 1262
152 Ga0207680_10025240 3300025903 Bacteria 3276
153 Ga0207680_10031558 3300025903 Bacteria 3002
154 Ga0207680_10068851 3300025903 Bacteria 2185
155 Ga0207680_10285878 3300025903 Bacteria 1147
156 Ga0207705_10003443 3300025909 Bacteria 12038
157 Ga0207707_10012872 3300025912 Bacteria 7280
158 Ga0207707_10161144 3300025912 Bacteria 1961
159 Ga0207707_10265571 3300025912 Bacteria 1488
160 Ga0207707_10526731 3300025912 Bacteria 1006
161 Ga0207695_10001303 3300025913 Bacteria 42365
162 Ga0207695_10002836 3300025913 Bacteria 25176
163 Ga0207695_10507412 3300025913 Bacteria 1088
164 Ga0207660_10000845 3300025917 Bacteria 20177
165 Ga0207660_10260103 3300025917 Bacteria 1372
166 Ga0207657_10041777 3300025919 Bacteria 4051
167 Ga0207649_10378057 3300025920 Bacteria 1055
168 Ga0207652_10009166 3300025921 Bacteria 7964
169 Ga0207652_10032089 3300025921 Bacteria 4412
170 Ga0207681_10459108 3300025923 Bacteria 1037
171 Ga0207694_10022208 3300025924 Bacteria 4812
172 Ga0207694_10037811 3300025924 Bacteria 3710
173 Ga0207694_10038387 3300025924 Bacteria 3682
174 Ga0207694_10046695 3300025924 Bacteria 3347
175 Ga0207694_10507595 3300025924 Bacteria 1010
176 Ga0207650_10000161 3300025925 Bacteria 81097
177 Ga0207650_10014204 3300025925 Bacteria 5532
178 Ga0207644_10026310 3300025931 Bacteria 4007
179 Ga0207644_10038670 3300025931 Bacteria 3363
180 Ga0207690_10000294 3300025932 Bacteria 35162
181 Ga0207690_10008516 3300025932 Bacteria 6084
182 Ga0207690_10008700 3300025932 Bacteria 6023
183 Ga0207706_10043661 3300025933 Bacteria 3972
184 Ga0207704_10000963 3300025938 Bacteria 12727
185 Ga0207711_10004279 3300025941 Bacteria 12197
186 Ga0207711_10005573 3300025941 Bacteria 10646
187 Ga0207679_10105197 3300025945 Bacteria 2216
188 Ga0207667_10013715 3300025949 Bacteria 9263
189 Ga0207667_10034504 3300025949 Bacteria 5432
190 Ga0207667_10117223 3300025949 Bacteria 2744
191 Ga0207667_10137058 3300025949 Bacteria 2520
192 Ga0207667_10141677 3300025949 Bacteria 2475
193 Ga0207712_10002765 3300025961 Bacteria 11217
194 Ga0207712_10226134 3300025961 Bacteria 1499
195 Ga0207668_10000180 3300025972 Bacteria 42714
196 Ga0207668_10000413 3300025972 Bacteria 26960
197 Ga0207668_10002455 3300025972 Bacteria 10825
198 Ga0207668_10018561 3300025972 Bacteria 4380
199 Ga0207668_10028229 3300025972 Bacteria 3666
200 Ga0207668_10028977 3300025972 Bacteria 3626
201 Ga0207640_10326373 3300025981 Bacteria 1224
202 Ga0207658_10000106 3300025986 Bacteria 90920
203 Ga0207658_10007897 3300025986 Bacteria 7247
204 Ga0207658_10389759 3300025986 Bacteria 1222
205 Ga0207703_10000037 3300026035 Bacteria 176167
206 Ga0207703_10015822 3300026035 Bacteria 5884
207 Ga0207703_10059485 3300026035 Bacteria 3121
208 Ga0207703_10147924 3300026035 Bacteria 2045
209 Ga0207639_10138716 3300026041 Bacteria 2023
210 Ga0207639_10483401 3300026041 Bacteria 1129
211 Ga0207678_10124641 3300026067 Bacteria 2198
212 Ga0207702_10112636 3300026078 Bacteria 2422
213 Ga0207702_10447228 3300026078 Bacteria 1253
214 Ga0207641_10000055 3300026088 Bacteria 170796
215 Ga0207641_10001659 3300026088 Bacteria 21728
216 Ga0207641_10011195 3300026088 Bacteria 7358
217 Ga0207641_10139115 3300026088 Bacteria 2188
218 Ga0207641_10179342 3300026088 Bacteria 1939
219 Ga0207676_10000744 3300026095 Bacteria 25497
220 Ga0207676_10013576 3300026095 Bacteria 5846
221 Ga0207676_10031259 3300026095 Bacteria 4003
222 Ga0207676_10033928 3300026095 Bacteria 3861
223 Ga0207676_10219785 3300026095 Bacteria 1691
224 Ga0207675_100457078 3300026118 Bacteria 1266
225 Ga0207683_10386087 3300026121 Bacteria 1287
226 Ga0207698_10367715 3300026142 Bacteria 1364
227 Ga0209999_1002881 3300027543 Bacteria 3052
228 Ga0209813_10006607 3300027866 Bacteria 2871
229 Ga0268266_10000064 3300028379 Bacteria 249533
230 Ga0268266_10000450 3300028379 Bacteria 60987
231 Ga0268266_10014856 3300028379 Bacteria 6685
232 Ga0268266_10096731 3300028379 Bacteria 2596
233 Ga0268266_10125697 3300028379 Bacteria 2288
234 Ga0268265_10003333 3300028380 Bacteria 11616
235 Ga0268265_10005595 3300028380 Bacteria 8580
236 Ga0268265_10014106 3300028380 Bacteria 5446
237 Ga0268265_10106024 3300028380 Bacteria 2282
238 Ga0268264_10000046 3300028381 Bacteria 364597
239 Ga0268264_10000059 3300028381 Bacteria 306927
240 Ga0268264_10004827 3300028381 Bacteria 11425
241 Ga0268264_10286504 3300028381 Bacteria 1545
242 Ga0265319_1070912 3300028563 Bacteria 1117
243 Ga0265334_10017019 3300028573 Bacteria 3007
244 Ga0307517_10005270 3300028786 Bacteria 19547
245 Ga0307515_10081295 3300028794 Bacteria 4211
246 Ga0265338_10000869 3300028800 Bacteria 51220
247 Ga0265338_10063642 3300028800 Bacteria 3215
248 Ga0307511_10089687 3300030521 Bacteria 2093
249 Ga0265325_10000112 3300031241 Bacteria 55792
250 Ga0265340_10051745 3300031247 Bacteria 1988
251 Ga0265339_10002509 3300031249 Bacteria 13109
252 Ga0265331_10017250 3300031250 Bacteria 3771
253 Ga0265327_10123206 3300031251 Bacteria 1226
254 Ga0307513_10000181 3300031456 Bacteria 91264
255 Ga0307513_10001560 3300031456 Bacteria 32859
256 Ga0307513_10003287 3300031456 Bacteria 22017
257 Ga0265313_10001297 3300031595 Bacteria 23643
258 Ga0307508_10211268 3300031616 Bacteria 1541
259 Ga0265314_10109031 3300031711 Unclassified 1763
260 Ga0265342_10011516 3300031712 Bacteria 6047
261 Ga0307516_10000004 3300031730 Bacteria 367451
262 Ga0307412_10004337 3300031911 Bacteria 7910
263 Ga0307414_10021457 3300032004 Bacteria 4053
264 Ga0307510_10056419 3300033180 Bacteria 4091
265 Ga0373936_0011279 3300035113 Bacteria 3381
266 Ga0373937_0739815 3300036401 Bacteria 931
267 Ga0395899_0000013 3300037312 Bacteria 510397
268 Ga0395899_0000100 3300037312 Bacteria 151710
269 Ga0395899_0174440 3300037312 Bacteria 1512
270 Ga0395900_0000009 3300037418 Bacteria 476249
271 Ga0395900_0108643 3300037418 Bacteria 2850
272 Ga0395900_0237558 3300037418 Bacteria 1829
273 Ga0395898_0012235 3300037466 Bacteria 8870
274 Ga0395898_0157714 3300037466 Bacteria 2170
275 Ga0395905_0000983 3300037471 Bacteria 36562
276 Ga0395905_0008702 3300037471 Bacteria 9990
277 Ga0395905_0064704 3300037471 Bacteria 3423
278 Ga0395901_0000014 3300038443 Bacteria 375100
279 Ga0395901_0235762 3300038443 Bacteria 1909
280 Ga0436365_1271125 3300039437 Bacteria 3300
281 Ga0436365_1884511 3300039437 Bacteria 98004
282 Ga0436360_0503204 3300039438 Bacteria 893
283 Ga0436361_0107954 3300039447 Bacteria 6055
284 Ga0436361_0722808 3300039447 Bacteria 1849
285 Ga0436363_0806815 3300039450 Bacteria 1405
286 Ga0439465_0046730 3300041413 Bacteria 1410
287 Ga0439445_0054865 3300042004 Bacteria 1081
288 Ga0439459_0010785 3300042438 Bacteria 1600
289 Ga0466966_0053850 3300044684 Bacteria 2552
290 Ga0466963_0501821 3300044694 Bacteria 857
291 Ga0466959_0110805 3300045049 Bacteria 1959
292 Ga0495627_000679 3300046453 Bacteria 26196
293 Ga0495629_0014901 3300046459 Bacteria 5590
294 Ga0495638_0000462 3300046460 Bacteria 48757
295 Ga0495638_0001280 3300046460 Bacteria 23445
296 Ga0495638_0001418 3300046460 Bacteria 21760
297 Ga0495638_0004552 3300046460 Bacteria 10504
298 Ga0495650_0000020 3300046471 Bacteria 533839
299 Ga0495650_0049728 3300046471 Bacteria 1739
300 Ga0495605_0142625 3300046474 Bacteria 1074
301 Ga0495583_0000069 3300046506 Bacteria 186863
302 Ga0495583_0118346 3300046506 Bacteria 1117
303 Ga0495606_0001454 3300046507 Bacteria 31699
304 Ga0495606_0030642 3300046507 Bacteria 3755
305 Ga0495610_0000731 3300046512 Bacteria 31166
306 Ga0495610_0001496 3300046512 Bacteria 20535
307 Ga0495616_0000112 3300046513 Bacteria 71263
308 Ga0495620_0082249 3300046515 Bacteria 1301
309 Ga0495631_0002719 3300046518 Bacteria 9813
310 Ga0495637_0006460 3300046520 Bacteria 5880
311 Ga0495637_0015178 3300046520 Bacteria 3617
312 Ga0495637_0018684 3300046520 Bacteria 3212
313 Ga0495644_0173645 3300046523 Bacteria 828
314 Ga0495648_0000724 3300046524 Bacteria 35198
315 Ga0495648_0118179 3300046524 Bacteria 1430
316 Ga0495642_0047390 3300046528 Bacteria 1760
317 Ga0495642_0098134 3300046528 Bacteria 1245
318 Ga0495654_0000018 3300046530 Bacteria 293124
319 Ga0495621_0094318 3300046539 Bacteria 1132
320 Ga0495597_0001857 3300046542 Bacteria 14445
321 Ga0495622_0007388 3300046557 Bacteria 5097
322 Ga0495668_0000014 3300046616 Bacteria 442055
323 Ga0495668_0003909 3300046616 Bacteria 10886
324 Ga0495668_0064959 3300046616 Bacteria 2008
325 Ga0495668_0065019 3300046616 Bacteria 2008
326 Ga0495668_0076512 3300046616 Bacteria 1837
327 Ga0495668_0085178 3300046616 Bacteria 1733
328 Ga0495668_0110935 3300046616 Bacteria 1500
329 Ga0495625_0000271 3300046660 Bacteria 80817
330 Ga0495625_0114117 3300046660 Bacteria 1844
331 Ga0495625_0372752 3300046660 Bacteria 897
332 Ga0495669_0000001 3300046684 Bacteria 291866
333 Ga0495669_0000172 3300046684 Bacteria 40888
334 Ga0495669_0061104 3300046684 Bacteria 1705
335 Ga0495670_0029256 3300046691 Bacteria 2734
336 Ga0495589_0006610 3300046794 Bacteria 6109
337 Ga0495687_021405 3300047443 Bacteria 3129
338 Ga0495677_0016491 3300047445 Bacteria 2681
339 Ga0495677_0031816 3300047445 Bacteria 1921
340 Ga0495679_041712 3300047446 Bacteria 1419
341 Ga0495673_0000094 3300047469 Bacteria 183868
342 Ga0495673_0000296 3300047469 Bacteria 66691
343 Ga0495686_0001837 3300047472 Bacteria 21314
344 Ga0495686_0028790 3300047472 Bacteria 3616
345 Ga0495602_0481463 3300048088 Bacteria 871
346 Ga0496102_0045101 3300048905 Bacteria 4002
347 Ga0496102_0093292 3300048905 Bacteria 2789
348 Ga0496105_0301157 3300048908 Bacteria 1289
349 Ga0496106_0046083 3300048909 Bacteria 3276
350 Ga0496107_0000037 3300048910 Bacteria 78089
351 Ga0496112_0264109 3300048915 Bacteria 1670
352 Ga0496115_0027080 3300048918 Bacteria 4480
353 Ga0496115_0061583 3300048918 Bacteria 3025
354 Ga0496115_0125262 3300048918 Bacteria 2116
355 Ga0496115_0374369 3300048918 Bacteria 1159
356 Ga0496116_0042290 3300048919 Bacteria 3117
357 Ga0496117_0018687 3300048920 Bacteria 5729
358 Ga0496118_0015808 3300048921 Bacteria 6961
359 Ga0496121_0000852 3300048924 Bacteria 55246
360 Ga0496121_0001466 3300048924 Bacteria 39744
361 Ga0496125_0000598 3300048928 Bacteria 61438
362 Ga0496126_0001922 3300048929 Bacteria 29774
363 Ga0501033_0231077 3300049570 Bacteria 1314
364 Ga0501034_0242998 3300049571 Bacteria 1746
365 Ga0501034_0444437 3300049571 Bacteria 1215
366 Ga0501047_0002694 3300049581 Bacteria 16915
367 Ga0501047_0047893 3300049581 Bacteria 4129
368 Ga0501048_0239040 3300049582 Bacteria 1289
369 Ga0501070_0395497 3300049586 Bacteria 1118
370 Ga0501257_016545 3300049686 Bacteria 1711
371 Ga0501035_0468041 3300049822 Bacteria 1041
372 Ga0501044_0181710 3300049823 Bacteria 2070
373 Ga0501044_0295235 3300049823 Bacteria 1551
374 Ga0501044_0764128 3300049823 Bacteria 848
375 nmdc:mga00v17_2041_c1 3300050491 Bacteria 10398
376 nmdc:mga0k408_35168_c1 3300050493 Bacteria 2872
377 nmdc:mga06z11_201740_c1 3300050494 Bacteria 1156
378 nmdc:mga04h51_3583_c1 3300050495 Bacteria 3785
379 nmdc:mga0sz30_15618_c1 3300050516 Bacteria 3003
380 Ga0500578_0000035 3300053086 Bacteria 136406
381 Ga0500578_0171824 3300053086 Bacteria 1340
382 Ga0500643_004968 3300053087 Bacteria 5846
383 Ga0500643_010684 3300053087 Bacteria 3398
384 Ga0500643_013486 3300053087 Bacteria 2884
385 Ga0500643_014449 3300053087 Bacteria 2744
386 Ga0500644_0000508 3300053088 Bacteria 16629
387 Ga0500644_0032355 3300053088 Bacteria 1671
388 Ga0500583_0098638 3300053092 Bacteria 1429
389 Ga0500651_0034928 3300053093 Bacteria 3169
390 Ga0500651_0152875 3300053093 Bacteria 1385
391 Ga0500641_0000388 3300053096 Bacteria 16338
392 Ga0500641_0002268 3300053096 Bacteria 6817
393 Ga0500650_0046477 3300053098 Bacteria 2012
394 Ga0500554_052120 3300053102 Bacteria 1290
395 Ga0500556_0000111 3300053104 Bacteria 72589
396 Ga0500562_000185 3300053108 Bacteria 16837
397 Ga0500562_000418 3300053108 Bacteria 10340
398 Ga0500562_001174 3300053108 Bacteria 6457
399 Ga0500569_010992 3300053109 Bacteria 2149
400 Ga0500572_051725 3300053111 Bacteria 1226
401 Ga0500594_0000176 3300053118 Bacteria 16254
402 Ga0500595_007953 3300053119 Bacteria 4358
403 Ga0500595_009858 3300053119 Bacteria 3832
404 Ga0500608_000093 3300053122 Bacteria 36398
405 Ga0500608_001039 3300053122 Bacteria 9934
406 Ga0500614_002421 3300053123 Bacteria 4167
407 Ga0500614_013724 3300053123 Bacteria 1784
408 Ga0500618_000209 3300053125 Bacteria 46358
409 Ga0500652_145909 3300053131 Bacteria 983
410 Ga0500658_0002416 3300053134 Bacteria 7230
411 Ga0500559_0000101 3300053136 Bacteria 67160
412 Ga0500559_0007831 3300053136 Bacteria 4717
413 Ga0500559_0016575 3300053136 Bacteria 3112
414 Ga0500559_0120974 3300053136 Bacteria 1217
415 Ga0500564_004773 3300053138 Bacteria 5469
416 Ga0500577_0042015 3300053142 Bacteria 1671
417 Ga0500603_044635 3300053150 Bacteria 1194
418 Ga0500616_0019140 3300053153 Bacteria 3862
419 Ga0500622_0000180 3300053156 Bacteria 68052
420 Ga0500622_0004073 3300053156 Bacteria 9385
421 Ga0500622_0011345 3300053156 Bacteria 4857
422 Ga0500627_0070624 3300053158 Bacteria 1546
423 Ga0500638_167673 3300053162 Bacteria 960
424 Ga0500637_0002023 3300053178 Bacteria 8845
425 Ga0500637_0055416 3300053178 Bacteria 2264
426 Ga0500625_025584 3300053729 Bacteria 2792
427 Ga0500645_000433 3300053730 Bacteria 28666
428 Ga0500645_000457 3300053730 Bacteria 28069
429 Ga0500645_002058 3300053730 Bacteria 9334
430 Ga0500645_020526 3300053730 Bacteria 2048
431 Ga0500609_008612 3300053731 Bacteria 1376
432 Ga0500596_000136 3300053735 Bacteria 10927
433 Ga0500601_002672 3300053737 Bacteria 1916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_11018101 Ga0157369_110181011 233
2 3300031247 Ga0265340_10051745 Ga0265340_100517452 236
3 3300028800 Ga0265338_10063642 Ga0265338_100636423 238
4 iso_pu_bacteria 2643221663 2644352079 240
5 iso_pu_bacteria 2941485952 2941488521 240
6 3300049823 Ga0501044_0181710 Ga0501044_0181710_488_1234 241
7 iso_pu_bacteria 2928972540 2928974917 241
8 iso_pu_bacteria 2977240413 2977242039 241
9 3300053087 Ga0500643_010684 Ga0500643_010684_1750_2589 242
10 3300005539 Ga0068853_100253714 Ga0068853_1002537142 243
11 3300025292 Ga0209676_1007843 Ga0209676_10078435 243
12 3300028573 Ga0265334_10017019 Ga0265334_100170192 243
13 3300028800 Ga0265338_10000869 Ga0265338_100008699 243
14 3300031241 Ga0265325_10000112 Ga0265325_1000011212 243
15 3300031249 Ga0265339_10002509 Ga0265339_100025095 243
16 3300031250 Ga0265331_10017250 Ga0265331_100172501 243
17 3300031595 Ga0265313_10001297 Ga0265313_100012979 243
18 3300031711 Ga0265314_10109031 Ga0265314_101090312 243
19 3300031712 Ga0265342_10011516 Ga0265342_100115166 243
20 iso_pu_bacteria 2643221640 2644226362 243
21 iso_pu_bacteria 2643221642 2644235850 243
22 iso_pu_bacteria 2928531327 2928534511 243
23 3300032004 Ga0307414_10021457 Ga0307414_100214574 244
24 3300048928 Ga0496125_0000598 Ga0496125_0000598_44089_44823 244
25 3300053156 Ga0500622_0004073 Ga0500622_0004073_6350_7102 244
26 3300017792 Ga0163161_10420839 Ga0163161_104208391 245
27 3300026118 Ga0207675_100457078 Ga0207675_1004570782 245
28 3300033180 Ga0307510_10056419 Ga0307510_100564193 245
29 3300009093 Ga0105240_10003668 Ga0105240_1000366825 246
30 iso_pu_bacteria 2558860983 2561466115 246
31 iso_pu_bacteria 2791355048 2792459455 246
32 iso_pu_bacteria 2849560528 2849560744 246
33 iso_pu_bacteria 2851153111 2851158109 246
34 3300003781 Ga0055536_1000689 Ga0055536_10006895 247
35 3300003781 Ga0055536_1000750 Ga0055536_100075020 247
36 3300003791 Ga0055530_10005161 Ga0055530_100051615 247
37 3300003791 Ga0055530_10015291 Ga0055530_100152912 247
38 3300003794 Ga0055531_10000307 Ga0055531_1000030744 247
39 3300005564 Ga0070664_100014357 Ga0070664_1000143576 247
40 3300006186 Ga0075369_10008571 Ga0075369_100085713 247
41 3300025292 Ga0209676_1000136 Ga0209676_100013617 247
42 3300025295 Ga0209564_1011737 Ga0209564_10117374 247
43 3300025298 Ga0209050_1000568 Ga0209050_100056817 247
44 3300025304 Ga0209257_1000142 Ga0209257_100014217 247
45 3300026078 Ga0207702_10112636 Ga0207702_101126363 247
46 3300026088 Ga0207641_10179342 Ga0207641_101793422 247
47 3300053131 Ga0500652_145909 Ga0500652_145909_192_935 247
48 3300005618 Ga0068864_100044149 Ga0068864_1000441493 248
49 3300017792 Ga0163161_10217141 Ga0163161_102171411 248
50 3300021361 Ga0213872_10144069 Ga0213872_101440692 248
51 3300025903 Ga0207680_10068851 Ga0207680_100688512 248
52 3300026095 Ga0207676_10033928 Ga0207676_100339283 248
53 3300031911 Ga0307412_10004337 Ga0307412_100043378 248
54 3300039447 Ga0436361_0107954 Ga0436361_0107954_847_1593 248
55 3300039447 Ga0436361_0722808 Ga0436361_0722808_374_1120 248
56 3300053087 Ga0500643_004968 Ga0500643_004968_4843_5616 248
57 3300005327 Ga0070658_10134358 Ga0070658_101343582 249
58 3300028379 Ga0268266_10096731 Ga0268266_100967312 249
59 3300037312 Ga0395899_0000013 Ga0395899_0000013_375366_376121 249
60 3300039450 Ga0436363_0806815 Ga0436363_0806815_99_986 249
61 3300044684 Ga0466966_0053850 Ga0466966_0053850_1764_2516 249
62 3300045049 Ga0466959_0110805 Ga0466959_0110805_148_900 249
63 3300046539 Ga0495621_0094318 Ga0495621_0094318_195_944 249
64 3300048915 Ga0496112_0264109 Ga0496112_0264109_749_1519 249
65 iso_pu_bacteria 2643221699 2644548209 249
66 3300005355 Ga0070671_100180578 Ga0070671_1001805782 250
67 3300005364 Ga0070673_100301168 Ga0070673_1003011681 250
68 3300005455 Ga0070663_100277774 Ga0070663_1002777742 250
69 3300005457 Ga0070662_100104822 Ga0070662_1001048223 250
70 3300005563 Ga0068855_100305905 Ga0068855_1003059052 250
71 3300005564 Ga0070664_100197692 Ga0070664_1001976922 250
72 3300005618 Ga0068864_100028069 Ga0068864_1000280693 250
73 3300005841 Ga0068863_100161659 Ga0068863_1001616592 250
74 3300006881 Ga0068865_100001535 Ga0068865_10000153511 250
75 3300009177 Ga0105248_10278223 Ga0105248_102782232 250
76 3300009545 Ga0105237_10396359 Ga0105237_103963592 250
77 3300009551 Ga0105238_10705269 Ga0105238_107052691 250
78 3300013306 Ga0163162_10048692 Ga0163162_100486922 250
79 3300013308 Ga0157375_10396527 Ga0157375_103965272 250
80 3300014325 Ga0163163_10089961 Ga0163163_100899612 250
81 3300014325 Ga0163163_10096786 Ga0163163_100967863 250
82 3300014968 Ga0157379_10217580 Ga0157379_102175802 250
83 3300025920 Ga0207649_10378057 Ga0207649_103780572 250
84 3300025924 Ga0207694_10037811 Ga0207694_100378113 250
85 3300025924 Ga0207694_10507595 Ga0207694_105075951 250
86 3300025933 Ga0207706_10043661 Ga0207706_100436612 250
87 3300025938 Ga0207704_10000963 Ga0207704_100009636 250
88 3300025945 Ga0207679_10105197 Ga0207679_101051972 250
89 3300025949 Ga0207667_10137058 Ga0207667_101370581 250
90 3300025961 Ga0207712_10226134 Ga0207712_102261342 250
91 3300025986 Ga0207658_10389759 Ga0207658_103897591 250
92 3300026067 Ga0207678_10124641 Ga0207678_101246413 250
93 3300026078 Ga0207702_10447228 Ga0207702_104472282 250
94 3300026095 Ga0207676_10031259 Ga0207676_100312593 250
95 3300036401 Ga0373937_0739815 Ga0373937_0739815_117_869 250
96 3300044694 Ga0466963_0501821 Ga0466963_0501821_77_829 250
97 3300048905 Ga0496102_0045101 Ga0496102_0045101_997_1749 250
98 3300049581 Ga0501047_0047893 Ga0501047_0047893_763_1515 250
99 iso_pu_bacteria 2643221614 2644085059 250
100 iso_pu_bacteria 2643221661 2644342611 250
101 iso_pu_bacteria 2643221666 2644365911 250
102 3300005471 Ga0070698_100187674 Ga0070698_1001876742 251
103 3300006038 Ga0075365_10297554 Ga0075365_102975542 251
104 3300006048 Ga0075363_100192315 Ga0075363_1001923152 251
105 3300014326 Ga0157380_11142772 Ga0157380_111427721 251
106 3300027543 Ga0209999_1002881 Ga0209999_10028812 251
107 3300037312 Ga0395899_0000100 Ga0395899_0000100_97319_98074 251
108 3300037418 Ga0395900_0000009 Ga0395900_0000009_159841_160596 251
109 3300037466 Ga0395898_0012235 Ga0395898_0012235_1775_2530 251
110 3300037471 Ga0395905_0008702 Ga0395905_0008702_696_1451 251
111 3300037471 Ga0395905_0064704 Ga0395905_0064704_438_1193 251
112 3300038443 Ga0395901_0000014 Ga0395901_0000014_111061_111816 251
113 3300039437 Ga0436365_1271125 Ga0436365_1271125_241_996 251
114 3300046471 Ga0495650_0049728 Ga0495650_0049728_418_1173 251
115 3300046616 Ga0495668_0065019 Ga0495668_0065019_1199_1954 251
116 3300049581 Ga0501047_0002694 Ga0501047_0002694_11838_12614 251
117 3300005336 Ga0070680_100003919 Ga0070680_1000039195 252
118 3300005339 Ga0070660_100006139 Ga0070660_1000061396 252
119 3300005339 Ga0070660_100115582 Ga0070660_1001155823 252
120 3300005366 Ga0070659_100103099 Ga0070659_1001030992 252
121 3300005455 Ga0070663_100184566 Ga0070663_1001845662 252
122 3300005458 Ga0070681_10008777 Ga0070681_100087773 252
123 3300005530 Ga0070679_100007723 Ga0070679_1000077233 252
124 3300005548 Ga0070665_100000327 Ga0070665_10000032772 252
125 3300005563 Ga0068855_100010643 Ga0068855_1000106437 252
126 3300006028 Ga0070717_10211147 Ga0070717_102111471 252
127 3300009177 Ga0105248_10000335 Ga0105248_1000033544 252
128 3300009551 Ga0105238_10041512 Ga0105238_100415125 252
129 3300010375 Ga0105239_10623687 Ga0105239_106236872 252
130 3300025254 Ga0209148_1009461 Ga0209148_10094613 252
131 3300025903 Ga0207680_10285878 Ga0207680_102858781 252
132 3300025909 Ga0207705_10003443 Ga0207705_100034434 252
133 3300025912 Ga0207707_10012872 Ga0207707_100128722 252
134 3300025917 Ga0207660_10000845 Ga0207660_1000084514 252
135 3300025919 Ga0207657_10041777 Ga0207657_100417773 252
136 3300025921 Ga0207652_10009166 Ga0207652_100091665 252
137 3300025924 Ga0207694_10038387 Ga0207694_100383872 252
138 3300025932 Ga0207690_10000294 Ga0207690_100002949 252
139 3300025932 Ga0207690_10008516 Ga0207690_100085162 252
140 3300025941 Ga0207711_10005573 Ga0207711_100055732 252
141 3300025949 Ga0207667_10013715 Ga0207667_100137155 252
142 3300028379 Ga0268266_10000064 Ga0268266_1000006436 252
143 3300028786 Ga0307517_10005270 Ga0307517_100052708 252
144 3300030521 Ga0307511_10089687 Ga0307511_100896872 252
145 3300031456 Ga0307513_10001560 Ga0307513_1000156016 252
146 3300031616 Ga0307508_10211268 Ga0307508_102112682 252
147 3300031730 Ga0307516_10000004 Ga0307516_1000000424 252
148 3300039437 Ga0436365_1884511 Ga0436365_1884511_43384_44142 252
149 3300046684 Ga0495669_0000172 Ga0495669_0000172_36782_37540 252
150 3300047445 Ga0495677_0016491 Ga0495677_0016491_126_884 252
151 3300048918 Ga0496115_0061583 Ga0496115_0061583_527_1285 252
152 3300049822 Ga0501035_0468041 Ga0501035_0468041_223_981 252
153 3300049823 Ga0501044_0764128 Ga0501044_0764128_61_819 252
154 3300053119 Ga0500595_007953 Ga0500595_007953_1897_2655 252
155 iso_pu_bacteria 2643221598 2644000034 252
156 3300005327 Ga0070658_10042597 Ga0070658_100425972 253
157 3300005331 Ga0070670_100263779 Ga0070670_1002637792 253
158 3300005347 Ga0070668_100002513 Ga0070668_1000025132 253
159 3300005367 Ga0070667_100030589 Ga0070667_1000305894 253
160 3300005578 Ga0068854_100452923 Ga0068854_1004529231 253
161 3300005617 Ga0068859_100028356 Ga0068859_1000283568 253
162 3300005617 Ga0068859_100124405 Ga0068859_1001244052 253
163 3300005618 Ga0068864_100266967 Ga0068864_1002669672 253
164 3300005719 Ga0068861_100054639 Ga0068861_1000546392 253
165 3300005841 Ga0068863_100047211 Ga0068863_1000472114 253
166 3300005841 Ga0068863_100182443 Ga0068863_1001824433 253
167 3300005842 Ga0068858_100206843 Ga0068858_1002068432 253
168 3300005844 Ga0068862_100014236 Ga0068862_1000142364 253
169 3300005844 Ga0068862_100070631 Ga0068862_1000706312 253
170 3300005844 Ga0068862_100141605 Ga0068862_1001416052 253
171 3300006051 Ga0075364_10002360 Ga0075364_1000236011 253
172 3300006178 Ga0075367_10009950 Ga0075367_100099502 253
173 3300006186 Ga0075369_10108666 Ga0075369_101086662 253
174 3300006931 Ga0097620_100028357 Ga0097620_1000283573 253
175 3300006931 Ga0097620_100124402 Ga0097620_1001244022 253
176 3300009553 Ga0105249_10260535 Ga0105249_102605352 253
177 3300025912 Ga0207707_10526731 Ga0207707_105267311 253
178 3300025925 Ga0207650_10014204 Ga0207650_100142042 253
179 3300025972 Ga0207668_10018561 Ga0207668_100185616 253
180 3300025972 Ga0207668_10028229 Ga0207668_100282293 253
181 3300025972 Ga0207668_10028977 Ga0207668_100289773 253
182 3300026035 Ga0207703_10147924 Ga0207703_101479242 253
183 3300026088 Ga0207641_10139115 Ga0207641_101391153 253
184 3300026095 Ga0207676_10219785 Ga0207676_102197852 253
185 3300027866 Ga0209813_10006607 Ga0209813_100066072 253
186 3300028380 Ga0268265_10003333 Ga0268265_1000333310 253
187 3300028380 Ga0268265_10014106 Ga0268265_100141067 253
188 3300028380 Ga0268265_10106024 Ga0268265_101060242 253
189 3300028381 Ga0268264_10000046 Ga0268264_10000046312 253
190 3300028381 Ga0268264_10004827 Ga0268264_100048278 253
191 3300031456 Ga0307513_10000181 Ga0307513_1000018171 253
192 3300037418 Ga0395900_0108643 Ga0395900_0108643_777_1538 253
193 3300048918 Ga0496115_0125262 Ga0496115_0125262_1207_1968 253
194 3300048918 Ga0496115_0374369 Ga0496115_0374369_152_913 253
195 3300050491 nmdc:mga00v17_2041_c1 nmdc:mga00v17_2041_c1_8289_9050 253
196 3300050493 nmdc:mga0k408_35168_c1 nmdc:mga0k408_35168_c1_1229_1990 253
197 3300050494 nmdc:mga06z11_201740_c1 nmdc:mga06z11_201740_c1_20_781 253
198 3300050495 nmdc:mga04h51_3583_c1 nmdc:mga04h51_3583_c1_1763_2524 253
199 3300053093 Ga0500651_0152875 Ga0500651_0152875_372_1133 253
200 3300005336 Ga0070680_100028058 Ga0070680_1000280584 254
201 3300005367 Ga0070667_100010779 Ga0070667_1000107794 254
202 3300005367 Ga0070667_100621948 Ga0070667_1006219481 254
203 3300005539 Ga0068853_100290302 Ga0068853_1002903022 254
204 3300005548 Ga0070665_100000435 Ga0070665_1000004359 254
205 3300005563 Ga0068855_100222206 Ga0068855_1002222063 254
206 3300005614 Ga0068856_100409386 Ga0068856_1004093861 254
207 3300005616 Ga0068852_100022666 Ga0068852_1000226666 254
208 3300005841 Ga0068863_100000036 Ga0068863_100000036132 254
209 3300005842 Ga0068858_100000030 Ga0068858_10000003017 254
210 3300005844 Ga0068862_100057559 Ga0068862_1000575592 254
211 3300009092 Ga0105250_10086630 Ga0105250_100866302 254
212 3300009093 Ga0105240_10075728 Ga0105240_100757284 254
213 3300009093 Ga0105240_10300397 Ga0105240_103003972 254
214 3300009177 Ga0105248_10007227 Ga0105248_100072274 254
215 3300013105 Ga0157369_10122069 Ga0157369_101220693 254
216 3300013296 Ga0157374_10586004 Ga0157374_105860042 254
217 3300013307 Ga0157372_10056415 Ga0157372_100564154 254
218 3300014325 Ga0163163_10056830 Ga0163163_100568303 254
219 3300014968 Ga0157379_10031414 Ga0157379_100314142 254
220 3300025711 Ga0207696_1045901 Ga0207696_10459012 254
221 3300025912 Ga0207707_10161144 Ga0207707_101611442 254
222 3300025913 Ga0207695_10002836 Ga0207695_100028369 254
223 3300025913 Ga0207695_10507412 Ga0207695_105074122 254
224 3300025917 Ga0207660_10260103 Ga0207660_102601032 254
225 3300025931 Ga0207644_10038670 Ga0207644_100386703 254
226 3300025941 Ga0207711_10004279 Ga0207711_100042799 254
227 3300025949 Ga0207667_10034504 Ga0207667_100345043 254
228 3300025949 Ga0207667_10117223 Ga0207667_101172232 254
229 3300025972 Ga0207668_10000180 Ga0207668_1000018038 254
230 3300025981 Ga0207640_10326373 Ga0207640_103263732 254
231 3300025986 Ga0207658_10007897 Ga0207658_100078974 254
232 3300026035 Ga0207703_10000037 Ga0207703_10000037130 254
233 3300026088 Ga0207641_10000055 Ga0207641_1000005544 254
234 3300026095 Ga0207676_10013576 Ga0207676_100135766 254
235 3300026121 Ga0207683_10386087 Ga0207683_103860872 254
236 3300028379 Ga0268266_10000450 Ga0268266_100004509 254
237 3300037312 Ga0395899_0174440 Ga0395899_0174440_477_1241 254
238 3300037418 Ga0395900_0237558 Ga0395900_0237558_471_1235 254
239 3300037466 Ga0395898_0157714 Ga0395898_0157714_920_1684 254
240 3300038443 Ga0395901_0235762 Ga0395901_0235762_551_1315 254
241 3300041413 Ga0439465_0046730 Ga0439465_0046730_333_1097 254
242 3300046459 Ga0495629_0014901 Ga0495629_0014901_4143_4907 254
243 3300046506 Ga0495583_0118346 Ga0495583_0118346_200_964 254
244 3300046507 Ga0495606_0030642 Ga0495606_0030642_970_1734 254
245 3300046515 Ga0495620_0082249 Ga0495620_0082249_461_1225 254
246 3300046523 Ga0495644_0173645 Ga0495644_0173645_14_778 254
247 3300046524 Ga0495648_0118179 Ga0495648_0118179_640_1404 254
248 3300046528 Ga0495642_0098134 Ga0495642_0098134_316_1080 254
249 3300046542 Ga0495597_0001857 Ga0495597_0001857_265_1029 254
250 3300046557 Ga0495622_0007388 Ga0495622_0007388_1536_2300 254
251 3300046660 Ga0495625_0372752 Ga0495625_0372752_92_856 254
252 3300046684 Ga0495669_0000001 Ga0495669_0000001_72772_73536 254
253 3300046684 Ga0495669_0061104 Ga0495669_0061104_456_1220 254
254 3300047443 Ga0495687_021405 Ga0495687_021405_31_795 254
255 3300047445 Ga0495677_0031816 Ga0495677_0031816_308_1072 254
256 3300048088 Ga0495602_0481463 Ga0495602_0481463_80_844 254
257 3300048905 Ga0496102_0093292 Ga0496102_0093292_1556_2320 254
258 3300048919 Ga0496116_0042290 Ga0496116_0042290_1194_1958 254
259 3300048920 Ga0496117_0018687 Ga0496117_0018687_1175_1939 254
260 3300048921 Ga0496118_0015808 Ga0496118_0015808_4605_5369 254
261 3300048924 Ga0496121_0000852 Ga0496121_0000852_47095_47859 254
262 3300049570 Ga0501033_0231077 Ga0501033_0231077_239_1003 254
263 3300049571 Ga0501034_0242998 Ga0501034_0242998_878_1642 254
264 3300049571 Ga0501034_0444437 Ga0501034_0444437_227_991 254
265 3300049586 Ga0501070_0395497 Ga0501070_0395497_112_876 254
266 3300049823 Ga0501044_0295235 Ga0501044_0295235_93_857 254
267 3300053092 Ga0500583_0098638 Ga0500583_0098638_301_1065 254
268 3300053093 Ga0500651_0034928 Ga0500651_0034928_2374_3138 254
269 3300053109 Ga0500569_010992 Ga0500569_010992_314_1078 254
270 3300053111 Ga0500572_051725 Ga0500572_051725_243_1007 254
271 3300053119 Ga0500595_009858 Ga0500595_009858_424_1188 254
272 3300053122 Ga0500608_001039 Ga0500608_001039_8078_8842 254
273 3300053123 Ga0500614_002421 Ga0500614_002421_3058_3822 254
274 3300053136 Ga0500559_0016575 Ga0500559_0016575_1465_2229 254
275 3300053150 Ga0500603_044635 Ga0500603_044635_198_962 254
276 3300053162 Ga0500638_167673 Ga0500638_167673_30_794 254
277 3300053178 Ga0500637_0002023 Ga0500637_0002023_3818_4582 254
278 3300053178 Ga0500637_0055416 Ga0500637_0055416_324_1088 254
279 3300053729 Ga0500625_025584 Ga0500625_025584_1171_1935 254
280 3300053735 Ga0500596_000136 Ga0500596_000136_269_1033 254
281 3300053737 Ga0500601_002672 Ga0500601_002672_198_962 254
282 3300005335 Ga0070666_10026098 Ga0070666_100260982 255
283 3300005341 Ga0070691_10002909 Ga0070691_100029094 255
284 3300005347 Ga0070668_100001314 Ga0070668_1000013143 255
285 3300005347 Ga0070668_100003794 Ga0070668_1000037943 255
286 3300005353 Ga0070669_100310191 Ga0070669_1003101911 255
287 3300005355 Ga0070671_100000153 Ga0070671_1000001534 255
288 3300005367 Ga0070667_100000164 Ga0070667_10000016450 255
289 3300005458 Ga0070681_10006236 Ga0070681_100062368 255
290 3300005530 Ga0070679_100018512 Ga0070679_1000185125 255
291 3300005548 Ga0070665_100000489 Ga0070665_10000048946 255
292 3300005548 Ga0070665_100065040 Ga0070665_1000650403 255
293 3300005617 Ga0068859_100081503 Ga0068859_1000815031 255
294 3300005618 Ga0068864_100000068 Ga0068864_10000006824 255
295 3300005719 Ga0068861_100274876 Ga0068861_1002748762 255
296 3300005841 Ga0068863_100006128 Ga0068863_10000612812 255
297 3300005842 Ga0068858_100013333 Ga0068858_1000133332 255
298 3300005842 Ga0068858_100015350 Ga0068858_1000153503 255
299 3300005843 Ga0068860_100000625 Ga0068860_10000062532 255
300 3300005843 Ga0068860_100111096 Ga0068860_1001110962 255
301 3300006931 Ga0097620_100081509 Ga0097620_1000815091 255
302 3300009093 Ga0105240_10053244 Ga0105240_100532443 255
303 3300009093 Ga0105240_10061003 Ga0105240_100610033 255
304 3300009177 Ga0105248_10002814 Ga0105248_100028145 255
305 3300009551 Ga0105238_10270735 Ga0105238_102707352 255
306 3300009553 Ga0105249_10005313 Ga0105249_100053138 255
307 3300013104 Ga0157370_10087240 Ga0157370_100872403 255
308 3300014325 Ga0163163_10000698 Ga0163163_1000069810 255
309 3300014325 Ga0163163_10173294 Ga0163163_101732942 255
310 3300014325 Ga0163163_10275445 Ga0163163_102754452 255
311 3300014968 Ga0157379_10000956 Ga0157379_1000095616 255
312 3300025250 Ga0209026_1000780 Ga0209026_10007809 255
313 3300025304 Ga0209257_1000572 Ga0209257_100057236 255
314 3300025903 Ga0207680_10025240 Ga0207680_100252402 255
315 3300025903 Ga0207680_10031558 Ga0207680_100315582 255
316 3300025912 Ga0207707_10265571 Ga0207707_102655712 255
317 3300025913 Ga0207695_10001303 Ga0207695_1000130328 255
318 3300025921 Ga0207652_10032089 Ga0207652_100320895 255
319 3300025923 Ga0207681_10459108 Ga0207681_104591082 255
320 3300025924 Ga0207694_10022208 Ga0207694_100222086 255
321 3300025924 Ga0207694_10046695 Ga0207694_100466954 255
322 3300025925 Ga0207650_10000161 Ga0207650_1000016112 255
323 3300025931 Ga0207644_10026310 Ga0207644_100263101 255
324 3300025949 Ga0207667_10141677 Ga0207667_101416773 255
325 3300025961 Ga0207712_10002765 Ga0207712_100027658 255
326 3300025972 Ga0207668_10000413 Ga0207668_100004133 255
327 3300025972 Ga0207668_10002455 Ga0207668_100024557 255
328 3300025986 Ga0207658_10000106 Ga0207658_1000010687 255
329 3300026035 Ga0207703_10015822 Ga0207703_100158224 255
330 3300026035 Ga0207703_10059485 Ga0207703_100594852 255
331 3300026041 Ga0207639_10138716 Ga0207639_101387162 255
332 3300026041 Ga0207639_10483401 Ga0207639_104834011 255
333 3300026088 Ga0207641_10001659 Ga0207641_100016598 255
334 3300026088 Ga0207641_10011195 Ga0207641_100111958 255
335 3300026095 Ga0207676_10000744 Ga0207676_100007443 255
336 3300026142 Ga0207698_10367715 Ga0207698_103677151 255
337 3300028379 Ga0268266_10014856 Ga0268266_100148562 255
338 3300028380 Ga0268265_10005595 Ga0268265_100055954 255
339 3300028381 Ga0268264_10000059 Ga0268264_1000005999 255
340 3300028381 Ga0268264_10286504 Ga0268264_102865041 255
341 3300031251 Ga0265327_10123206 Ga0265327_101232061 255
342 3300031456 Ga0307513_10003287 Ga0307513_1000328724 255
343 3300035113 Ga0373936_0011279 Ga0373936_0011279_2427_3194 255
344 3300039438 Ga0436360_0503204 Ga0436360_0503204_59_826 255
345 3300046616 Ga0495668_0085178 Ga0495668_0085178_353_1126 255
346 3300048908 Ga0496105_0301157 Ga0496105_0301157_327_1094 255
347 3300048929 Ga0496126_0001922 Ga0496126_0001922_22886_23659 255
348 3300049582 Ga0501048_0239040 Ga0501048_0239040_229_996 255
349 3300053730 Ga0500645_002058 Ga0500645_002058_2988_3755 255
350 3300003794 Ga0055531_10003562 Ga0055531_100035623 256
351 3300025297 Ga0209758_1002676 Ga0209758_100267615 256
352 3300025298 Ga0209050_1000431 Ga0209050_100043159 256
353 3300025304 Ga0209257_1001182 Ga0209257_100118215 256
354 3300028379 Ga0268266_10125697 Ga0268266_101256972 256
355 3300037471 Ga0395905_0000983 Ga0395905_0000983_12438_13211 256
356 3300049686 Ga0501257_016545 Ga0501257_016545_666_1436 256
357 3300053096 Ga0500641_0000388 Ga0500641_0000388_3250_4029 256
358 3300053730 Ga0500645_020526 Ga0500645_020526_488_1270 256
359 3300028563 Ga0265319_1070912 Ga0265319_10709122 260
360 3300003794 Ga0055531_10008569 Ga0055531_100085692 261
361 3300025292 Ga0209676_1000061 Ga0209676_1000061202 261
362 3300025304 Ga0209257_1000199 Ga0209257_1000199115 261
363 3300053108 Ga0500562_000418 Ga0500562_000418_9190_9975 261
364 3300046616 Ga0495668_0076512 Ga0495668_0076512_515_1366 272
365 3300003794 Ga0055531_10005109 Ga0055531_100051093 273
366 3300025304 Ga0209257_1001049 Ga0209257_10010493 273
367 3300025932 Ga0207690_10008700 Ga0207690_100087007 273
368 3300042438 Ga0439459_0010785 Ga0439459_0010785_177_1028 273
369 iso_pu_bacteria 2582581279 2585149171 273
370 iso_pu_bacteria 2585428106 2587919704 273
371 iso_pu_bacteria 2884960567 2884963941 273
372 iso_pu_bacteria 2857504554 2857506673 274
373 3300046616 Ga0495668_0110935 Ga0495668_0110935_428_1291 276
374 iso_pu_bacteria 2843744320 2843747207 276
375 iso_pu_bacteria 2849573788 2849574265 276
376 iso_pu_bacteria 2898329390 2898330953 276
377 3300013100 Ga0157373_10006647 Ga0157373_100066478 277
378 3300025292 Ga0209676_1000200 Ga0209676_100020044 277
379 3300025298 Ga0209050_1000057 Ga0209050_1000057161 277
380 3300025303 Ga0209051_1000836 Ga0209051_100083612 277
381 3300046460 Ga0495638_0001418 Ga0495638_0001418_6876_7715 277
382 3300046512 Ga0495610_0001496 Ga0495610_0001496_12918_13757 277
383 3300046518 Ga0495631_0002719 Ga0495631_0002719_498_1337 277
384 3300046520 Ga0495637_0015178 Ga0495637_0015178_2378_3217 277
385 3300046524 Ga0495648_0000724 Ga0495648_0000724_22836_23675 277
386 3300046616 Ga0495668_0000014 Ga0495668_0000014_309361_310200 277
387 3300046616 Ga0495668_0003909 Ga0495668_0003909_1304_2143 277
388 3300047469 Ga0495673_0000296 Ga0495673_0000296_41_883 277
389 3300047472 Ga0495686_0001837 Ga0495686_0001837_14084_14923 277
390 3300050516 nmdc:mga0sz30_15618_c1 nmdc:mga0sz30_15618_c1_1678_2517 277
391 3300053086 Ga0500578_0000035 Ga0500578_0000035_13961_14800 277
392 3300053087 Ga0500643_013486 Ga0500643_013486_287_1129 277
393 3300053088 Ga0500644_0000508 Ga0500644_0000508_12100_12942 277
394 3300053108 Ga0500562_001174 Ga0500562_001174_341_1180 277
395 3300053118 Ga0500594_0000176 Ga0500594_0000176_2285_3124 277
396 3300053122 Ga0500608_000093 Ga0500608_000093_6036_6875 277
397 3300053138 Ga0500564_004773 Ga0500564_004773_3134_3973 277
398 3300053156 Ga0500622_0000180 Ga0500622_0000180_51658_52497 277
399 3300053156 Ga0500622_0011345 Ga0500622_0011345_1078_1941 277
400 3300053096 Ga0500641_0002268 Ga0500641_0002268_4146_5009 278
401 3300053136 Ga0500559_0007831 Ga0500559_0007831_1391_2233 278
402 3300053730 Ga0500645_000433 Ga0500645_000433_15599_16462 278
403 3300053098 Ga0500650_0046477 Ga0500650_0046477_776_1636 279
404 3300053108 Ga0500562_000185 Ga0500562_000185_11467_12327 279
405 3300053730 Ga0500645_000457 Ga0500645_000457_22451_23311 279
406 iso_pu_bacteria 2510917020 2511124622 279
407 iso_pu_bacteria 2582581280 2585154709 279
408 iso_pu_bacteria 2582581293 2585198225 279
409 iso_pu_bacteria 2643221545 2643750711 279
410 iso_pu_bacteria 2643221552 2643782012 279
411 iso_pu_bacteria 2643221583 2643926166 279
412 iso_pu_bacteria 2643221584 2643927902 279
413 iso_pu_bacteria 2643221691 2644509785 279
414 iso_pu_bacteria 2818991435 2819537932 279
415 iso_pu_bacteria 2818991454 2819648715 279
416 3300046474 Ga0495605_0142625 Ga0495605_0142625_176_1024 282
417 3300046528 Ga0495642_0047390 Ga0495642_0047390_669_1562 282
418 3300003773 Ga0055537_1002613 Ga0055537_10026134 283
419 3300003790 Ga0055528_1006429 Ga0055528_10064294 283
420 3300005262 Ga0065165_1004073 Ga0065165_100407311 283
421 3300025263 Ga0209565_1000354 Ga0209565_100035440 283
422 3300025273 Ga0209673_1000961 Ga0209673_10009613 283
423 3300025291 Ga0209675_1010151 Ga0209675_10101512 283
424 3300025295 Ga0209564_1000667 Ga0209564_100066723 283
425 3300025297 Ga0209758_1002962 Ga0209758_10029623 283
426 3300025299 Ga0209256_1000707 Ga0209256_10007073 283
427 3300028794 Ga0307515_10081295 Ga0307515_100812954 283
428 3300042004 Ga0439445_0054865 Ga0439445_0054865_77_934 283
429 3300046453 Ga0495627_000679 Ga0495627_000679_19364_20218 283
430 3300046460 Ga0495638_0000462 Ga0495638_0000462_2381_3232 283
431 3300046460 Ga0495638_0001280 Ga0495638_0001280_14645_15496 283
432 3300046460 Ga0495638_0004552 Ga0495638_0004552_425_1282 283
433 3300046471 Ga0495650_0000020 Ga0495650_0000020_103448_104299 283
434 3300046506 Ga0495583_0000069 Ga0495583_0000069_82605_83456 283
435 3300046507 Ga0495606_0001454 Ga0495606_0001454_14255_15106 283
436 3300046512 Ga0495610_0000731 Ga0495610_0000731_13433_14284 283
437 3300046513 Ga0495616_0000112 Ga0495616_0000112_22595_23446 283
438 3300046520 Ga0495637_0006460 Ga0495637_0006460_497_1348 283
439 3300046520 Ga0495637_0018684 Ga0495637_0018684_63_917 283
440 3300046530 Ga0495654_0000018 Ga0495654_0000018_2377_3228 283
441 3300046616 Ga0495668_0064959 Ga0495668_0064959_643_1494 283
442 3300046660 Ga0495625_0000271 Ga0495625_0000271_35675_36526 283
443 3300046660 Ga0495625_0114117 Ga0495625_0114117_705_1556 283
444 3300046691 Ga0495670_0029256 Ga0495670_0029256_659_1510 283
445 3300046794 Ga0495589_0006610 Ga0495589_0006610_941_1798 283
446 3300047446 Ga0495679_041712 Ga0495679_041712_257_1108 283
447 3300047469 Ga0495673_0000094 Ga0495673_0000094_30707_31561 283
448 3300047472 Ga0495686_0028790 Ga0495686_0028790_661_1512 283
449 3300048909 Ga0496106_0046083 Ga0496106_0046083_1590_2441 283
450 3300048910 Ga0496107_0000037 Ga0496107_0000037_57446_58297 283
451 3300048918 Ga0496115_0027080 Ga0496115_0027080_1127_1978 283
452 3300048924 Ga0496121_0001466 Ga0496121_0001466_38229_39080 283
453 3300053086 Ga0500578_0171824 Ga0500578_0171824_428_1279 283
454 3300053087 Ga0500643_014449 Ga0500643_014449_754_1605 283
455 3300053088 Ga0500644_0032355 Ga0500644_0032355_226_1077 283
456 3300053102 Ga0500554_052120 Ga0500554_052120_429_1280 283
457 3300053104 Ga0500556_0000111 Ga0500556_0000111_28229_29080 283
458 3300053123 Ga0500614_013724 Ga0500614_013724_25_876 283
459 3300053125 Ga0500618_000209 Ga0500618_000209_2063_2914 283
460 3300053134 Ga0500658_0002416 Ga0500658_0002416_4018_4869 283
461 3300053136 Ga0500559_0000101 Ga0500559_0000101_64177_65028 283
462 3300053136 Ga0500559_0120974 Ga0500559_0120974_280_1131 283
463 3300053142 Ga0500577_0042015 Ga0500577_0042015_473_1327 283
464 3300053153 Ga0500616_0019140 Ga0500616_0019140_2124_2975 283
465 3300053158 Ga0500627_0070624 Ga0500627_0070624_239_1090 283
466 3300053731 Ga0500609_008612 Ga0500609_008612_187_1038 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04376

ATE_N

Arginine-tRNA-protein transferase, N terminus

17

87

0.98

PF04377

ATE_C

Arginine-tRNA-protein transferase, C terminus

107

235

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wg2-assembly1.cif.gz_A evaa-klate1 0.8512 27 234
7wg1-assembly1.cif.gz_A dvaa-klate1 0.8506 27 234
7wg4-assembly1.cif.gz_A dvaa-klate1 0.8482 27 234
7wg1-assembly2.cif.gz_B dvaa-klate1 0.8397 27 234
7wfx-assembly2.cif.gz_B evaa-klate1 0.8359 22 241
ID Description Score Start End Superfamily
af_P90914_254_388_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7871 109 230 3.40.630.30
af_O14133_140_264_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7853 110 230 3.40.50.1820
af_Q9C776_322_467_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.774 109 230 3.40.630.30
af_Q09518_10_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7571 156 213 3.40.630.30
af_A0A1D8PG12_149_290_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7569 110 228 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A653RRE2-F1-model_v4 Aspartate/glutamate leucyltransferase (EC 2.3.2.29) 0.9934 15 244 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A3G9G8I3-F1-model_v4 Arginine-tRNA-protein transferase (EC 2.3.2.8) 0.9822 32 242 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A653RRE2-F1-model_v4 Aspartate/glutamate leucyltransferase (EC 2.3.2.29) 0.9807 15 244 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A7W7F826-F1-model_v4 Aspartate/glutamate leucyltransferase (EC 2.3.2.29) 0.9766 28 243 GO:0004057
GO:0005737
GO:0008914
GO:0071596
AF-A0A4Q3YJK2-F1-model_v4 Arginyltransferase (EC 2.3.2.8) 0.9756 28 243 GO:0004057
GO:0005737
GO:0008914
GO:0071596

Feature Viewer

pLDDT pTM Quality
83.34 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map