F449616

General Info

Members Datasets Scaffolds Average Seq Length
466 244 932 153

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100265986|Ga0070713_1002659862
Length 176
Sequence VRVRLIAVGSRMPKWVREAYEDYITRLRASLKISLVEIETGPRGGRASERSPGTGGPGGGSVDGTSKRPSRAVEIEGQKLLAALRKDEYVVALDEHGSQMTTRELAAWLKARMQDGRDVAFLIGGPDGFAPGVLERSDLKWSLSRLTFPHALVRVVLAEQLYRAHGVLANHPYHRD

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
226 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
227 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
228 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
231 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
234 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
235 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
242 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
243 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0
Rhizoplane 6.44
Rhizosphere 77.9
Stem 0
Stem Tuber 0
Unclassified 13.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100265986 3300005436 Bacteria 1568
2 JGI25154J39366_1000775 3300002738 Bacteria 14185
3 rootH1_10111460 3300003316 Bacteria 3947
4 rootL2_10128443 3300003322 Bacteria 1326
5 rootL2_10136917 3300003322 Bacteria 2316
6 Ga0007409J51694_1030117 3300003575 Bacteria 2274
7 Ga0065707_10084801 3300005295 Bacteria 6768
8 Ga0070658_10278650 3300005327 Bacteria 1423
9 Ga0070683_100096595 3300005329 Bacteria 2779
10 Ga0070670_100136771 3300005331 Bacteria 2117
11 Ga0068869_100339625 3300005334 Bacteria 1222
12 Ga0070666_10008277 3300005335 Bacteria 6450
13 Ga0070666_10047553 3300005335 Bacteria 2880
14 Ga0070666_10052262 3300005335 Bacteria 2753
15 Ga0070666_10936128 3300005335 Bacteria 641
16 Ga0070680_100301682 3300005336 Bacteria 1358
17 Ga0070680_101157592 3300005336 Bacteria 669
18 Ga0070682_100156480 3300005337 Bacteria 1569
19 Ga0070682_100197843 3300005337 Bacteria 1416
20 Ga0068868_100008420 3300005338 Bacteria 7385
21 Ga0070687_100730405 3300005343 Unclassified 695
22 Ga0070661_100886183 3300005344 Bacteria 736
23 Ga0070671_100002179 3300005355 Bacteria 15116
24 Ga0070671_100043009 3300005355 Bacteria 3756
25 Ga0070674_100429862 3300005356 Bacteria 1085
26 Ga0070673_100100586 3300005364 Bacteria 2380
27 Ga0070667_100001144 3300005367 Bacteria 24083
28 Ga0070667_100010765 3300005367 Bacteria 7559
29 Ga0070667_100021067 3300005367 Bacteria 5415
30 Ga0070667_101081403 3300005367 Bacteria 749
31 Ga0070667_101382286 3300005367 Unclassified 660
32 Ga0070709_10081539 3300005434 Bacteria 2112
33 Ga0070714_100142197 3300005435 Bacteria 2155
34 Ga0070713_100078329 3300005436 Bacteria 2813
35 Ga0070711_100002199 3300005439 Bacteria 11073
36 Ga0070663_100464406 3300005455 Bacteria 1045
37 Ga0070678_100026351 3300005456 Bacteria 3928
38 Ga0070662_100895123 3300005457 Unclassified 757
39 Ga0070681_10004697 3300005458 Bacteria 13071
40 Ga0070681_10081916 3300005458 Bacteria 3183
41 Ga0070681_10933899 3300005458 Bacteria 786
42 Ga0068867_100047885 3300005459 Bacteria 3144
43 Ga0070685_10045359 3300005466 Bacteria 2521
44 Ga0070706_101577101 3300005467 Bacteria 599
45 Ga0070679_100000534 3300005530 Bacteria 32328
46 Ga0070679_100099895 3300005530 Bacteria 2889
47 Ga0070679_100186364 3300005530 Bacteria 2045
48 Ga0070679_100371893 3300005530 Bacteria 1376
49 Ga0070684_100067347 3300005535 Bacteria 3145
50 Ga0070684_100230043 3300005535 Unclassified 1693
51 Ga0068853_100065768 3300005539 Bacteria 3146
52 Ga0068853_100124803 3300005539 Bacteria 2299
53 Ga0068853_100299783 3300005539 Bacteria 1485
54 Ga0070686_100704068 3300005544 Unclassified 806
55 Ga0070693_100045058 3300005547 Bacteria 2498
56 Ga0070665_100001700 3300005548 Bacteria 25288
57 Ga0070665_100005821 3300005548 Bacteria 12645
58 Ga0070665_100013728 3300005548 Bacteria 8153
59 Ga0070665_100027400 3300005548 Bacteria 5740
60 Ga0070665_100034687 3300005548 Bacteria 5075
61 Ga0070665_100035143 3300005548 Bacteria 5038
62 Ga0070665_100119071 3300005548 Bacteria 2643
63 Ga0070665_101590142 3300005548 Bacteria 662
64 Ga0068855_100008557 3300005563 Bacteria 12370
65 Ga0068855_100038003 3300005563 Bacteria 5722
66 Ga0068855_100148657 3300005563 Bacteria 2665
67 Ga0068855_100157736 3300005563 Bacteria 2577
68 Ga0068855_100409113 3300005563 Bacteria 1486
69 Ga0068855_100553287 3300005563 Bacteria 1245
70 Ga0068855_100852110 3300005563 Bacteria 966
71 Ga0068857_100084478 3300005577 Bacteria 2837
72 Ga0068854_100207609 3300005578 Bacteria 1543
73 Ga0068856_100711109 3300005614 Unclassified 1025
74 Ga0068859_100001039 3300005617 Bacteria 28434
75 Ga0068859_100043358 3300005617 Bacteria 4521
76 Ga0068859_101095294 3300005617 Bacteria 876
77 Ga0068864_100086131 3300005618 Bacteria 2763
78 Ga0068864_100383800 3300005618 Bacteria 1332
79 Ga0068866_10040598 3300005718 Bacteria 2304
80 Ga0068861_100147147 3300005719 Bacteria 1929
81 Ga0068861_100199897 3300005719 Bacteria 1677
82 Ga0068861_100249002 3300005719 Bacteria 1515
83 Ga0068851_10109718 3300005834 Unclassified 1472
84 Ga0068863_100011984 3300005841 Bacteria 8378
85 Ga0068863_100866406 3300005841 Bacteria 902
86 Ga0068863_101406145 3300005841 Bacteria 705
87 Ga0068858_100000125 3300005842 Bacteria 79795
88 Ga0068858_100097101 3300005842 Bacteria 2746
89 Ga0068858_100225413 3300005842 Unclassified 1776
90 Ga0068858_100226293 3300005842 Bacteria 1772
91 Ga0068858_100469179 3300005842 Unclassified 1214
92 Ga0068858_100669642 3300005842 Bacteria 1009
93 Ga0068860_100001229 3300005843 Bacteria 27945
94 Ga0068860_100048414 3300005843 Bacteria 4051
95 Ga0068860_100124913 3300005843 Bacteria 2466
96 Ga0068862_100107788 3300005844 Unclassified 2442
97 Ga0081455_10001331 3300005937 Bacteria 30542
98 Ga0081455_10221898 3300005937 Unclassified 1400
99 Ga0081539_10000011 3300005985 Bacteria 461887
100 Ga0070715_10000743 3300006163 Bacteria 8788
101 Ga0070716_100001832 3300006173 Bacteria 9629
102 Ga0070712_100014338 3300006175 Bacteria 5088
103 Ga0075366_10504537 3300006195 Bacteria 748
104 Ga0068871_100017348 3300006358 Bacteria 5445
105 Ga0068871_100093420 3300006358 Bacteria 2510
106 Ga0068871_100351307 3300006358 Bacteria 1304
107 Ga0097620_100001039 3300006931 Bacteria 28434
108 Ga0097620_100043358 3300006931 Bacteria 4521
109 Ga0097620_101094959 3300006931 Bacteria 876
110 Ga0105250_10208750 3300009092 Unclassified 825
111 Ga0105240_10000901 3300009093 Bacteria 53028
112 Ga0105240_10004339 3300009093 Bacteria 21648
113 Ga0105240_10012526 3300009093 Bacteria 11700
114 Ga0105240_10019698 3300009093 Bacteria 9011
115 Ga0105240_10038983 3300009093 Bacteria 6089
116 Ga0105240_10076118 3300009093 Bacteria 4138
117 Ga0105240_10106716 3300009093 Bacteria 3396
118 Ga0105240_10398577 3300009093 Bacteria 1550
119 Ga0105240_10423008 3300009093 Unclassified 1496
120 Ga0105240_10601028 3300009093 Unclassified 1211
121 Ga0105240_10668746 3300009093 Unclassified 1136
122 Ga0105245_10019136 3300009098 Bacteria 5995
123 Ga0105247_10000269 3300009101 Bacteria 48237
124 Ga0105247_10052971 3300009101 Bacteria 2502
125 Ga0105247_10069011 3300009101 Bacteria 2205
126 Ga0105247_10384870 3300009101 Bacteria 996
127 Ga0105241_10155776 3300009174 Bacteria 1873
128 Ga0105241_10354301 3300009174 Bacteria 1275
129 Ga0105242_10069090 3300009176 Bacteria 2925
130 Ga0105242_11620979 3300009176 Bacteria 681
131 Ga0105248_10017108 3300009177 Bacteria 7988
132 Ga0105248_10019188 3300009177 Bacteria 7564
133 Ga0105248_11163400 3300009177 Bacteria 872
134 Ga0105237_10005523 3300009545 Bacteria 14254
135 Ga0105237_10064105 3300009545 Bacteria 3672
136 Ga0105237_10075570 3300009545 Bacteria 3360
137 Ga0105237_10186452 3300009545 Bacteria 2075
138 Ga0105237_10304106 3300009545 Bacteria 1598
139 Ga0105237_10351786 3300009545 Unclassified 1478
140 Ga0105237_11890635 3300009545 Bacteria 605
141 Ga0105238_10025860 3300009551 Bacteria 5985
142 Ga0105238_10029724 3300009551 Bacteria 5565
143 Ga0105238_10056343 3300009551 Bacteria 3944
144 Ga0105238_10056896 3300009551 Bacteria 3922
145 Ga0105238_10061715 3300009551 Bacteria 3750
146 Ga0105238_10249130 3300009551 Bacteria 1754
147 Ga0105238_10274745 3300009551 Bacteria 1666
148 Ga0105238_10396251 3300009551 Unclassified 1373
149 Ga0105238_10469133 3300009551 Bacteria 1257
150 Ga0105238_10535395 3300009551 Bacteria 1175
151 Ga0105238_10947057 3300009551 Bacteria 881
152 Ga0105238_12091637 3300009551 Bacteria 600
153 Ga0105249_10045766 3300009553 Bacteria 3981
154 Ga0105249_10085285 3300009553 Bacteria 2943
155 Ga0105239_10029194 3300010375 Bacteria 6064
156 Ga0105239_10114575 3300010375 Bacteria 2990
157 Ga0105239_10175541 3300010375 Bacteria 2396
158 Ga0105246_10780514 3300011119 Bacteria 846
159 Ga0157373_10067444 3300013100 Bacteria 2530
160 Ga0157370_10011797 3300013104 Bacteria 9119
161 Ga0157370_10140773 3300013104 Bacteria 2248
162 Ga0157369_10053275 3300013105 Bacteria 4374
163 Ga0157369_10087082 3300013105 Bacteria 3335
164 Ga0157369_10158651 3300013105 Bacteria 2388
165 Ga0157374_10001720 3300013296 Bacteria 18374
166 Ga0157378_10034468 3300013297 Bacteria 4476
167 Ga0163162_10006541 3300013306 Bacteria 11289
168 Ga0163162_10127101 3300013306 Bacteria 2656
169 Ga0163162_10356697 3300013306 Bacteria 1595
170 Ga0163162_11051332 3300013306 Bacteria 922
171 Ga0157372_10189936 3300013307 Unclassified 2379
172 Ga0157375_10021329 3300013308 Bacteria 5937
173 Ga0163163_10093927 3300014325 Bacteria 3016
174 Ga0163163_10116062 3300014325 Bacteria 2708
175 Ga0163163_10221254 3300014325 Bacteria 1942
176 Ga0157379_10003724 3300014968 Bacteria 12970
177 Ga0157379_10019367 3300014968 Bacteria 6010
178 Ga0157379_10049284 3300014968 Unclassified 3760
179 Ga0157379_10068059 3300014968 Bacteria 3184
180 Ga0157379_10201624 3300014968 Bacteria 1799
181 Ga0157379_10315383 3300014968 Unclassified 1427
182 Ga0157379_10977233 3300014968 Unclassified 806
183 Ga0206354_10668525 3300020081 Bacteria 1748
184 Ga0207692_11211859 3300025898 Unclassified 501
185 Ga0207710_10000332 3300025900 Bacteria 35424
186 Ga0207710_10149894 3300025900 Bacteria 1131
187 Ga0207680_10003611 3300025903 Bacteria 7266
188 Ga0207680_10264444 3300025903 Bacteria 1191
189 Ga0207680_10926159 3300025903 Bacteria 624
190 Ga0207685_10003203 3300025905 Bacteria 3936
191 Ga0207699_10113788 3300025906 Bacteria 1739
192 Ga0207699_10577602 3300025906 Unclassified 817
193 Ga0207654_10319068 3300025911 Bacteria 1062
194 Ga0207654_10640368 3300025911 Bacteria 761
195 Ga0207707_10004120 3300025912 Bacteria 12885
196 Ga0207707_10044843 3300025912 Bacteria 3854
197 Ga0207707_10053698 3300025912 Bacteria 3508
198 Ga0207707_10062507 3300025912 Bacteria 3240
199 Ga0207707_10416931 3300025912 Bacteria 1152
200 Ga0207707_10817306 3300025912 Unclassified 775
201 Ga0207695_10003807 3300025913 Bacteria 20912
202 Ga0207695_10017428 3300025913 Bacteria 8359
203 Ga0207695_10027473 3300025913 Bacteria 6336
204 Ga0207695_10060091 3300025913 Bacteria 3937
205 Ga0207695_10064656 3300025913 Bacteria 3765
206 Ga0207695_10507551 3300025913 Bacteria 1088
207 Ga0207695_10518186 3300025913 Bacteria 1074
208 Ga0207695_10625475 3300025913 Bacteria 958
209 Ga0207671_10021466 3300025914 Bacteria 4900
210 Ga0207671_10254205 3300025914 Bacteria 1382
211 Ga0207693_10000503 3300025915 Bacteria 35359
212 Ga0207663_10146119 3300025916 Bacteria 1653
213 Ga0207660_10014155 3300025917 Bacteria 5238
214 Ga0207660_10088530 3300025917 Bacteria 2290
215 Ga0207660_10662717 3300025917 Bacteria 851
216 Ga0207660_10785561 3300025917 Bacteria 777
217 Ga0207652_10008956 3300025921 Bacteria 8066
218 Ga0207652_10014963 3300025921 Bacteria 6293
219 Ga0207652_10336347 3300025921 Bacteria 1363
220 Ga0207694_10036972 3300025924 Bacteria 3748
221 Ga0207694_10037575 3300025924 Bacteria 3720
222 Ga0207694_10068621 3300025924 Bacteria 2769
223 Ga0207694_10096173 3300025924 Bacteria 2342
224 Ga0207694_10171947 3300025924 Bacteria 1755
225 Ga0207694_10418041 3300025924 Unclassified 1117
226 Ga0207650_10266307 3300025925 Bacteria 1391
227 Ga0207687_10398963 3300025927 Bacteria 1131
228 Ga0207700_10050476 3300025928 Bacteria 3100
229 Ga0207700_10246700 3300025928 Bacteria 1524
230 Ga0207664_10088426 3300025929 Bacteria 2535
231 Ga0207644_10051428 3300025931 Bacteria 2957
232 Ga0207644_10352379 3300025931 Bacteria 1195
233 Ga0207686_10034462 3300025934 Bacteria 3030
234 Ga0207704_10585769 3300025938 Bacteria 911
235 Ga0207665_10001006 3300025939 Bacteria 19021
236 Ga0207711_10107081 3300025941 Bacteria 2482
237 Ga0207711_10142751 3300025941 Bacteria 2155
238 Ga0207711_10309552 3300025941 Bacteria 1458
239 Ga0207689_10408762 3300025942 Bacteria 1132
240 Ga0207661_10193223 3300025944 Bacteria 1785
241 Ga0207679_10367647 3300025945 Bacteria 1258
242 Ga0207667_10005460 3300025949 Bacteria 15495
243 Ga0207667_10035497 3300025949 Bacteria 5348
244 Ga0207667_10049828 3300025949 Bacteria 4421
245 Ga0207667_11019347 3300025949 Bacteria 814
246 Ga0207651_10022944 3300025960 Bacteria 3829
247 Ga0207712_10068619 3300025961 Bacteria 2541
248 Ga0207668_10437966 3300025972 Bacteria 1113
249 Ga0207658_10000131 3300025986 Bacteria 80909
250 Ga0207658_10005547 3300025986 Bacteria 8643
251 Ga0207658_10056253 3300025986 Bacteria 2918
252 Ga0207658_10130189 3300025986 Bacteria 2020
253 Ga0207658_10976745 3300025986 Unclassified 772
254 Ga0207677_10069051 3300026023 Bacteria 2483
255 Ga0207703_10000688 3300026035 Bacteria 33443
256 Ga0207703_10036997 3300026035 Bacteria 3887
257 Ga0207703_10098349 3300026035 Bacteria 2474
258 Ga0207703_10186469 3300026035 Bacteria 1834
259 Ga0207703_10379680 3300026035 Unclassified 1307
260 Ga0207703_12073226 3300026035 Unclassified 545
261 Ga0207639_10196753 3300026041 Bacteria 1726
262 Ga0207639_10260326 3300026041 Bacteria 1517
263 Ga0207639_10364921 3300026041 Bacteria 1293
264 Ga0207678_10066093 3300026067 Bacteria 3105
265 Ga0207678_10535666 3300026067 Unclassified 1023
266 Ga0207702_11055768 3300026078 Bacteria 806
267 Ga0207702_11184908 3300026078 Unclassified 758
268 Ga0207641_10016691 3300026088 Bacteria 6012
269 Ga0207641_10196593 3300026088 Bacteria 1856
270 Ga0207641_10342743 3300026088 Bacteria 1422
271 Ga0207641_10745657 3300026088 Bacteria 966
272 Ga0207648_10073090 3300026089 Bacteria 2989
273 Ga0207676_10325275 3300026095 Bacteria 1413
274 Ga0207676_10407097 3300026095 Bacteria 1273
275 Ga0207674_10218626 3300026116 Bacteria 1853
276 Ga0207675_100019395 3300026118 Bacteria 6345
277 Ga0207675_100279835 3300026118 Bacteria 1621
278 Ga0207683_10029833 3300026121 Bacteria 4723
279 Ga0268266_10001105 3300028379 Bacteria 33805
280 Ga0268266_10001899 3300028379 Bacteria 23525
281 Ga0268266_10005995 3300028379 Bacteria 11217
282 Ga0268266_10039819 3300028379 Bacteria 4004
283 Ga0268266_10045207 3300028379 Bacteria 3767
284 Ga0268266_10048091 3300028379 Bacteria 3655
285 Ga0268266_10052128 3300028379 Bacteria 3513
286 Ga0268265_10005733 3300028380 Bacteria 8480
287 Ga0268265_10413366 3300028380 Bacteria 1250
288 Ga0268265_11877092 3300028380 Bacteria 606
289 Ga0268264_10000102 3300028381 Bacteria 222526
290 Ga0268264_10018433 3300028381 Bacteria 5708
291 Ga0268264_10288382 3300028381 Bacteria 1540
292 Ga0268264_10309353 3300028381 Bacteria 1490
293 Ga0265319_1010217 3300028563 Bacteria 3932
294 Ga0265334_10006488 3300028573 Bacteria 5034
295 Ga0265334_10056244 3300028573 Bacteria 1494
296 Ga0265318_10002258 3300028577 Bacteria 10378
297 Ga0307517_10367732 3300028786 Unclassified 774
298 Ga0307515_10020160 3300028794 Bacteria 11919
299 Ga0265338_10051742 3300028800 Bacteria 3694
300 Ga0307511_10000235 3300030521 Bacteria 56564
301 Ga0307511_10047579 3300030521 Bacteria 3506
302 Ga0307511_10128980 3300030521 Unclassified 1531
303 Ga0265330_10003245 3300031235 Bacteria 8564
304 Ga0265320_10253186 3300031240 Bacteria 781
305 Ga0265325_10012592 3300031241 Bacteria 4832
306 Ga0265329_10005106 3300031242 Bacteria 5352
307 Ga0265340_10084213 3300031247 Unclassified 1493
308 Ga0265340_10159836 3300031247 Unclassified 1024
309 Ga0265339_10022860 3300031249 Bacteria 3617
310 Ga0265331_10002017 3300031250 Bacteria 14117
311 Ga0265331_10005754 3300031250 Bacteria 7427
312 Ga0265316_10046527 3300031344 Bacteria 3436
313 Ga0307513_10039255 3300031456 Bacteria 5249
314 Ga0307509_10000987 3300031507 Bacteria 48811
315 Ga0307509_10150855 3300031507 Bacteria 2240
316 Ga0307509_10182765 3300031507 Bacteria 1959
317 Ga0307509_10415807 3300031507 Bacteria 1047
318 Ga0265313_10002313 3300031595 Bacteria 16699
319 Ga0265314_10003767 3300031711 Bacteria 14497
320 Ga0265342_10003243 3300031712 Bacteria 13489
321 Ga0307416_101615676 3300032002 Bacteria 753
322 Ga0307507_10477581 3300033179 Unclassified 679
323 Ga0307510_10079498 3300033180 Unclassified 3197
324 Ga0373944_0404433 3300035089 Bacteria 527
325 Ga0373923_0022115 3300035111 Bacteria 2490
326 Ga0373936_0089990 3300035113 Bacteria 1286
327 Ga0373955_0474361 3300035172 Unclassified 763
328 Ga0373935_0116766 3300035692 Bacteria 1778
329 Ga0373927_0095094 3300035695 Bacteria 1936
330 Ga0373947_0016225 3300035725 Bacteria 4281
331 Ga0373937_0118486 3300036401 Bacteria 2466
332 Ga0373937_0241008 3300036401 Unclassified 1704
333 Ga0373925_0155674 3300037068 Bacteria 1797
334 Ga0436363_0180686 3300039450 Bacteria 550
335 Ga0436363_0215834 3300039450 Bacteria 662
336 Ga0436363_0509065 3300039450 Bacteria 3544
337 Ga0436363_0851948 3300039450 Unclassified 1185
338 Ga0436363_1077091 3300039450 Unclassified 611
339 Ga0451802_0533470 3300041460 Bacteria 676
340 Ga0451807_1840129 3300041486 Bacteria 3355
341 Ga0451849_0216996 3300041505 Unclassified 926
342 Ga0466969_0013487 3300044656 Bacteria 4304
343 Ga0466969_0028252 3300044656 Bacteria 2867
344 Ga0466969_0436892 3300044656 Bacteria 595
345 Ga0466972_0064828 3300044658 Bacteria 1748
346 Ga0466966_0001231 3300044684 Bacteria 16430
347 Ga0466966_0003082 3300044684 Bacteria 10981
348 Ga0466961_0020426 3300044693 Bacteria 4260
349 Ga0466964_0093367 3300044706 Bacteria 1313
350 Ga0466971_0000391 3300044719 Bacteria 16943
351 Ga0466971_0148667 3300044719 Bacteria 1093
352 Ga0466968_0012713 3300044735 Bacteria 3302
353 Ga0466970_0068821 3300044765 Unclassified 1902
354 Ga0466970_0073999 3300044765 Bacteria 1833
355 Ga0466957_0015594 3300044842 Bacteria 4438
356 Ga0466960_0011590 3300044901 Bacteria 3695
357 Ga0466959_0004500 3300045049 Bacteria 9343
358 Ga0466959_0017148 3300045049 Bacteria 5304
359 Ga0466959_0159354 3300045049 Unclassified 1587
360 Ga0495629_0068789 3300046459 Bacteria 2471
361 Ga0495638_0017921 3300046460 Bacteria 4713
362 Ga0495580_0016396 3300046472 Bacteria 5559
363 Ga0495580_0171795 3300046472 Bacteria 1498
364 Ga0495585_0251763 3300046492 Bacteria 881
365 Ga0495583_0148611 3300046506 Bacteria 972
366 Ga0495606_0069919 3300046507 Bacteria 2216
367 Ga0495628_0125624 3300046516 Bacteria 1966
368 Ga0495632_0030562 3300046519 Bacteria 2794
369 Ga0495632_0048447 3300046519 Bacteria 2104
370 Ga0495648_0134096 3300046524 Bacteria 1313
371 Ga0495586_0434016 3300046535 Bacteria 757
372 Ga0495634_0307698 3300046642 Bacteria 957
373 Ga0495611_0559682 3300046648 Unclassified 518
374 Ga0495625_0030286 3300046660 Bacteria 4040
375 Ga0495658_0196892 3300046683 Bacteria 1255
376 Ga0495671_0545836 3300046692 Bacteria 552
377 Ga0495649_0198774 3300046694 Bacteria 1042
378 Ga0495581_0714553 3300047315 Bacteria 577
379 Ga0495687_120189 3300047443 Bacteria 950
380 Ga0495673_0320573 3300047469 Bacteria 552
381 Ga0495686_0199014 3300047472 Bacteria 1151
382 Ga0496100_0016400 3300048903 Bacteria 4350
383 Ga0496101_0493752 3300048904 Unclassified 967
384 Ga0496101_0656357 3300048904 Bacteria 829
385 Ga0496102_0006338 3300048905 Bacteria 10088
386 Ga0496102_0015680 3300048905 Bacteria 6602
387 Ga0496102_0025058 3300048905 Bacteria 5306
388 Ga0496103_0434407 3300048906 Unclassified 842
389 Ga0496104_0128304 3300048907 Bacteria 2435
390 Ga0496105_0011043 3300048908 Bacteria 7119
391 Ga0496105_0499724 3300048908 Unclassified 955
392 Ga0496106_0008909 3300048909 Bacteria 7417
393 Ga0496106_0533602 3300048909 Unclassified 942
394 Ga0496106_0646751 3300048909 Unclassified 845
395 Ga0496107_0032088 3300048910 Bacteria 3752
396 Ga0496107_0447915 3300048910 Unclassified 959
397 Ga0496108_0008245 3300048911 Bacteria 8457
398 Ga0496108_0187375 3300048911 Bacteria 1793
399 Ga0496109_0416592 3300048912 Bacteria 1269
400 Ga0496110_0013923 3300048913 Bacteria 6663
401 Ga0496110_0880835 3300048913 Unclassified 801
402 Ga0496111_0027098 3300048914 Bacteria 4051
403 Ga0496112_0024436 3300048915 Bacteria 5786
404 Ga0496113_0108870 3300048916 Bacteria 2154
405 Ga0496114_0016424 3300048917 Bacteria 5965
406 Ga0496114_0147262 3300048917 Bacteria 2042
407 Ga0496115_0074927 3300048918 Bacteria 2748
408 Ga0496115_0238213 3300048918 Bacteria 1500
409 Ga0496115_1409609 3300048918 Unclassified 514
410 Ga0496116_0042153 3300048919 Bacteria 3124
411 Ga0496117_0001307 3300048920 Bacteria 36670
412 Ga0496118_0000032 3300048921 Bacteria 330072
413 Ga0496118_0045488 3300048921 Bacteria 3426
414 Ga0496118_0295799 3300048921 Unclassified 892
415 Ga0496119_0006461 3300048922 Bacteria 10842
416 Ga0496119_0008002 3300048922 Bacteria 9397
417 Ga0496120_0001131 3300048923 Bacteria 34451
418 Ga0496120_0044692 3300048923 Bacteria 2571
419 Ga0496120_0324269 3300048923 Unclassified 698
420 Ga0496121_0000704 3300048924 Bacteria 62218
421 Ga0496121_0010840 3300048924 Bacteria 10195
422 Ga0496121_0169434 3300048924 Bacteria 1588
423 Ga0496121_0525243 3300048924 Unclassified 746
424 Ga0496121_0648455 3300048924 Unclassified 643
425 Ga0496124_0030070 3300048927 Bacteria 4828
426 Ga0496125_0000324 3300048928 Bacteria 92755
427 Ga0496125_0027043 3300048928 Bacteria 5210
428 Ga0496125_0032189 3300048928 Bacteria 4661
429 Ga0496125_0319904 3300048928 Unclassified 941
430 Ga0496126_0004870 3300048929 Bacteria 15724
431 Ga0496126_0012178 3300048929 Bacteria 8827
432 Ga0496126_0367150 3300048929 Unclassified 1174
433 Ga0495682_0128131 3300049460 Unclassified 908
434 Ga0501039_0210006 3300049575 Unclassified 1531
435 Ga0501083_0041196 3300049744 Bacteria 3133
436 nmdc:mga0k408_443101_c1 3300050493 Bacteria 771
437 Ga0495612_0075244 3300053078 Bacteria 1413
438 Ga0495595_0239161 3300053084 Bacteria 908
439 Ga0500583_0051807 3300053092 Bacteria 1908
440 Ga0500583_0081254 3300053092 Bacteria 1566
441 Ga0500583_0109457 3300053092 Bacteria 1359
442 Ga0500566_0487671 3300053094 Unclassified 533
443 Ga0500641_0013424 3300053096 Bacteria 3010
444 Ga0500641_0076505 3300053096 Bacteria 1416
445 Ga0500648_211367 3300053097 Bacteria 962
446 Ga0500660_096007 3300053100 Bacteria 1308
447 Ga0500556_0000313 3300053104 Bacteria 36728
448 Ga0500556_0033676 3300053104 Bacteria 1758
449 Ga0500562_154264 3300053108 Bacteria 625
450 Ga0500591_010318 3300053115 Bacteria 4414
451 Ga0500594_0225692 3300053118 Bacteria 620
452 Ga0500595_048454 3300053119 Bacteria 1327
453 Ga0500614_054294 3300053123 Bacteria 1061
454 Ga0500617_028295 3300053124 Bacteria 2496
455 Ga0500658_0063167 3300053134 Bacteria 1545
456 Ga0500559_0525772 3300053136 Unclassified 542
457 Ga0500604_0028633 3300053151 Bacteria 1619
458 Ga0500604_0353646 3300053151 Bacteria 510
459 Ga0500616_0000193 3300053153 Bacteria 100119
460 Ga0500616_0019201 3300053153 Bacteria 3854
461 Ga0500622_0011589 3300053156 Bacteria 4796
462 Ga0500639_108428 3300053163 Bacteria 1355
463 Ga0500637_0067752 3300053178 Bacteria 2051
464 Ga0500637_0196999 3300053178 Bacteria 1149
465 Ga0587079_074020 3300059647 Bacteria 765
466 Ga0466962_0000261 3300061719 Bacteria 22319
467 Ga0070713_100265986
468 JGI25154J39366_1000775
469 rootH1_10111460
470 rootL2_10128443
471 rootL2_10136917
472 Ga0007409J51694_1030117
473 Ga0065707_10084801
474 Ga0070658_10278650
475 Ga0070683_100096595
476 Ga0070670_100136771
477 Ga0068869_100339625
478 Ga0070666_10008277
479 Ga0070666_10047553
480 Ga0070666_10052262
481 Ga0070666_10936128
482 Ga0070680_100301682
483 Ga0070680_101157592
484 Ga0070682_100156480
485 Ga0070682_100197843
486 Ga0068868_100008420
487 Ga0070687_100730405
488 Ga0070661_100886183
489 Ga0070671_100002179
490 Ga0070671_100043009
491 Ga0070674_100429862
492 Ga0070673_100100586
493 Ga0070667_100001144
494 Ga0070667_100010765
495 Ga0070667_100021067
496 Ga0070667_101081403
497 Ga0070667_101382286
498 Ga0070709_10081539
499 Ga0070714_100142197
500 Ga0070713_100078329
501 Ga0070711_100002199
502 Ga0070663_100464406
503 Ga0070678_100026351
504 Ga0070662_100895123
505 Ga0070681_10004697
506 Ga0070681_10081916
507 Ga0070681_10933899
508 Ga0068867_100047885
509 Ga0070685_10045359
510 Ga0070706_101577101
511 Ga0070679_100000534
512 Ga0070679_100099895
513 Ga0070679_100186364
514 Ga0070679_100371893
515 Ga0070684_100067347
516 Ga0070684_100230043
517 Ga0068853_100065768
518 Ga0068853_100124803
519 Ga0068853_100299783
520 Ga0070686_100704068
521 Ga0070693_100045058
522 Ga0070665_100001700
523 Ga0070665_100005821
524 Ga0070665_100013728
525 Ga0070665_100027400
526 Ga0070665_100034687
527 Ga0070665_100035143
528 Ga0070665_100119071
529 Ga0070665_101590142
530 Ga0068855_100008557
531 Ga0068855_100038003
532 Ga0068855_100148657
533 Ga0068855_100157736
534 Ga0068855_100409113
535 Ga0068855_100553287
536 Ga0068855_100852110
537 Ga0068857_100084478
538 Ga0068854_100207609
539 Ga0068856_100711109
540 Ga0068859_100001039
541 Ga0068859_100043358
542 Ga0068859_101095294
543 Ga0068864_100086131
544 Ga0068864_100383800
545 Ga0068866_10040598
546 Ga0068861_100147147
547 Ga0068861_100199897
548 Ga0068861_100249002
549 Ga0068851_10109718
550 Ga0068863_100011984
551 Ga0068863_100866406
552 Ga0068863_101406145
553 Ga0068858_100000125
554 Ga0068858_100097101
555 Ga0068858_100225413
556 Ga0068858_100226293
557 Ga0068858_100469179
558 Ga0068858_100669642
559 Ga0068860_100001229
560 Ga0068860_100048414
561 Ga0068860_100124913
562 Ga0068862_100107788
563 Ga0081455_10001331
564 Ga0081455_10221898
565 Ga0081539_10000011
566 Ga0070715_10000743
567 Ga0070716_100001832
568 Ga0070712_100014338
569 Ga0075366_10504537
570 Ga0068871_100017348
571 Ga0068871_100093420
572 Ga0068871_100351307
573 Ga0097620_100001039
574 Ga0097620_100043358
575 Ga0097620_101094959
576 Ga0105250_10208750
577 Ga0105240_10000901
578 Ga0105240_10004339
579 Ga0105240_10012526
580 Ga0105240_10019698
581 Ga0105240_10038983
582 Ga0105240_10076118
583 Ga0105240_10106716
584 Ga0105240_10398577
585 Ga0105240_10423008
586 Ga0105240_10601028
587 Ga0105240_10668746
588 Ga0105245_10019136
589 Ga0105247_10000269
590 Ga0105247_10052971
591 Ga0105247_10069011
592 Ga0105247_10384870
593 Ga0105241_10155776
594 Ga0105241_10354301
595 Ga0105242_10069090
596 Ga0105242_11620979
597 Ga0105248_10017108
598 Ga0105248_10019188
599 Ga0105248_11163400
600 Ga0105237_10005523
601 Ga0105237_10064105
602 Ga0105237_10075570
603 Ga0105237_10186452
604 Ga0105237_10304106
605 Ga0105237_10351786
606 Ga0105237_11890635
607 Ga0105238_10025860
608 Ga0105238_10029724
609 Ga0105238_10056343
610 Ga0105238_10056896
611 Ga0105238_10061715
612 Ga0105238_10249130
613 Ga0105238_10274745
614 Ga0105238_10396251
615 Ga0105238_10469133
616 Ga0105238_10535395
617 Ga0105238_10947057
618 Ga0105238_12091637
619 Ga0105249_10045766
620 Ga0105249_10085285
621 Ga0105239_10029194
622 Ga0105239_10114575
623 Ga0105239_10175541
624 Ga0105246_10780514
625 Ga0157373_10067444
626 Ga0157370_10011797
627 Ga0157370_10140773
628 Ga0157369_10053275
629 Ga0157369_10087082
630 Ga0157369_10158651
631 Ga0157374_10001720
632 Ga0157378_10034468
633 Ga0163162_10006541
634 Ga0163162_10127101
635 Ga0163162_10356697
636 Ga0163162_11051332
637 Ga0157372_10189936
638 Ga0157375_10021329
639 Ga0163163_10093927
640 Ga0163163_10116062
641 Ga0163163_10221254
642 Ga0157379_10003724
643 Ga0157379_10019367
644 Ga0157379_10049284
645 Ga0157379_10068059
646 Ga0157379_10201624
647 Ga0157379_10315383
648 Ga0157379_10977233
649 Ga0206354_10668525
650 Ga0207692_11211859
651 Ga0207710_10000332
652 Ga0207710_10149894
653 Ga0207680_10003611
654 Ga0207680_10264444
655 Ga0207680_10926159
656 Ga0207685_10003203
657 Ga0207699_10113788
658 Ga0207699_10577602
659 Ga0207654_10319068
660 Ga0207654_10640368
661 Ga0207707_10004120
662 Ga0207707_10044843
663 Ga0207707_10053698
664 Ga0207707_10062507
665 Ga0207707_10416931
666 Ga0207707_10817306
667 Ga0207695_10003807
668 Ga0207695_10017428
669 Ga0207695_10027473
670 Ga0207695_10060091
671 Ga0207695_10064656
672 Ga0207695_10507551
673 Ga0207695_10518186
674 Ga0207695_10625475
675 Ga0207671_10021466
676 Ga0207671_10254205
677 Ga0207693_10000503
678 Ga0207663_10146119
679 Ga0207660_10014155
680 Ga0207660_10088530
681 Ga0207660_10662717
682 Ga0207660_10785561
683 Ga0207652_10008956
684 Ga0207652_10014963
685 Ga0207652_10336347
686 Ga0207694_10036972
687 Ga0207694_10037575
688 Ga0207694_10068621
689 Ga0207694_10096173
690 Ga0207694_10171947
691 Ga0207694_10418041
692 Ga0207650_10266307
693 Ga0207687_10398963
694 Ga0207700_10050476
695 Ga0207700_10246700
696 Ga0207664_10088426
697 Ga0207644_10051428
698 Ga0207644_10352379
699 Ga0207686_10034462
700 Ga0207704_10585769
701 Ga0207665_10001006
702 Ga0207711_10107081
703 Ga0207711_10142751
704 Ga0207711_10309552
705 Ga0207689_10408762
706 Ga0207661_10193223
707 Ga0207679_10367647
708 Ga0207667_10005460
709 Ga0207667_10035497
710 Ga0207667_10049828
711 Ga0207667_11019347
712 Ga0207651_10022944
713 Ga0207712_10068619
714 Ga0207668_10437966
715 Ga0207658_10000131
716 Ga0207658_10005547
717 Ga0207658_10056253
718 Ga0207658_10130189
719 Ga0207658_10976745
720 Ga0207677_10069051
721 Ga0207703_10000688
722 Ga0207703_10036997
723 Ga0207703_10098349
724 Ga0207703_10186469
725 Ga0207703_10379680
726 Ga0207703_12073226
727 Ga0207639_10196753
728 Ga0207639_10260326
729 Ga0207639_10364921
730 Ga0207678_10066093
731 Ga0207678_10535666
732 Ga0207702_11055768
733 Ga0207702_11184908
734 Ga0207641_10016691
735 Ga0207641_10196593
736 Ga0207641_10342743
737 Ga0207641_10745657
738 Ga0207648_10073090
739 Ga0207676_10325275
740 Ga0207676_10407097
741 Ga0207674_10218626
742 Ga0207675_100019395
743 Ga0207675_100279835
744 Ga0207683_10029833
745 Ga0268266_10001105
746 Ga0268266_10001899
747 Ga0268266_10005995
748 Ga0268266_10039819
749 Ga0268266_10045207
750 Ga0268266_10048091
751 Ga0268266_10052128
752 Ga0268265_10005733
753 Ga0268265_10413366
754 Ga0268265_11877092
755 Ga0268264_10000102
756 Ga0268264_10018433
757 Ga0268264_10288382
758 Ga0268264_10309353
759 Ga0265319_1010217
760 Ga0265334_10006488
761 Ga0265334_10056244
762 Ga0265318_10002258
763 Ga0307517_10367732
764 Ga0307515_10020160
765 Ga0265338_10051742
766 Ga0307511_10000235
767 Ga0307511_10047579
768 Ga0307511_10128980
769 Ga0265330_10003245
770 Ga0265320_10253186
771 Ga0265325_10012592
772 Ga0265329_10005106
773 Ga0265340_10084213
774 Ga0265340_10159836
775 Ga0265339_10022860
776 Ga0265331_10002017
777 Ga0265331_10005754
778 Ga0265316_10046527
779 Ga0307513_10039255
780 Ga0307509_10000987
781 Ga0307509_10150855
782 Ga0307509_10182765
783 Ga0307509_10415807
784 Ga0265313_10002313
785 Ga0265314_10003767
786 Ga0265342_10003243
787 Ga0307416_101615676
788 Ga0307507_10477581
789 Ga0307510_10079498
790 Ga0373944_0404433
791 Ga0373923_0022115
792 Ga0373936_0089990
793 Ga0373955_0474361
794 Ga0373935_0116766
795 Ga0373927_0095094
796 Ga0373947_0016225
797 Ga0373937_0118486
798 Ga0373937_0241008
799 Ga0373925_0155674
800 Ga0436363_0180686
801 Ga0436363_0215834
802 Ga0436363_0509065
803 Ga0436363_0851948
804 Ga0436363_1077091
805 Ga0451802_0533470
806 Ga0451807_1840129
807 Ga0451849_0216996
808 Ga0466969_0013487
809 Ga0466969_0028252
810 Ga0466969_0436892
811 Ga0466972_0064828
812 Ga0466966_0001231
813 Ga0466966_0003082
814 Ga0466961_0020426
815 Ga0466964_0093367
816 Ga0466971_0000391
817 Ga0466971_0148667
818 Ga0466968_0012713
819 Ga0466970_0068821
820 Ga0466970_0073999
821 Ga0466957_0015594
822 Ga0466960_0011590
823 Ga0466959_0004500
824 Ga0466959_0017148
825 Ga0466959_0159354
826 Ga0495629_0068789
827 Ga0495638_0017921
828 Ga0495580_0016396
829 Ga0495580_0171795
830 Ga0495585_0251763
831 Ga0495583_0148611
832 Ga0495606_0069919
833 Ga0495628_0125624
834 Ga0495632_0030562
835 Ga0495632_0048447
836 Ga0495648_0134096
837 Ga0495586_0434016
838 Ga0495634_0307698
839 Ga0495611_0559682
840 Ga0495625_0030286
841 Ga0495658_0196892
842 Ga0495671_0545836
843 Ga0495649_0198774
844 Ga0495581_0714553
845 Ga0495687_120189
846 Ga0495673_0320573
847 Ga0495686_0199014
848 Ga0496100_0016400
849 Ga0496101_0493752
850 Ga0496101_0656357
851 Ga0496102_0006338
852 Ga0496102_0015680
853 Ga0496102_0025058
854 Ga0496103_0434407
855 Ga0496104_0128304
856 Ga0496105_0011043
857 Ga0496105_0499724
858 Ga0496106_0008909
859 Ga0496106_0533602
860 Ga0496106_0646751
861 Ga0496107_0032088
862 Ga0496107_0447915
863 Ga0496108_0008245
864 Ga0496108_0187375
865 Ga0496109_0416592
866 Ga0496110_0013923
867 Ga0496110_0880835
868 Ga0496111_0027098
869 Ga0496112_0024436
870 Ga0496113_0108870
871 Ga0496114_0016424
872 Ga0496114_0147262
873 Ga0496115_0074927
874 Ga0496115_0238213
875 Ga0496115_1409609
876 Ga0496116_0042153
877 Ga0496117_0001307
878 Ga0496118_0000032
879 Ga0496118_0045488
880 Ga0496118_0295799
881 Ga0496119_0006461
882 Ga0496119_0008002
883 Ga0496120_0001131
884 Ga0496120_0044692
885 Ga0496120_0324269
886 Ga0496121_0000704
887 Ga0496121_0010840
888 Ga0496121_0169434
889 Ga0496121_0525243
890 Ga0496121_0648455
891 Ga0496124_0030070
892 Ga0496125_0000324
893 Ga0496125_0027043
894 Ga0496125_0032189
895 Ga0496125_0319904
896 Ga0496126_0004870
897 Ga0496126_0012178
898 Ga0496126_0367150
899 Ga0495682_0128131
900 Ga0501039_0210006
901 Ga0501083_0041196
902 nmdc:mga0k408_443101_c1
903 Ga0495612_0075244
904 Ga0495595_0239161
905 Ga0500583_0051807
906 Ga0500583_0081254
907 Ga0500583_0109457
908 Ga0500566_0487671
909 Ga0500641_0013424
910 Ga0500641_0076505
911 Ga0500648_211367
912 Ga0500660_096007
913 Ga0500556_0000313
914 Ga0500556_0033676
915 Ga0500562_154264
916 Ga0500591_010318
917 Ga0500594_0225692
918 Ga0500595_048454
919 Ga0500614_054294
920 Ga0500617_028295
921 Ga0500658_0063167
922 Ga0500559_0525772
923 Ga0500604_0028633
924 Ga0500604_0353646
925 Ga0500616_0000193
926 Ga0500616_0019201
927 Ga0500622_0011589
928 Ga0500639_108428
929 Ga0500637_0067752
930 Ga0500637_0196999
931 Ga0587079_074020
932 Ga0466962_0000261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02590

SPOUT_MTase

Predicted SPOUT methyltransferase

1

174

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ns5-assembly1.cif.gz_A x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 0.9556 1 154
1ns5-assembly1.cif.gz_A x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45 0.9496 1 154
5twj-assembly2.cif.gz_A crystal structure of rlmh in complex with s-adenosylmethionine 0.9426 2 156
1vh0-assembly9.cif.gz_D crystal structure of a hypothetical protein 0.9283 1 153
1to0-assembly4.cif.gz_G x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9269 1 153
ID Description Score Start End Superfamily
1ns5A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9507 3 154 3.40.1280.10
1ns5A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9385 3 154 3.40.1280.10
1to0F00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9185 3 149 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9034 1 155 3.40.1280.10
1to0F00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8995 3 149 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A4Q6GTN7-F1-model_v4 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH 0.9831 1 111 GO:0006364
GO:0008168
GO:0032259
AF-Q31IE1-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9757 1 156 GO:0005737
GO:0070038
AF-A0A5C7JE22-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9756 1 156 GO:0005737
GO:0070038
AF-A0A7W8HHK5-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9715 1 156 GO:0005737
GO:0070038
AF-A0A1H8CDR0-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.9707 1 156 GO:0005737
GO:0070038

Map