F449624

General Info

Members Datasets Scaffolds Average Seq Length
466 232 932 289

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100113257|Ga0070707_1001132572
Length 340
Sequence MLGINPFMVLSPVRDDRLFFFRPCRDCTLDRLRYPALKRWAIVFVSLPFARTMPNDPVKLIECPRDAWQGLKRQIPTEVKIGYLRALIDAGFKHIDAVSFVSPKAVPQMADSEKVLEQLDPPVDVEIIGIVVNEKGAERAIATKRVATLGYPYSISNTFLRKNQNQSPEENYQVLEAIKERARDAQLDTVVYISMAFGNPYGDPWDEDEVKKAVEAIAHLDIRSISLADTVGVAAPELISRVVSAVTSDYGDREIGVHMHSTRSDAAATVLAAYDAGCRRFDSAIGGLGGCPFAQGMLVGNIPTEAVVEALQQRGVDMPTRKSMERVMAMNTEISSRFSL

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
102 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.73
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 12.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100113257 3300005468 Bacteria 2632
2 SwRhRL3b_contig_111260 2162886006 Bacteria 1575
3 SwRhRL2b_contig_951603 2162886007 Unclassified 1805
4 CNXas_1000060 3300000545 Bacteria 21130
5 JGI25406J46586_10000243 3300003203 Bacteria 24409
6 JGI25404J52841_10005765 3300003659 Unclassified 2565
7 Ga0065715_10010162 3300005293 Bacteria 2244
8 Ga0065715_10095473 3300005293 Unclassified 4075
9 Ga0065715_10150833 3300005293 Bacteria 1730
10 Ga0065707_10006399 3300005295 Bacteria 4391
11 Ga0065707_10015798 3300005295 Bacteria 1461
12 Ga0065707_10017893 3300005295 Unclassified 2051
13 Ga0065707_10123883 3300005295 Bacteria 2055
14 Ga0070676_10009643 3300005328 Bacteria 5219
15 Ga0070676_10026453 3300005328 Bacteria 3285
16 Ga0070676_10175159 3300005328 Bacteria 1391
17 Ga0070683_100022211 3300005329 Bacteria 5668
18 Ga0070683_100022644 3300005329 Bacteria 5618
19 Ga0070683_100431365 3300005329 Bacteria 1257
20 Ga0070690_100018817 3300005330 Bacteria 4180
21 Ga0070690_100040720 3300005330 Bacteria 2939
22 Ga0070690_100108314 3300005330 Bacteria 1851
23 Ga0070677_10067491 3300005333 Bacteria 1494
24 Ga0070666_10033562 3300005335 Bacteria 3396
25 Ga0070666_10063219 3300005335 Bacteria 2508
26 Ga0070666_10188701 3300005335 Bacteria 1448
27 Ga0070680_100231671 3300005336 Bacteria 1560
28 Ga0070682_100010473 3300005337 Bacteria 5263
29 Ga0070682_100049491 3300005337 Bacteria 2620
30 Ga0070682_100080208 3300005337 Bacteria 2109
31 Ga0068868_100026491 3300005338 Bacteria 4419
32 Ga0068868_100050559 3300005338 Bacteria 3265
33 Ga0068868_100210533 3300005338 Bacteria 1624
34 Ga0070660_100026704 3300005339 Bacteria 4302
35 Ga0070660_100050683 3300005339 Bacteria 3195
36 Ga0070660_100289755 3300005339 Bacteria 1341
37 Ga0070689_100003800 3300005340 Bacteria 10120
38 Ga0070661_100010336 3300005344 Bacteria 6488
39 Ga0070668_100016719 3300005347 Bacteria 5483
40 Ga0070669_100003434 3300005353 Bacteria 11413
41 Ga0070669_100017822 3300005353 Bacteria 5069
42 Ga0070675_100028115 3300005354 Bacteria 4524
43 Ga0070675_100052521 3300005354 Bacteria 3351
44 Ga0070675_100115735 3300005354 Bacteria 2273
45 Ga0070671_100041539 3300005355 Bacteria 3822
46 Ga0070671_100048196 3300005355 Bacteria 3543
47 Ga0070674_100002348 3300005356 Bacteria 10435
48 Ga0070673_100127941 3300005364 Unclassified 2127
49 Ga0070673_100144970 3300005364 Unclassified 2007
50 Ga0070673_100217419 3300005364 Bacteria 1652
51 Ga0070688_100003068 3300005365 Bacteria 8530
52 Ga0070688_100028540 3300005365 Bacteria 3332
53 Ga0070659_100039333 3300005366 Bacteria 3692
54 Ga0070659_100397702 3300005366 Bacteria 1163
55 Ga0070667_100063778 3300005367 Bacteria 3124
56 Ga0070667_100183948 3300005367 Bacteria 1849
57 Ga0070667_100321216 3300005367 Bacteria 1397
58 Ga0070703_10039086 3300005406 Bacteria 1469
59 Ga0070709_10013669 3300005434 Bacteria 4570
60 Ga0070709_10058501 3300005434 Bacteria 2444
61 Ga0070709_10157381 3300005434 Bacteria 1576
62 Ga0070714_100041910 3300005435 Bacteria 3865
63 Ga0070714_100069685 3300005435 Bacteria 3038
64 Ga0070714_100183171 3300005435 Bacteria 1907
65 Ga0070713_100160732 3300005436 Bacteria 2005
66 Ga0070713_100184149 3300005436 Bacteria 1878
67 Ga0070713_100279662 3300005436 Unclassified 1531
68 Ga0070710_10031828 3300005437 Bacteria 2851
69 Ga0070710_10048642 3300005437 Unclassified 2369
70 Ga0070711_100095040 3300005439 Unclassified 2156
71 Ga0070708_100015913 3300005445 Bacteria 6224
72 Ga0070708_100098720 3300005445 Unclassified 2671
73 Ga0070708_100255563 3300005445 Bacteria 1646
74 Ga0070708_100281947 3300005445 Bacteria 1564
75 Ga0070663_100042296 3300005455 Bacteria 3201
76 Ga0070663_100055607 3300005455 Bacteria 2833
77 Ga0070678_100064948 3300005456 Bacteria 2707
78 Ga0070678_100162281 3300005456 Bacteria 1812
79 Ga0070662_100026160 3300005457 Bacteria 4039
80 Ga0070662_100067421 3300005457 Bacteria 2628
81 Ga0070662_100155840 3300005457 Unclassified 1783
82 Ga0070662_100162242 3300005457 Bacteria 1749
83 Ga0070662_100406776 3300005457 Bacteria 1124
84 Ga0070681_10005188 3300005458 Bacteria 12572
85 Ga0070681_10019551 3300005458 Bacteria 6782
86 Ga0070685_10050184 3300005466 Bacteria 2410
87 Ga0070685_10113550 3300005466 Bacteria 1673
88 Ga0070706_100000060 3300005467 Bacteria 131097
89 Ga0070706_100020242 3300005467 Bacteria 6132
90 Ga0070706_100065291 3300005467 Bacteria 3365
91 Ga0070706_100103446 3300005467 Bacteria 2648
92 Ga0070706_100140022 3300005467 Unclassified 2258
93 Ga0070706_100172962 3300005467 Bacteria 2017
94 Ga0070706_100183444 3300005467 Unclassified 1954
95 Ga0070706_100314767 3300005467 Bacteria 1460
96 Ga0070706_100358955 3300005467 Bacteria 1358
97 Ga0070707_100000404 3300005468 Bacteria 42569
98 Ga0070707_100009712 3300005468 Bacteria 8943
99 Ga0070707_100049080 3300005468 Bacteria 4045
100 Ga0070707_100057229 3300005468 Bacteria 3740
101 Ga0070707_100214504 3300005468 Unclassified 1876
102 Ga0070707_100393159 3300005468 Unclassified 1346
103 Ga0070698_100092868 3300005471 Bacteria 2998
104 Ga0070698_100113468 3300005471 Bacteria 2675
105 Ga0070698_100211864 3300005471 Bacteria 1872
106 Ga0070699_100007182 3300005518 Bacteria 9685
107 Ga0070699_100007799 3300005518 Bacteria 9305
108 Ga0070679_100086987 3300005530 Bacteria 3112
109 Ga0070684_100028907 3300005535 Bacteria 4692
110 Ga0070684_100079528 3300005535 Bacteria 2898
111 Ga0070684_100092075 3300005535 Unclassified 2697
112 Ga0070697_100001547 3300005536 Bacteria 17512
113 Ga0070697_100009720 3300005536 Bacteria 7508
114 Ga0070697_100014093 3300005536 Bacteria 6278
115 Ga0070697_100022443 3300005536 Bacteria 5009
116 Ga0070697_100027056 3300005536 Bacteria 4586
117 Ga0070697_100078453 3300005536 Bacteria 2717
118 Ga0070697_100172911 3300005536 Bacteria 1829
119 Ga0068853_100245947 3300005539 Bacteria 1640
120 Ga0070672_100009990 3300005543 Bacteria 6568
121 Ga0070686_100146022 3300005544 Bacteria 1652
122 Ga0070665_100084845 3300005548 Bacteria 3172
123 Ga0070665_100098416 3300005548 Unclassified 2930
124 Ga0070665_100118757 3300005548 Bacteria 2646
125 Ga0070665_100363850 3300005548 Unclassified 1453
126 Ga0070704_100009970 3300005549 Bacteria 5768
127 Ga0068854_100057385 3300005578 Bacteria 2808
128 Ga0068856_100025481 3300005614 Bacteria 5768
129 Ga0068856_100289615 3300005614 Unclassified 1654
130 Ga0068859_100017494 3300005617 Bacteria 7206
131 Ga0068859_100155880 3300005617 Bacteria 2361
132 Ga0068864_100050744 3300005618 Bacteria 3572
133 Ga0068866_10007219 3300005718 Bacteria 4649
134 Ga0068866_10019867 3300005718 Bacteria 3067
135 Ga0068861_100204365 3300005719 Unclassified 1660
136 Ga0068851_10025116 3300005834 Bacteria 2921
137 Ga0068863_100431915 3300005841 Unclassified 1291
138 Ga0068858_100030626 3300005842 Bacteria 4996
139 Ga0068858_100149905 3300005842 Bacteria 2192
140 Ga0068858_100450049 3300005842 Bacteria 1241
141 Ga0068860_100072708 3300005843 Bacteria 3269
142 Ga0068862_100072365 3300005844 Bacteria 2978
143 Ga0081455_10006858 3300005937 Bacteria 12133
144 Ga0081455_10068779 3300005937 Bacteria 2946
145 Ga0081455_10158397 3300005937 Bacteria 1738
146 Ga0081540_1000010 3300005983 Bacteria 193206
147 Ga0081540_1112071 3300005983 Bacteria 1150
148 Ga0081539_10000153 3300005985 Bacteria 159919
149 Ga0081539_10009945 3300005985 Bacteria 7841
150 Ga0081539_10014922 3300005985 Bacteria 5701
151 Ga0081539_10025684 3300005985 Bacteria 3783
152 Ga0070717_10014664 3300006028 Bacteria 6031
153 Ga0070717_10032935 3300006028 Bacteria 4178
154 Ga0070717_10036789 3300006028 Bacteria 3972
155 Ga0070717_10049572 3300006028 Bacteria 3447
156 Ga0070717_10051409 3300006028 Bacteria 3391
157 Ga0070717_10073311 3300006028 Bacteria 2861
158 Ga0070717_10265104 3300006028 Bacteria 1520
159 Ga0070715_10011584 3300006163 Bacteria 3180
160 Ga0070715_10024118 3300006163 Bacteria 2392
161 Ga0070716_100016545 3300006173 Bacteria 3809
162 Ga0070716_100017380 3300006173 Bacteria 3728
163 Ga0070712_100000987 3300006175 Bacteria 17088
164 Ga0070712_100076182 3300006175 Bacteria 2415
165 Ga0070712_100082315 3300006175 Bacteria 2334
166 Ga0070712_100135085 3300006175 Unclassified 1874
167 Ga0097621_100066923 3300006237 Unclassified 2960
168 Ga0068871_100061315 3300006358 Bacteria 3071
169 Ga0068871_100190212 3300006358 Bacteria 1768
170 Ga0075434_100731071 3300006871 Bacteria 1007
171 Ga0075436_100039951 3300006914 Unclassified 3237
172 Ga0075436_100109755 3300006914 Unclassified 1925
173 Ga0097620_100017494 3300006931 Bacteria 7206
174 Ga0097620_100155886 3300006931 Bacteria 2361
175 Ga0099795_10007996 3300007788 Unclassified 2988
176 Ga0105240_10006436 3300009093 Bacteria 17263
177 Ga0105240_10007559 3300009093 Bacteria 15749
178 Ga0105245_10115739 3300009098 Bacteria 2499
179 Ga0105245_10129298 3300009098 Bacteria 2367
180 Ga0105245_10392369 3300009098 Bacteria 1385
181 Ga0105245_10449171 3300009098 Bacteria 1297
182 Ga0105247_10056734 3300009101 Bacteria 2420
183 Ga0105247_10165252 3300009101 Bacteria 1468
184 Ga0114129_10009121 3300009147 Bacteria 14139
185 Ga0114129_10276352 3300009147 Unclassified 2245
186 Ga0105243_10023617 3300009148 Bacteria 4684
187 Ga0105241_10021607 3300009174 Bacteria 4759
188 Ga0105241_10021731 3300009174 Bacteria 4746
189 Ga0105248_10076182 3300009177 Bacteria 3770
190 Ga0105248_10145585 3300009177 Bacteria 2673
191 Ga0105248_10262323 3300009177 Bacteria 1945
192 Ga0105248_10360900 3300009177 Unclassified 1636
193 Ga0105237_10083629 3300009545 Unclassified 3183
194 Ga0105237_10173775 3300009545 Bacteria 2154
195 Ga0105238_10043595 3300009551 Bacteria 4539
196 Ga0105238_10091802 3300009551 Bacteria 3024
197 Ga0105249_10022406 3300009553 Bacteria 5658
198 Ga0105249_10049159 3300009553 Bacteria 3846
199 Ga0105239_10314668 3300010375 Bacteria 1765
200 Ga0105239_10842028 3300010375 Bacteria 1052
201 Ga0157373_10290505 3300013100 Bacteria 1159
202 Ga0157371_10113926 3300013102 Bacteria 1920
203 Ga0157369_10008528 3300013105 Bacteria 11755
204 Ga0157369_10030101 3300013105 Bacteria 5990
205 Ga0157369_10276728 3300013105 Bacteria 1748
206 Ga0157369_10573033 3300013105 Bacteria 1166
207 Ga0157369_10627365 3300013105 Bacteria 1109
208 Ga0157374_10000649 3300013296 Bacteria 30659
209 Ga0157374_10002997 3300013296 Bacteria 14129
210 Ga0157374_10028709 3300013296 Bacteria 5028
211 Ga0157374_10279377 3300013296 Bacteria 1648
212 Ga0157378_10115677 3300013297 Bacteria 2465
213 Ga0157378_10141490 3300013297 Bacteria 2234
214 Ga0157378_10203339 3300013297 Bacteria 1874
215 Ga0157378_10232750 3300013297 Unclassified 1756
216 Ga0157378_10324850 3300013297 Unclassified 1496
217 Ga0163162_10003507 3300013306 Bacteria 15002
218 Ga0163162_10010968 3300013306 Bacteria 8826
219 Ga0163162_10033565 3300013306 Bacteria 5101
220 Ga0157372_10052573 3300013307 Bacteria 4537
221 Ga0157372_10412458 3300013307 Bacteria 1574
222 Ga0157375_10006798 3300013308 Bacteria 9959
223 Ga0157375_10020882 3300013308 Bacteria 5994
224 Ga0157375_10042583 3300013308 Bacteria 4396
225 Ga0163163_10092527 3300014325 Bacteria 3039
226 Ga0163163_10127643 3300014325 Bacteria 2582
227 Ga0182008_10009320 3300014497 Bacteria 5305
228 Ga0157377_10024082 3300014745 Bacteria 3233
229 Ga0157379_10037750 3300014968 Bacteria 4308
230 Ga0157376_10023940 3300014969 Bacteria 4789
231 Ga0157376_10248333 3300014969 Bacteria 1661
232 Ga0163161_10017584 3300017792 Bacteria 5006
233 Ga0224570_100596 3300022730 Bacteria 2872
234 Ga0228598_1000817 3300024227 Bacteria 6711
235 Ga0207666_1000254 3300025271 Bacteria 7863
236 Ga0207697_10000229 3300025315 Bacteria 30325
237 Ga0207697_10003825 3300025315 Bacteria 7348
238 Ga0207697_10004033 3300025315 Bacteria 7116
239 Ga0207697_10008272 3300025315 Bacteria 4567
240 Ga0207697_10022817 3300025315 Unclassified 2563
241 Ga0207697_10025423 3300025315 Unclassified 2420
242 Ga0207656_10024376 3300025321 Bacteria 2446
243 Ga0207692_10012802 3300025898 Bacteria 3615
244 Ga0207642_10006147 3300025899 Bacteria 3975
245 Ga0207642_10068352 3300025899 Bacteria 1681
246 Ga0207688_10117254 3300025901 Bacteria 1551
247 Ga0207680_10252935 3300025903 Bacteria 1217
248 Ga0207647_10063872 3300025904 Bacteria 2238
249 Ga0207699_10018437 3300025906 Bacteria 3699
250 Ga0207645_10001529 3300025907 Bacteria 18897
251 Ga0207645_10020126 3300025907 Bacteria 4369
252 Ga0207645_10032222 3300025907 Bacteria 3369
253 Ga0207684_10000118 3300025910 Bacteria 145120
254 Ga0207684_10020496 3300025910 Bacteria 5650
255 Ga0207684_10020578 3300025910 Bacteria 5638
256 Ga0207684_10038419 3300025910 Bacteria 4062
257 Ga0207684_10099998 3300025910 Bacteria 2478
258 Ga0207684_10236214 3300025910 Bacteria 1577
259 Ga0207654_10008632 3300025911 Bacteria 5164
260 Ga0207654_10023615 3300025911 Bacteria 3296
261 Ga0207707_10032791 3300025912 Bacteria 4546
262 Ga0207695_10004843 3300025913 Bacteria 18170
263 Ga0207695_10029399 3300025913 Bacteria 6074
264 Ga0207671_10440573 3300025914 Bacteria 1037
265 Ga0207693_10007933 3300025915 Bacteria 8721
266 Ga0207693_10027206 3300025915 Bacteria 4522
267 Ga0207693_10050482 3300025915 Bacteria 3267
268 Ga0207693_10051436 3300025915 Bacteria 3233
269 Ga0207693_10080135 3300025915 Bacteria 2556
270 Ga0207663_10024158 3300025916 Bacteria 3498
271 Ga0207663_10104685 3300025916 Bacteria 1908
272 Ga0207663_10266553 3300025916 Unclassified 1267
273 Ga0207657_10008758 3300025919 Bacteria 10242
274 Ga0207657_10034254 3300025919 Bacteria 4569
275 Ga0207657_10202277 3300025919 Bacteria 1597
276 Ga0207649_10051774 3300025920 Bacteria 2544
277 Ga0207649_10125265 3300025920 Bacteria 1738
278 Ga0207649_10252630 3300025920 Bacteria 1270
279 Ga0207646_10001329 3300025922 Bacteria 30714
280 Ga0207646_10004180 3300025922 Bacteria 15816
281 Ga0207646_10013327 3300025922 Bacteria 7866
282 Ga0207646_10025212 3300025922 Bacteria 5442
283 Ga0207646_10032078 3300025922 Bacteria 4754
284 Ga0207646_10227340 3300025922 Bacteria 1686
285 Ga0207646_10234333 3300025922 Bacteria 1658
286 Ga0207681_10006833 3300025923 Bacteria 6999
287 Ga0207681_10134368 3300025923 Bacteria 1833
288 Ga0207694_10036956 3300025924 Bacteria 3748
289 Ga0207694_10041871 3300025924 Bacteria 3531
290 Ga0207659_10037265 3300025926 Bacteria 3375
291 Ga0207659_10069723 3300025926 Bacteria 2562
292 Ga0207659_10225358 3300025926 Bacteria 1509
293 Ga0207687_10003342 3300025927 Bacteria 10839
294 Ga0207687_10131498 3300025927 Bacteria 1887
295 Ga0207687_10292687 3300025927 Bacteria 1309
296 Ga0207700_10034541 3300025928 Bacteria 3631
297 Ga0207700_10355675 3300025928 Unclassified 1276
298 Ga0207700_10450488 3300025928 Unclassified 1134
299 Ga0207664_10094419 3300025929 Unclassified 2458
300 Ga0207664_10145932 3300025929 Bacteria 2006
301 Ga0207644_10098335 3300025931 Bacteria 2193
302 Ga0207644_10167054 3300025931 Unclassified 1715
303 Ga0207690_10270657 3300025932 Bacteria 1319
304 Ga0207706_10001302 3300025933 Bacteria 25124
305 Ga0207706_10146106 3300025933 Bacteria 2080
306 Ga0207706_10198012 3300025933 Bacteria 1762
307 Ga0207686_10248893 3300025934 Bacteria 1297
308 Ga0207670_10033173 3300025936 Bacteria 3325
309 Ga0207670_10074419 3300025936 Bacteria 2358
310 Ga0207670_10118016 3300025936 Bacteria 1923
311 Ga0207669_10017444 3300025937 Bacteria 3682
312 Ga0207665_10005033 3300025939 Bacteria 8822
313 Ga0207665_10006429 3300025939 Bacteria 7795
314 Ga0207665_10010859 3300025939 Bacteria 5979
315 Ga0207691_10002581 3300025940 Bacteria 17703
316 Ga0207711_10003254 3300025941 Bacteria 14153
317 Ga0207689_10015489 3300025942 Bacteria 6457
318 Ga0207661_10458727 3300025944 Bacteria 1161
319 Ga0207679_10035375 3300025945 Bacteria 3533
320 Ga0207679_10332549 3300025945 Bacteria 1319
321 Ga0207667_10002559 3300025949 Bacteria 22617
322 Ga0207651_10025501 3300025960 Bacteria 3675
323 Ga0207651_10415660 3300025960 Bacteria 1147
324 Ga0207651_10432085 3300025960 Bacteria 1126
325 Ga0207712_10025121 3300025961 Bacteria 3955
326 Ga0207712_10179271 3300025961 Bacteria 1663
327 Ga0207712_10203679 3300025961 Bacteria 1571
328 Ga0207668_10070082 3300025972 Bacteria 2499
329 Ga0207640_10041651 3300025981 Bacteria 2922
330 Ga0207658_10038813 3300025986 Bacteria 3433
331 Ga0207658_10158428 3300025986 Bacteria 1853
332 Ga0207658_10159937 3300025986 Unclassified 1845
333 Ga0207658_10194206 3300025986 Bacteria 1690
334 Ga0207677_10372698 3300026023 Bacteria 1202
335 Ga0207703_10138451 3300026035 Bacteria 2110
336 Ga0207678_10021841 3300026067 Bacteria 5613
337 Ga0207678_10023132 3300026067 Bacteria 5437
338 Ga0207678_10106624 3300026067 Bacteria 2390
339 Ga0207702_10118477 3300026078 Bacteria 2366
340 Ga0207702_10164922 3300026078 Bacteria 2026
341 Ga0207702_10169169 3300026078 Bacteria 2002
342 Ga0207641_10030801 3300026088 Bacteria 4446
343 Ga0207641_10077679 3300026088 Bacteria 2874
344 Ga0207648_10034229 3300026089 Bacteria 4479
345 Ga0207675_100048098 3300026118 Bacteria 3981
346 Ga0207675_100259809 3300026118 Bacteria 1683
347 Ga0207683_10031417 3300026121 Bacteria 4608
348 Ga0207683_10033703 3300026121 Bacteria 4449
349 Ga0207683_10134645 3300026121 Bacteria 2224
350 Ga0265356_1005574 3300028017 Bacteria 1498
351 Ga0268266_10021034 3300028379 Bacteria 5561
352 Ga0268266_10130468 3300028379 Bacteria 2247
353 Ga0268266_10170548 3300028379 Bacteria 1975
354 Ga0268266_10456524 3300028379 Bacteria 1215
355 Ga0268265_10053751 3300028380 Bacteria 3052
356 Ga0268264_10048878 3300028381 Bacteria 3518
357 Ga0268264_10117598 3300028381 Bacteria 2338
358 Ga0265338_10025836 3300028800 Bacteria 5943
359 Ga0265338_10042147 3300028800 Bacteria 4257
360 Ga0265338_10055033 3300028800 Bacteria 3543
361 Ga0265760_10000007 3300031090 Bacteria 117681
362 Ga0265760_10004773 3300031090 Bacteria 3884
363 Ga0265325_10012960 3300031241 Bacteria 4755
364 Ga0265331_10124207 3300031250 Bacteria 1179
365 Ga0373932_0034151 3300035112 Bacteria 1432
366 Ga0373936_0070389 3300035113 Bacteria 1441
367 Ga0373943_0038437 3300035170 Bacteria 2301
368 Ga0373955_0208868 3300035172 Unclassified 1164
369 Ga0373927_0039058 3300035695 Unclassified 3081
370 Ga0373947_0055213 3300035725 Bacteria 2398
371 Ga0373937_0244329 3300036401 Unclassified 1692
372 Ga0373925_0031927 3300037068 Bacteria 3874
373 Ga0395898_0011104 3300037466 Bacteria 9377
374 Ga0395905_0006788 3300037471 Bacteria 11472
375 Ga0395905_0050062 3300037471 Bacteria 3915
376 Ga0395905_0150571 3300037471 Bacteria 2189
377 Ga0395901_0003456 3300038443 Bacteria 15923
378 Ga0395901_0236402 3300038443 Unclassified 1907
379 Ga0395901_0318023 3300038443 Bacteria 1611
380 Ga0436363_0878464 3300039450 Bacteria 5870
381 Ga0439455_0021405 3300042012 Bacteria 1541
382 Ga0451577_0003666 3300042876 Bacteria 16827
383 Ga0453683_0052335 3300044673 Bacteria 2556
384 Ga0453684_0000480 3300044712 Bacteria 158630
385 Ga0466959_0010391 3300045049 Bacteria 6652
386 Ga0451576_0105904 3300045051 Bacteria 2926
387 Ga0466967_0135491 3300045976 Bacteria 2290
388 Ga0495592_0015199 3300046454 Bacteria 5846
389 Ga0495592_0133083 3300046454 Bacteria 1737
390 Ga0495603_0124053 3300046455 Unclassified 1505
391 Ga0495651_0228866 3300046462 Unclassified 1282
392 Ga0495580_0005906 3300046472 Bacteria 10040
393 Ga0495582_0034040 3300046473 Bacteria 2801
394 Ga0495582_0042929 3300046473 Unclassified 2490
395 Ga0495584_0136006 3300046491 Viruses 1248
396 Ga0495594_0045825 3300046499 Bacteria 2401
397 Ga0495607_0146367 3300046501 Bacteria 1214
398 Ga0495630_0091005 3300046517 Bacteria 2305
399 Ga0495642_0031579 3300046528 Bacteria 2124
400 Ga0495652_0087495 3300046529 Unclassified 2555
401 Ga0495652_0115809 3300046529 Unclassified 2147
402 Ga0495640_0174458 3300046533 Unclassified 1373
403 Ga0495586_0263170 3300046535 Bacteria 985
404 Ga0495598_0009744 3300046537 Bacteria 2281
405 Ga0495645_0005554 3300046543 Bacteria 8670
406 Ga0495668_0071769 3300046616 Bacteria 1903
407 Ga0495634_0078602 3300046642 Unclassified 2161
408 Ga0495635_0108361 3300046663 Bacteria 1898
409 Ga0495599_0010342 3300046678 Bacteria 5705
410 Ga0495623_0040018 3300046679 Bacteria 2994
411 Ga0495669_0024879 3300046684 Bacteria 2609
412 Ga0495669_0115014 3300046684 Bacteria 1258
413 Ga0495669_0126969 3300046684 Bacteria 1199
414 Ga0495613_0007327 3300046689 Bacteria 8215
415 Ga0495624_0124187 3300046690 Bacteria 1585
416 Ga0495604_0093811 3300047317 Unclassified 2220
417 Ga0495604_0110628 3300047317 Bacteria 2004
418 Ga0495674_0390531 3300047319 Bacteria 1125
419 Ga0495676_0069059 3300047321 Bacteria 2728
420 Ga0495680_0141526 3300047322 Bacteria 1760
421 Ga0495675_0045822 3300047444 Unclassified 2785
422 Ga0495677_0035175 3300047445 Bacteria 1828
423 Ga0496100_0147453 3300048903 Bacteria 1675
424 Ga0496100_0302256 3300048903 Bacteria 1198
425 Ga0496101_0054464 3300048904 Bacteria 2888
426 Ga0496102_0001755 3300048905 Bacteria 18917
427 Ga0496102_0056678 3300048905 Bacteria 3575
428 Ga0496102_0080081 3300048905 Bacteria 3009
429 Ga0496102_0112126 3300048905 Bacteria 2543
430 Ga0496103_0012744 3300048906 Bacteria 4987
431 Ga0496103_0058970 3300048906 Bacteria 2385
432 Ga0496104_0046269 3300048907 Bacteria 4097
433 Ga0496104_0055462 3300048907 Bacteria 3747
434 Ga0496104_0442223 3300048907 Unclassified 1212
435 Ga0496105_0051451 3300048908 Bacteria 3404
436 Ga0496105_0121475 3300048908 Bacteria 2154
437 Ga0496106_0029700 3300048909 Bacteria 4075
438 Ga0496106_0055535 3300048909 Bacteria 2994
439 Ga0496106_0431404 3300048909 Bacteria 1059
440 Ga0496107_0001175 3300048910 Bacteria 15890
441 Ga0496107_0047653 3300048910 Bacteria 3086
442 Ga0496107_0186737 3300048910 Unclassified 1540
443 Ga0496108_0015744 3300048911 Bacteria 6166
444 Ga0496108_0136135 3300048911 Bacteria 2114
445 Ga0496109_0046787 3300048912 Bacteria 3930
446 Ga0496109_0062389 3300048912 Bacteria 3408
447 Ga0496109_0210852 3300048912 Bacteria 1827
448 Ga0496109_0299660 3300048912 Bacteria 1516
449 Ga0496110_0174468 3300048913 Bacteria 1951
450 Ga0496111_0331836 3300048914 Unclassified 1126
451 Ga0496112_0100433 3300048915 Bacteria 2863
452 Ga0496112_0130823 3300048915 Unclassified 2480
453 Ga0496112_0438545 3300048915 Bacteria 1244
454 Ga0496112_0551477 3300048915 Bacteria 1086
455 Ga0496113_0001826 3300048916 Bacteria 12112
456 Ga0496114_0282999 3300048917 Bacteria 1462
457 Ga0496115_0027663 3300048918 Unclassified 4437
458 Ga0496115_0050035 3300048918 Bacteria 3346
459 Ga0496126_0089646 3300048929 Bacteria 2707
460 nmdc:mga05p37_494769_c1 3300050507 Bacteria 1405
461 nmdc:mga05p37_6047_c1 3300050507 Bacteria 8020
462 nmdc:mga0rr50_357364_c1 3300050513 Unclassified 1229
463 nmdc:mga08x19_119389_c1 3300050514 Unclassified 1766
464 nmdc:mga08x19_92017_c1 3300050514 Bacteria 2002
465 Ga0495601_0003878 3300053077 Bacteria 8611
466 Ga0495655_0052954 3300053083 Bacteria 1081
467 Ga0070707_100113257
468 SwRhRL3b_contig_111260
469 SwRhRL2b_contig_951603
470 CNXas_1000060
471 JGI25406J46586_10000243
472 JGI25404J52841_10005765
473 Ga0065715_10010162
474 Ga0065715_10095473
475 Ga0065715_10150833
476 Ga0065707_10006399
477 Ga0065707_10015798
478 Ga0065707_10017893
479 Ga0065707_10123883
480 Ga0070676_10009643
481 Ga0070676_10026453
482 Ga0070676_10175159
483 Ga0070683_100022211
484 Ga0070683_100022644
485 Ga0070683_100431365
486 Ga0070690_100018817
487 Ga0070690_100040720
488 Ga0070690_100108314
489 Ga0070677_10067491
490 Ga0070666_10033562
491 Ga0070666_10063219
492 Ga0070666_10188701
493 Ga0070680_100231671
494 Ga0070682_100010473
495 Ga0070682_100049491
496 Ga0070682_100080208
497 Ga0068868_100026491
498 Ga0068868_100050559
499 Ga0068868_100210533
500 Ga0070660_100026704
501 Ga0070660_100050683
502 Ga0070660_100289755
503 Ga0070689_100003800
504 Ga0070661_100010336
505 Ga0070668_100016719
506 Ga0070669_100003434
507 Ga0070669_100017822
508 Ga0070675_100028115
509 Ga0070675_100052521
510 Ga0070675_100115735
511 Ga0070671_100041539
512 Ga0070671_100048196
513 Ga0070674_100002348
514 Ga0070673_100127941
515 Ga0070673_100144970
516 Ga0070673_100217419
517 Ga0070688_100003068
518 Ga0070688_100028540
519 Ga0070659_100039333
520 Ga0070659_100397702
521 Ga0070667_100063778
522 Ga0070667_100183948
523 Ga0070667_100321216
524 Ga0070703_10039086
525 Ga0070709_10013669
526 Ga0070709_10058501
527 Ga0070709_10157381
528 Ga0070714_100041910
529 Ga0070714_100069685
530 Ga0070714_100183171
531 Ga0070713_100160732
532 Ga0070713_100184149
533 Ga0070713_100279662
534 Ga0070710_10031828
535 Ga0070710_10048642
536 Ga0070711_100095040
537 Ga0070708_100015913
538 Ga0070708_100098720
539 Ga0070708_100255563
540 Ga0070708_100281947
541 Ga0070663_100042296
542 Ga0070663_100055607
543 Ga0070678_100064948
544 Ga0070678_100162281
545 Ga0070662_100026160
546 Ga0070662_100067421
547 Ga0070662_100155840
548 Ga0070662_100162242
549 Ga0070662_100406776
550 Ga0070681_10005188
551 Ga0070681_10019551
552 Ga0070685_10050184
553 Ga0070685_10113550
554 Ga0070706_100000060
555 Ga0070706_100020242
556 Ga0070706_100065291
557 Ga0070706_100103446
558 Ga0070706_100140022
559 Ga0070706_100172962
560 Ga0070706_100183444
561 Ga0070706_100314767
562 Ga0070706_100358955
563 Ga0070707_100000404
564 Ga0070707_100009712
565 Ga0070707_100049080
566 Ga0070707_100057229
567 Ga0070707_100214504
568 Ga0070707_100393159
569 Ga0070698_100092868
570 Ga0070698_100113468
571 Ga0070698_100211864
572 Ga0070699_100007182
573 Ga0070699_100007799
574 Ga0070679_100086987
575 Ga0070684_100028907
576 Ga0070684_100079528
577 Ga0070684_100092075
578 Ga0070697_100001547
579 Ga0070697_100009720
580 Ga0070697_100014093
581 Ga0070697_100022443
582 Ga0070697_100027056
583 Ga0070697_100078453
584 Ga0070697_100172911
585 Ga0068853_100245947
586 Ga0070672_100009990
587 Ga0070686_100146022
588 Ga0070665_100084845
589 Ga0070665_100098416
590 Ga0070665_100118757
591 Ga0070665_100363850
592 Ga0070704_100009970
593 Ga0068854_100057385
594 Ga0068856_100025481
595 Ga0068856_100289615
596 Ga0068859_100017494
597 Ga0068859_100155880
598 Ga0068864_100050744
599 Ga0068866_10007219
600 Ga0068866_10019867
601 Ga0068861_100204365
602 Ga0068851_10025116
603 Ga0068863_100431915
604 Ga0068858_100030626
605 Ga0068858_100149905
606 Ga0068858_100450049
607 Ga0068860_100072708
608 Ga0068862_100072365
609 Ga0081455_10006858
610 Ga0081455_10068779
611 Ga0081455_10158397
612 Ga0081540_1000010
613 Ga0081540_1112071
614 Ga0081539_10000153
615 Ga0081539_10009945
616 Ga0081539_10014922
617 Ga0081539_10025684
618 Ga0070717_10014664
619 Ga0070717_10032935
620 Ga0070717_10036789
621 Ga0070717_10049572
622 Ga0070717_10051409
623 Ga0070717_10073311
624 Ga0070717_10265104
625 Ga0070715_10011584
626 Ga0070715_10024118
627 Ga0070716_100016545
628 Ga0070716_100017380
629 Ga0070712_100000987
630 Ga0070712_100076182
631 Ga0070712_100082315
632 Ga0070712_100135085
633 Ga0097621_100066923
634 Ga0068871_100061315
635 Ga0068871_100190212
636 Ga0075434_100731071
637 Ga0075436_100039951
638 Ga0075436_100109755
639 Ga0097620_100017494
640 Ga0097620_100155886
641 Ga0099795_10007996
642 Ga0105240_10006436
643 Ga0105240_10007559
644 Ga0105245_10115739
645 Ga0105245_10129298
646 Ga0105245_10392369
647 Ga0105245_10449171
648 Ga0105247_10056734
649 Ga0105247_10165252
650 Ga0114129_10009121
651 Ga0114129_10276352
652 Ga0105243_10023617
653 Ga0105241_10021607
654 Ga0105241_10021731
655 Ga0105248_10076182
656 Ga0105248_10145585
657 Ga0105248_10262323
658 Ga0105248_10360900
659 Ga0105237_10083629
660 Ga0105237_10173775
661 Ga0105238_10043595
662 Ga0105238_10091802
663 Ga0105249_10022406
664 Ga0105249_10049159
665 Ga0105239_10314668
666 Ga0105239_10842028
667 Ga0157373_10290505
668 Ga0157371_10113926
669 Ga0157369_10008528
670 Ga0157369_10030101
671 Ga0157369_10276728
672 Ga0157369_10573033
673 Ga0157369_10627365
674 Ga0157374_10000649
675 Ga0157374_10002997
676 Ga0157374_10028709
677 Ga0157374_10279377
678 Ga0157378_10115677
679 Ga0157378_10141490
680 Ga0157378_10203339
681 Ga0157378_10232750
682 Ga0157378_10324850
683 Ga0163162_10003507
684 Ga0163162_10010968
685 Ga0163162_10033565
686 Ga0157372_10052573
687 Ga0157372_10412458
688 Ga0157375_10006798
689 Ga0157375_10020882
690 Ga0157375_10042583
691 Ga0163163_10092527
692 Ga0163163_10127643
693 Ga0182008_10009320
694 Ga0157377_10024082
695 Ga0157379_10037750
696 Ga0157376_10023940
697 Ga0157376_10248333
698 Ga0163161_10017584
699 Ga0224570_100596
700 Ga0228598_1000817
701 Ga0207666_1000254
702 Ga0207697_10000229
703 Ga0207697_10003825
704 Ga0207697_10004033
705 Ga0207697_10008272
706 Ga0207697_10022817
707 Ga0207697_10025423
708 Ga0207656_10024376
709 Ga0207692_10012802
710 Ga0207642_10006147
711 Ga0207642_10068352
712 Ga0207688_10117254
713 Ga0207680_10252935
714 Ga0207647_10063872
715 Ga0207699_10018437
716 Ga0207645_10001529
717 Ga0207645_10020126
718 Ga0207645_10032222
719 Ga0207684_10000118
720 Ga0207684_10020496
721 Ga0207684_10020578
722 Ga0207684_10038419
723 Ga0207684_10099998
724 Ga0207684_10236214
725 Ga0207654_10008632
726 Ga0207654_10023615
727 Ga0207707_10032791
728 Ga0207695_10004843
729 Ga0207695_10029399
730 Ga0207671_10440573
731 Ga0207693_10007933
732 Ga0207693_10027206
733 Ga0207693_10050482
734 Ga0207693_10051436
735 Ga0207693_10080135
736 Ga0207663_10024158
737 Ga0207663_10104685
738 Ga0207663_10266553
739 Ga0207657_10008758
740 Ga0207657_10034254
741 Ga0207657_10202277
742 Ga0207649_10051774
743 Ga0207649_10125265
744 Ga0207649_10252630
745 Ga0207646_10001329
746 Ga0207646_10004180
747 Ga0207646_10013327
748 Ga0207646_10025212
749 Ga0207646_10032078
750 Ga0207646_10227340
751 Ga0207646_10234333
752 Ga0207681_10006833
753 Ga0207681_10134368
754 Ga0207694_10036956
755 Ga0207694_10041871
756 Ga0207659_10037265
757 Ga0207659_10069723
758 Ga0207659_10225358
759 Ga0207687_10003342
760 Ga0207687_10131498
761 Ga0207687_10292687
762 Ga0207700_10034541
763 Ga0207700_10355675
764 Ga0207700_10450488
765 Ga0207664_10094419
766 Ga0207664_10145932
767 Ga0207644_10098335
768 Ga0207644_10167054
769 Ga0207690_10270657
770 Ga0207706_10001302
771 Ga0207706_10146106
772 Ga0207706_10198012
773 Ga0207686_10248893
774 Ga0207670_10033173
775 Ga0207670_10074419
776 Ga0207670_10118016
777 Ga0207669_10017444
778 Ga0207665_10005033
779 Ga0207665_10006429
780 Ga0207665_10010859
781 Ga0207691_10002581
782 Ga0207711_10003254
783 Ga0207689_10015489
784 Ga0207661_10458727
785 Ga0207679_10035375
786 Ga0207679_10332549
787 Ga0207667_10002559
788 Ga0207651_10025501
789 Ga0207651_10415660
790 Ga0207651_10432085
791 Ga0207712_10025121
792 Ga0207712_10179271
793 Ga0207712_10203679
794 Ga0207668_10070082
795 Ga0207640_10041651
796 Ga0207658_10038813
797 Ga0207658_10158428
798 Ga0207658_10159937
799 Ga0207658_10194206
800 Ga0207677_10372698
801 Ga0207703_10138451
802 Ga0207678_10021841
803 Ga0207678_10023132
804 Ga0207678_10106624
805 Ga0207702_10118477
806 Ga0207702_10164922
807 Ga0207702_10169169
808 Ga0207641_10030801
809 Ga0207641_10077679
810 Ga0207648_10034229
811 Ga0207675_100048098
812 Ga0207675_100259809
813 Ga0207683_10031417
814 Ga0207683_10033703
815 Ga0207683_10134645
816 Ga0265356_1005574
817 Ga0268266_10021034
818 Ga0268266_10130468
819 Ga0268266_10170548
820 Ga0268266_10456524
821 Ga0268265_10053751
822 Ga0268264_10048878
823 Ga0268264_10117598
824 Ga0265338_10025836
825 Ga0265338_10042147
826 Ga0265338_10055033
827 Ga0265760_10000007
828 Ga0265760_10004773
829 Ga0265325_10012960
830 Ga0265331_10124207
831 Ga0373932_0034151
832 Ga0373936_0070389
833 Ga0373943_0038437
834 Ga0373955_0208868
835 Ga0373927_0039058
836 Ga0373947_0055213
837 Ga0373937_0244329
838 Ga0373925_0031927
839 Ga0395898_0011104
840 Ga0395905_0006788
841 Ga0395905_0050062
842 Ga0395905_0150571
843 Ga0395901_0003456
844 Ga0395901_0236402
845 Ga0395901_0318023
846 Ga0436363_0878464
847 Ga0439455_0021405
848 Ga0451577_0003666
849 Ga0453683_0052335
850 Ga0453684_0000480
851 Ga0466959_0010391
852 Ga0451576_0105904
853 Ga0466967_0135491
854 Ga0495592_0015199
855 Ga0495592_0133083
856 Ga0495603_0124053
857 Ga0495651_0228866
858 Ga0495580_0005906
859 Ga0495582_0034040
860 Ga0495582_0042929
861 Ga0495584_0136006
862 Ga0495594_0045825
863 Ga0495607_0146367
864 Ga0495630_0091005
865 Ga0495642_0031579
866 Ga0495652_0087495
867 Ga0495652_0115809
868 Ga0495640_0174458
869 Ga0495586_0263170
870 Ga0495598_0009744
871 Ga0495645_0005554
872 Ga0495668_0071769
873 Ga0495634_0078602
874 Ga0495635_0108361
875 Ga0495599_0010342
876 Ga0495623_0040018
877 Ga0495669_0024879
878 Ga0495669_0115014
879 Ga0495669_0126969
880 Ga0495613_0007327
881 Ga0495624_0124187
882 Ga0495604_0093811
883 Ga0495604_0110628
884 Ga0495674_0390531
885 Ga0495676_0069059
886 Ga0495680_0141526
887 Ga0495675_0045822
888 Ga0495677_0035175
889 Ga0496100_0147453
890 Ga0496100_0302256
891 Ga0496101_0054464
892 Ga0496102_0001755
893 Ga0496102_0056678
894 Ga0496102_0080081
895 Ga0496102_0112126
896 Ga0496103_0012744
897 Ga0496103_0058970
898 Ga0496104_0046269
899 Ga0496104_0055462
900 Ga0496104_0442223
901 Ga0496105_0051451
902 Ga0496105_0121475
903 Ga0496106_0029700
904 Ga0496106_0055535
905 Ga0496106_0431404
906 Ga0496107_0001175
907 Ga0496107_0047653
908 Ga0496107_0186737
909 Ga0496108_0015744
910 Ga0496108_0136135
911 Ga0496109_0046787
912 Ga0496109_0062389
913 Ga0496109_0210852
914 Ga0496109_0299660
915 Ga0496110_0174468
916 Ga0496111_0331836
917 Ga0496112_0100433
918 Ga0496112_0130823
919 Ga0496112_0438545
920 Ga0496112_0551477
921 Ga0496113_0001826
922 Ga0496114_0282999
923 Ga0496115_0027663
924 Ga0496115_0050035
925 Ga0496126_0089646
926 nmdc:mga05p37_494769_c1
927 nmdc:mga05p37_6047_c1
928 nmdc:mga0rr50_357364_c1
929 nmdc:mga08x19_119389_c1
930 nmdc:mga08x19_92017_c1
931 Ga0495601_0003878
932 Ga0495655_0052954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00682

HMGL-like

HMGL-like

58

332

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mp5-assembly2.cif.gz_C crystal structure of human lyase r41m in complex with hmg-coa 0.9361 1 282
3mp3-assembly2.cif.gz_D crystal structure of human lyase in complex with inhibitor hg-coa 0.9342 1 282
2cw6-assembly1.cif.gz_A crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria 0.9328 1 282
1ydo-assembly1.cif.gz_A crystal structure of the bacillis subtilis hmg-coa lyase, northeast structural genomics target sr181. 0.9325 1 283
2cw6-assembly3.cif.gz_F crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria 0.9323 1 282
ID Description Score Start End Superfamily
af_Q4DIQ4_8_322_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9463 1 280 3.20.20.70
af_Q0JNR8_151_451_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9339 1 283 3.20.20.70
1ydoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9244 1 283 3.20.20.70
af_Q4DIQ4_8_322_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9177 1 280 3.20.20.70
af_Q0JNR8_151_451_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9061 1 283 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V9PDD1-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9815 91 255 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A7V9ES08-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9804 97 286 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A2V6HKK8-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9758 3 122 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A7V9ES08-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9753 97 286 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A2V5UT35-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9737 4 284 GO:0004419
GO:0006552
GO:0046872
GO:0046951

Map