F449541

General Info

Members Datasets Scaffolds Average Seq Length
465 335 322 360

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0000328|Ga0495648_0000328_15550_16827
Length 425
Sequence VISRLEQISAYNATTLCGAARILGIFIQPDRNATMSNPPVSDQRAVPCILMRGGTSRGPFFLESDLPADAAARNQLLLAAMGSPDPRQIDGLGGAHPLTSKVGIVRRSTTPGVDLDFSFAQLQPDNDTVDVTPNCGNMLAAVLPFALERGLLPVAQGTTTARILTLNTGMQCDVTLQTPNGRLQYGGDARIDGVPGTASPISINFLDTVGSVCPALLPTGAPLNRIAVTATSRHAAQTADVGTGVAPIVSVEAFEVDATLIDNGMPMVLVRASDFGVTGYEPAAELTASAELRARLEALRLAAGPLMGLGDVAAKNYPKMCLISAPRDGGAVNTRCFIPHVCHDSIGVLAAVTVATACVLPGSLAEGIAATQPGARQTLSIEHPTGEFSVELELDPNNPGQVLRAALLRTARPIMRGEVLIPAHL

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
5 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
6 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
7 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
8 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
9 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
10 2516143018 Ensifer sp. BR816 Isolate Nodule
11 2547132374 Acidovorax radicis N35 Isolate Unclassified
12 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
13 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
14 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
15 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
16 2643221570 Acidovorax sp. Root568 Isolate Unclassified
17 2643221609 Acidovorax sp. Root217 Isolate Unclassified
18 2643221611 Acidovorax sp. Root219 Isolate Unclassified
19 2643221652 Acidovorax sp. Root402 Isolate Unclassified
20 2643221717 Acidovorax sp. Root267 Isolate Unclassified
21 2643221723 Ensifer sp. Root278 Isolate Unclassified
22 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
23 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
24 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
25 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
26 2734482264 Dyella sp. AD052 Isolate Unclassified
27 2738541297 Duganella sp. GV083 Isolate Unclassified
28 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
29 2738541357 Duganella sp. GV053 Isolate Unclassified
30 2738543003 Duganella sp. GV066 Isolate Unclassified
31 2738543009 Luteibacter sp. OK325 Isolate Unclassified
32 2738543012 Acidovorax sp. CF301 Isolate Unclassified
33 2738543026 Duganella sp. GV089 Isolate Unclassified
34 2738543029 Duganella sp. GV039 Isolate Unclassified
35 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
36 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
37 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
38 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
39 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
40 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
41 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
42 2791355265 Rhizobium sp. H4 Isolate Nodule
43 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
44 2802429634 Rhizobium anhuiense S10 Isolate Nodule
45 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
46 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
47 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
48 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
49 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
50 2816332133 Acidovorax radicis 2721A Isolate Unclassified
51 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
52 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
53 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
54 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
55 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
56 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
57 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
58 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
59 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
60 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
61 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
62 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
63 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
64 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
65 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
66 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
67 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
68 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
69 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
70 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
71 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
72 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
73 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
74 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
75 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
76 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
77 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
78 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
79 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
80 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
81 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
82 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
83 2857564685 Duganella sp. R-74599 Isolate Unclassified
84 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
85 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
86 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
87 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
88 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
89 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
90 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
91 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
92 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
93 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
94 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
95 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
96 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
97 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
98 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
99 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
100 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
101 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
102 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
103 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
104 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
105 2919085039 Luteibacter sp. 1214 Isolate Unclassified
106 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
107 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
108 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
109 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
110 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
111 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
112 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
113 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
114 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
115 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
116 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
117 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
118 2941471342 Luteibacter sp. 621 Isolate Unclassified
119 2952252522 Salinicola sp. DM10 Isolate Unclassified
120 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
121 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
122 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
123 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
124 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
125 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
126 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
127 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
128 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
129 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
130 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
131 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
132 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
133 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
134 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
135 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
136 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
137 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
138 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
139 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
140 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
141 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
142 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
143 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
144 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
145 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
146 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
147 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
148 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
149 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
150 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
151 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
152 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
153 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
154 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
155 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
156 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
157 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
158 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
159 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
160 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
161 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
162 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
163 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
164 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
165 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
166 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
167 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
168 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
169 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
170 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
174 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
175 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
176 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
177 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
178 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
179 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
180 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
181 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
182 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
183 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
184 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
185 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
186 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
188 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
190 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
191 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
199 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
202 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
225 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
226 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
227 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
228 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
229 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
230 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
231 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
236 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
250 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
272 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
273 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
274 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
287 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
292 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
310 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
311 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
312 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
313 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
314 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
315 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
316 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
317 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
321 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
322 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
323 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
324 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
325 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
326 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
327 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
328 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
329 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
330 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
331 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
332 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
333 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
334 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
335 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.25
Metatranscriptomes 0
Isolates 30.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.99
Nodule 14.19
Rhizoplane 1.29
Rhizosphere 43.01
Stem 0
Stem Tuber 0
Unclassified 24.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001307 3300001904 Bacteria 4567
2 JGI24740J21852_10000002 3300001979 Bacteria 158865
3 JGI24735J21928_10025980 3300002067 Bacteria 1764
4 JGI25162J39368_1000144 3300002737 Bacteria 77232
5 JGI25152J39213_1006505 3300002773 Bacteria 3167
6 JGI25150J39212_1002431 3300002774 Bacteria 4647
7 JGI25159J45721_1001625 3300002987 Bacteria 9143
8 JGI25151J46595_10000162 3300003187 Bacteria 86356
9 JGI25151J46595_10001390 3300003187 Bacteria 16685
10 JGI25151J46595_10002227 3300003187 Bacteria 11972
11 JGI25151J46595_10015023 3300003187 Bacteria 3432
12 JGI25406J46586_10005302 3300003203 Bacteria 5981
13 JGI25165J46597_1000075 3300003214 Bacteria 181212
14 JGI25153J46596_10007943 3300003215 Bacteria 5140
15 JGI25153J46596_10011794 3300003215 Bacteria 3835
16 rootH2_10009642 3300003320 Bacteria 34527
17 rootH2_10080170 3300003320 Bacteria 5981
18 rootL2_10018242 3300003322 Bacteria 15247
19 rootL2_10138337 3300003322 Bacteria 4657
20 rootH1_10159869 3300003323 Bacteria 6051
21 JGI25160J50197_1002208 3300003354 Bacteria 9143
22 JGI25161J50226_1001090 3300003374 Bacteria 9143
23 Ga0055542_1000797 3300003762 Bacteria 23317
24 Ga0055526_1000029 3300003771 Bacteria 148855
25 Ga0055526_1003147 3300003771 Bacteria 10689
26 Ga0055536_1005210 3300003781 Bacteria 6417
27 Ga0055536_1008430 3300003781 Bacteria 4426
28 Ga0055540_1014280 3300003792 Bacteria 2372
29 Ga0055531_10004242 3300003794 Bacteria 8818
30 Ga0055543_1000310 3300004625 Bacteria 33955
31 Ga0055543_1000822 3300004625 Bacteria 15203
32 Ga0065165_1001819 3300005262 Bacteria 20888
33 Ga0065165_1002081 3300005262 Bacteria 18368
34 Ga0065165_1004196 3300005262 Bacteria 9181
35 Ga0065707_10001627 3300005295 Bacteria 6301
36 Ga0070666_10000003 3300005335 Bacteria 463666
37 Ga0070661_100012005 3300005344 Bacteria 6053
38 Ga0070665_100043702 3300005548 Bacteria 4501
39 Ga0068855_100016956 3300005563 Bacteria 8760
40 Ga0068857_100019220 3300005577 Bacteria 5998
41 Ga0068854_100036656 3300005578 Bacteria 3439
42 Ga0068856_100080384 3300005614 Bacteria 3233
43 Ga0068858_100059154 3300005842 Bacteria 3542
44 Ga0081539_10000076 3300005985 Bacteria 229037
45 Ga0075364_10008309 3300006051 Bacteria 6199
46 Ga0075367_10026005 3300006178 Bacteria 3315
47 Ga0075369_10041403 3300006186 Bacteria 1972
48 Ga0105250_10000186 3300009092 Bacteria 53643
49 Ga0105240_10000236 3300009093 Bacteria 110204
50 Ga0105247_10044682 3300009101 Bacteria 2717
51 Ga0105237_10003670 3300009545 Bacteria 18091
52 Ga0105238_10004877 3300009551 Bacteria 13269
53 Ga0123341_1008686 3300009765 Bacteria 9285
54 Ga0105239_10000110 3300010375 Bacteria 115508
55 Ga0157370_10000858 3300013104 Bacteria 38572
56 Ga0157369_10001146 3300013105 Bacteria 33054
57 Ga0171463_1009 3300013249 Bacteria 288284
58 Ga0163162_10000378 3300013306 Bacteria 40518
59 Ga0182008_10048928 3300014497 Bacteria 2099
60 Ga0157379_10000207 3300014968 Bacteria 45489
61 Ga0182006_1000061 3300015261 Bacteria 156823
62 Ga0182006_1000802 3300015261 Bacteria 21095
63 Ga0182007_10027827 3300015262 Bacteria 1946
64 Ga0182005_1000036 3300015265 Bacteria 166586
65 Ga0183363_1251 3300015690 Bacteria 8986
66 Ga0214544_1007618 3300021320 Bacteria 18826
67 Ga0214542_1000014 3300021321 Bacteria 233825
68 Ga0214542_1028231 3300021321 Bacteria 2454
69 Ga0214543_1000003 3300021327 Bacteria 692327
70 Ga0214543_1000056 3300021327 Bacteria 134292
71 Ga0213872_10000547 3300021361 Bacteria 29250
72 Ga0209436_101175 3300025208 Bacteria 9633
73 Ga0209437_100131 3300025233 Bacteria 181264
74 Ga0207425_1001139 3300025245 Bacteria 11971
75 Ga0207425_1016755 3300025245 Bacteria 1622
76 Ga0209148_1000302 3300025254 Bacteria 70861
77 Ga0209148_1006061 3300025254 Bacteria 2666
78 Ga0209129_1001890 3300025258 Bacteria 11066
79 Ga0209129_1002589 3300025258 Bacteria 8672
80 Ga0209129_1002913 3300025258 Bacteria 7853
81 Ga0209233_1000132 3300025261 Bacteria 203971
82 Ga0209455_1000284 3300025272 Bacteria 54580
83 Ga0209673_1000022 3300025273 Bacteria 413125
84 Ga0209673_1000621 3300025273 Bacteria 54117
85 Ga0209130_1000234 3300025284 Bacteria 71914
86 Ga0209675_1016062 3300025291 Bacteria 2195
87 Ga0209676_1001969 3300025292 Bacteria 16369
88 Ga0209025_1000146 3300025294 Bacteria 180022
89 Ga0209025_1000418 3300025294 Bacteria 85091
90 Ga0209025_1001085 3300025294 Bacteria 39382
91 Ga0209025_1004748 3300025294 Bacteria 11560
92 Ga0209025_1053444 3300025294 Bacteria 1584
93 Ga0209564_1000009 3300025295 Bacteria 950196
94 Ga0209564_1000117 3300025295 Bacteria 207096
95 Ga0209564_1001607 3300025295 Bacteria 21963
96 Ga0209564_1003761 3300025295 Bacteria 9903
97 Ga0209758_1000603 3300025297 Bacteria 55707
98 Ga0209758_1000614 3300025297 Bacteria 55061
99 Ga0209758_1012086 3300025297 Bacteria 4888
100 Ga0209050_1006671 3300025298 Bacteria 6756
101 Ga0209256_1000565 3300025299 Bacteria 52844
102 Ga0209256_1000622 3300025299 Bacteria 48813
103 Ga0207426_1000299 3300025302 Bacteria 97846
104 Ga0207426_1000410 3300025302 Bacteria 71914
105 Ga0207426_1005203 3300025302 Bacteria 6040
106 Ga0209051_1003919 3300025303 Bacteria 9487
107 Ga0209051_1014268 3300025303 Bacteria 3718
108 Ga0209051_1015011 3300025303 Bacteria 3586
109 Ga0209257_1002072 3300025304 Bacteria 21152
110 Ga0209257_1008072 3300025304 Bacteria 6128
111 Ga0207696_1000072 3300025711 Bacteria 224214
112 Ga0207680_10000006 3300025903 Bacteria 635950
113 Ga0207647_10000237 3300025904 Bacteria 45127
114 Ga0207705_10316817 3300025909 Bacteria 1198
115 Ga0207695_10000207 3300025913 Bacteria 160390
116 Ga0207695_10001342 3300025913 Bacteria 41747
117 Ga0207671_10134248 3300025914 Bacteria 1902
118 Ga0207694_10004641 3300025924 Bacteria 10694
119 Ga0207667_10009983 3300025949 Bacteria 11135
120 Ga0207703_10134084 3300026035 Bacteria 2142
121 Ga0207702_10060630 3300026078 Bacteria 3225
122 Ga0209371_1000821 3300027312 Bacteria 25570
123 Ga0268266_10000021 3300028379 Bacteria 522453
124 Ga0268256_1000474 3300030500 Bacteria 34547
125 Ga0307408_100061180 3300031548 Bacteria 2748
126 Ga0307408_100314102 3300031548 Bacteria 1318
127 Ga0307412_10000680 3300031911 Bacteria 19712
128 Ga0307510_10008270 3300033180 Bacteria 12399
129 Ga0395905_0086103 3300037471 Bacteria 2945
130 Ga0436361_0527730 3300039447 Bacteria 33218
131 Ga0439436_0038647 3300041404 Bacteria 1372
132 Ga0439465_0007071 3300041413 Bacteria 3566
133 Ga0451835_0842717 3300041492 Bacteria 7578
134 Ga0451837_1735123 3300041494 Bacteria 6003
135 Ga0451839_0809352 3300041496 Bacteria 6794
136 Ga0451841_0076186 3300041498 Bacteria 14121
137 Ga0451845_0279688 3300041501 Bacteria 5115
138 Ga0451847_0353095 3300041503 Bacteria 6606
139 Ga0451849_0356336 3300041505 Bacteria 6650
140 Ga0451851_0671713 3300041507 Bacteria 6075
141 Ga0451843_1145762 3300041509 Bacteria 6496
142 Ga0451855_1072631 3300041511 Bacteria 4476
143 Ga0451853_1661544 3300041512 Bacteria 4200
144 Ga0450908_000040 3300042184 Bacteria 25605
145 Ga0466982_0000162 3300044672 Bacteria 16814
146 Ga0466965_0027638 3300044683 Bacteria 2755
147 Ga0495617_000003 3300046452 Bacteria 541914
148 Ga0495617_000114 3300046452 Bacteria 56455
149 Ga0495617_000412 3300046452 Bacteria 23404
150 Ga0495590_0015416 3300046457 Bacteria 2775
151 Ga0495638_0000148 3300046460 Bacteria 110710
152 Ga0495638_0013155 3300046460 Bacteria 5646
153 Ga0495653_0000002 3300046463 Bacteria 507262
154 Ga0495650_0000457 3300046471 Bacteria 63668
155 Ga0495650_0000564 3300046471 Bacteria 52182
156 Ga0495650_0000653 3300046471 Bacteria 45690
157 Ga0495650_0001488 3300046471 Bacteria 22356
158 Ga0495605_0000068 3300046474 Bacteria 137743
159 Ga0495585_0000063 3300046492 Bacteria 109530
160 Ga0495585_0003226 3300046492 Bacteria 11126
161 Ga0495585_0003309 3300046492 Bacteria 10940
162 Ga0495596_0026988 3300046500 Bacteria 2312
163 Ga0495607_0000029 3300046501 Bacteria 155005
164 Ga0495607_0000100 3300046501 Bacteria 91570
165 Ga0495607_0010394 3300046501 Bacteria 6259
166 Ga0495583_0000160 3300046506 Bacteria 113560
167 Ga0495606_0000001 3300046507 Bacteria 592123
168 Ga0495606_0000351 3300046507 Bacteria 78808
169 Ga0495606_0000427 3300046507 Bacteria 70054
170 Ga0495606_0009348 3300046507 Bacteria 8307
171 Ga0495606_0136142 3300046507 Bacteria 1454
172 Ga0495610_0000003 3300046512 Bacteria 1203910
173 Ga0495610_0005195 3300046512 Bacteria 9323
174 Ga0495610_0006502 3300046512 Bacteria 8025
175 Ga0495616_0000183 3300046513 Bacteria 53040
176 Ga0495616_0071680 3300046513 Bacteria 1674
177 Ga0495620_0000090 3300046515 Bacteria 73605
178 Ga0495620_0012505 3300046515 Bacteria 4379
179 Ga0495631_0000055 3300046518 Bacteria 69950
180 Ga0495631_0000458 3300046518 Bacteria 27678
181 Ga0495631_0003605 3300046518 Bacteria 8447
182 Ga0495632_0004019 3300046519 Bacteria 10164
183 Ga0495632_0005237 3300046519 Bacteria 8630
184 Ga0495632_0021572 3300046519 Bacteria 3469
185 Ga0495643_0072622 3300046522 Bacteria 1804
186 Ga0495644_0025930 3300046523 Bacteria 2224
187 Ga0495648_0000324 3300046524 Bacteria 53060
188 Ga0495648_0000328 3300046524 Bacteria 52422
189 Ga0495648_0005227 3300046524 Bacteria 10854
190 Ga0495648_0019556 3300046524 Bacteria 4758
191 Ga0495642_0057561 3300046528 Bacteria 1607
192 Ga0495654_0013276 3300046530 Bacteria 4412
193 Ga0495609_0015702 3300046538 Bacteria 3540
194 Ga0495597_0001231 3300046542 Bacteria 19066
195 Ga0495597_0112907 3300046542 Bacteria 1138
196 Ga0495633_0029457 3300046558 Bacteria 2671
197 Ga0495668_0000095 3300046616 Bacteria 141321
198 Ga0495668_0000437 3300046616 Bacteria 53630
199 Ga0495668_0014476 3300046616 Bacteria 4623
200 Ga0495668_0114183 3300046616 Bacteria 1477
201 Ga0495611_0000003 3300046648 Bacteria 395679
202 Ga0495611_0000018 3300046648 Bacteria 126654
203 Ga0495611_0039521 3300046648 Bacteria 2100
204 Ga0495625_0000019 3300046660 Bacteria 298330
205 Ga0495625_0007982 3300046660 Bacteria 9095
206 Ga0495625_0021457 3300046660 Bacteria 4975
207 Ga0495625_0037328 3300046660 Bacteria 3565
208 Ga0495625_0052768 3300046660 Bacteria 2910
209 Ga0495625_0096971 3300046660 Bacteria 2030
210 Ga0495661_0001253 3300046665 Bacteria 21924
211 Ga0495661_0023855 3300046665 Bacteria 3965
212 Ga0495661_0025609 3300046665 Bacteria 3809
213 Ga0495670_0003618 3300046691 Bacteria 7591
214 Ga0495670_0094988 3300046691 Bacteria 1529
215 Ga0495671_0000010 3300046692 Bacteria 368641
216 Ga0495671_0000611 3300046692 Bacteria 26141
217 Ga0495671_0011248 3300046692 Bacteria 4934
218 Ga0495649_0000715 3300046694 Bacteria 27013
219 Ga0495649_0006019 3300046694 Bacteria 7593
220 Ga0495649_0030153 3300046694 Bacteria 2996
221 Ga0495589_0000018 3300046794 Bacteria 204851
222 Ga0495589_0060422 3300046794 Bacteria 1861
223 Ga0495660_0000164 3300046810 Bacteria 71324
224 Ga0495660_0000223 3300046810 Bacteria 56336
225 Ga0495683_0001383 3300047323 Bacteria 16072
226 Ga0495677_0006096 3300047445 Bacteria 4558
227 Ga0495677_0022598 3300047445 Bacteria 2281
228 Ga0495679_000017 3300047446 Bacteria 263230
229 Ga0495679_023404 3300047446 Bacteria 2095
230 Ga0495673_0000003 3300047469 Bacteria 1491337
231 Ga0495673_0000004 3300047469 Bacteria 1354526
232 Ga0495673_0000016 3300047469 Bacteria 580643
233 Ga0495673_0000133 3300047469 Bacteria 137275
234 Ga0495673_0000318 3300047469 Bacteria 62287
235 Ga0495686_0000033 3300047472 Bacteria 342031
236 Ga0495686_0007793 3300047472 Bacteria 7968
237 Ga0495686_0009430 3300047472 Bacteria 7031
238 Ga0495686_0027170 3300047472 Bacteria 3738
239 Ga0495686_0028491 3300047472 Bacteria 3637
240 Ga0495626_0007741 3300048091 Bacteria 5953
241 Ga0495626_0009104 3300048091 Bacteria 5386
242 Ga0495626_0009717 3300048091 Bacteria 5183
243 Ga0495626_0023942 3300048091 Bacteria 2999
244 Ga0495626_0038465 3300048091 Bacteria 2268
245 Ga0496102_0048907 3300048905 Bacteria 3846
246 Ga0496104_0107254 3300048907 Bacteria 2676
247 Ga0496105_0000587 3300048908 Bacteria 24213
248 Ga0496107_0072073 3300048910 Bacteria 2511
249 Ga0496117_0019850 3300048920 Bacteria 5502
250 Ga0496117_0021293 3300048920 Bacteria 5251
251 Ga0496117_0111165 3300048920 Bacteria 1706
252 Ga0496118_0000865 3300048921 Bacteria 47971
253 Ga0496118_0006417 3300048921 Bacteria 12929
254 Ga0496118_0007263 3300048921 Bacteria 11811
255 Ga0496119_0000029 3300048922 Bacteria 243194
256 Ga0496119_0013661 3300048922 Bacteria 6443
257 Ga0496120_0000039 3300048923 Bacteria 202237
258 Ga0496121_0000109 3300048924 Bacteria 187307
259 Ga0496121_0000408 3300048924 Bacteria 85494
260 Ga0496121_0000633 3300048924 Bacteria 65667
261 Ga0496121_0000922 3300048924 Bacteria 53157
262 Ga0496121_0029177 3300048924 Bacteria 5111
263 Ga0496121_0036240 3300048924 Bacteria 4399
264 Ga0496121_0077179 3300048924 Bacteria 2653
265 Ga0496121_0158870 3300048924 Bacteria 1655
266 Ga0496121_0279235 3300048924 Bacteria 1143
267 Ga0496122_0010820 3300048925 Bacteria 9344
268 Ga0496122_0013752 3300048925 Bacteria 7891
269 Ga0496122_0016368 3300048925 Bacteria 7021
270 Ga0496122_0043065 3300048925 Bacteria 3542
271 Ga0496122_0159425 3300048925 Bacteria 1378
272 Ga0496123_0003670 3300048926 Bacteria 16942
273 Ga0496123_0028107 3300048926 Bacteria 4171
274 Ga0496123_0067543 3300048926 Bacteria 2257
275 Ga0496123_0080283 3300048926 Bacteria 1989
276 Ga0496123_0102124 3300048926 Bacteria 1665
277 Ga0496124_0004873 3300048927 Bacteria 15435
278 Ga0496125_0000093 3300048928 Bacteria 210896
279 Ga0496125_0000376 3300048928 Bacteria 83515
280 Ga0496125_0013631 3300048928 Bacteria 7981
281 Ga0496125_0088219 3300048928 Bacteria 2339
282 Ga0496125_0143355 3300048928 Bacteria 1657
283 Ga0496126_0004543 3300048929 Bacteria 16500
284 Ga0496126_0013643 3300048929 Bacteria 8248
285 Ga0496126_0027549 3300048929 Bacteria 5426
286 Ga0496126_0031219 3300048929 Bacteria 5037
287 Ga0495678_000152 3300049459 Bacteria 83891
288 Ga0495682_0001052 3300049460 Bacteria 16275
289 Ga0501038_0013297 3300049574 Bacteria 7505
290 Ga0501039_0091631 3300049575 Bacteria 2369
291 Ga0501040_0010626 3300049576 Bacteria 6020
292 Ga0501041_0004798 3300049577 Bacteria 7855
293 Ga0501041_0020846 3300049577 Bacteria 3923
294 Ga0501042_0040398 3300049578 Bacteria 3316
295 Ga0501048_0022502 3300049582 Bacteria 4609
296 Ga0501069_0044185 3300049585 Bacteria 2467
297 Ga0501070_0067011 3300049586 Bacteria 2973
298 Ga0501071_0008075 3300049587 Bacteria 6942
299 Ga0501072_0000859 3300049588 Bacteria 22302
300 Ga0501075_0005752 3300049591 Bacteria 8482
301 Ga0501075_0018233 3300049591 Bacteria 5076
302 Ga0501076_0023698 3300049592 Bacteria 4734
303 Ga0501077_0079815 3300049593 Bacteria 2073
304 Ga0501077_0122569 3300049593 Bacteria 1648
305 Ga0501079_0009427 3300049741 Bacteria 7399
306 Ga0501045_0004967 3300049824 Bacteria 9217
307 Ga0501045_0057165 3300049824 Bacteria 2854
308 nmdc:mga00v17_19841_c1 3300050491 Bacteria 3844
309 Ga0500643_000029 3300053087 Bacteria 211149
310 Ga0500555_000768 3300053103 Bacteria 11792
311 Ga0500572_001181 3300053111 Bacteria 7473
312 Ga0500593_000250 3300053117 Bacteria 22072
313 Ga0500618_015224 3300053125 Bacteria 1947
314 Ga0500618_015703 3300053125 Bacteria 1908
315 Ga0500618_022006 3300053125 Bacteria 1552
316 Ga0500568_0000221 3300053139 Bacteria 48978
317 Ga0500633_0000751 3300053160 Bacteria 5530
318 Ga0500636_0001339 3300053177 Bacteria 13366
319 Ga0500645_000287 3300053730 Bacteria 36290
320 Ga0501084_0016268 3300054114 Bacteria 6176
321 Ga0501084_0089176 3300054114 Bacteria 2589
322 Ga0530510_0022225 3300061734 Bacteria 4517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0080283 Ga0496123_0080283_502_1410 300
2 3300003322 rootL2_10138337 rootL2_101383371 304
3 3300046522 Ga0495643_0072622 Ga0495643_0072622_489_1601 311
4 3300046542 Ga0495597_0112907 Ga0495597_0112907_124_1119 319
5 iso_pu_bacteria 2738541297 2738829761 321
6 iso_pu_bacteria 2738541357 2739153557 321
7 iso_pu_bacteria 2738543003 2739195477 321
8 iso_pu_bacteria 2738543026 2739321953 321
9 iso_pu_bacteria 2738543029 2739340194 321
10 3300003771 Ga0055526_1000029 Ga0055526_100002979 325
11 3300025295 Ga0209564_1000009 Ga0209564_100000954 325
12 3300046463 Ga0495653_0000002 Ga0495653_0000002_299959_301080 329
13 3300046558 Ga0495633_0029457 Ga0495633_0029457_106_1215 333
14 3300006186 Ga0075369_10041403 Ga0075369_100414032 334
15 3300046507 Ga0495606_0000001 Ga0495606_0000001_145752_146930 335
16 3300046616 Ga0495668_0000095 Ga0495668_0000095_4841_6019 335
17 3300005295 Ga0065707_10001627 Ga0065707_100016273 336
18 3300009092 Ga0105250_10000186 Ga0105250_1000018610 336
19 3300014968 Ga0157379_10000207 Ga0157379_1000020736 336
20 3300025711 Ga0207696_1000072 Ga0207696_1000072202 336
21 3300046512 Ga0495610_0006502 Ga0495610_0006502_5451_6776 338
22 3300048925 Ga0496122_0016368 Ga0496122_0016368_535_1692 338
23 3300048926 Ga0496123_0067543 Ga0496123_0067543_502_1659 338
24 3300047472 Ga0495686_0027170 Ga0495686_0027170_694_2019 341
25 iso_pu_bacteria 2899275550 2899278526 342
26 iso_pu_bacteria 2917699015 2917704944 344
27 3300047469 Ga0495673_0000003 Ga0495673_0000003_1118980_1120038 345
28 3300048929 Ga0496126_0013643 Ga0496126_0013643_734_1792 345
29 3300049575 Ga0501039_0091631 Ga0501039_0091631_1090_2151 345
30 3300049576 Ga0501040_0010626 Ga0501040_0010626_998_2059 345
31 3300049577 Ga0501041_0020846 Ga0501041_0020846_1979_3040 345
32 3300049587 Ga0501071_0008075 Ga0501071_0008075_91_1152 345
33 3300049591 Ga0501075_0005752 Ga0501075_0005752_1132_2193 345
34 3300049593 Ga0501077_0122569 Ga0501077_0122569_296_1357 345
35 3300049824 Ga0501045_0057165 Ga0501045_0057165_1573_2634 345
36 3300046542 Ga0495597_0001231 Ga0495597_0001231_17435_18499 346
37 3300046471 Ga0495650_0000457 Ga0495650_0000457_52543_53613 347
38 3300046492 Ga0495585_0003309 Ga0495585_0003309_608_1678 347
39 3300046512 Ga0495610_0000003 Ga0495610_0000003_806064_807134 347
40 3300046524 Ga0495648_0005227 Ga0495648_0005227_715_1785 347
41 3300046530 Ga0495654_0013276 Ga0495654_0013276_113_1183 347
42 3300046616 Ga0495668_0000437 Ga0495668_0000437_628_1698 347
43 3300046660 Ga0495625_0021457 Ga0495625_0021457_335_1408 347
44 3300046660 Ga0495625_0052768 Ga0495625_0052768_1416_2489 347
45 3300046660 Ga0495625_0096971 Ga0495625_0096971_440_1510 347
46 3300046692 Ga0495671_0000010 Ga0495671_0000010_49224_50357 347
47 3300046692 Ga0495671_0011248 Ga0495671_0011248_116_1186 347
48 3300046694 Ga0495649_0006019 Ga0495649_0006019_429_1502 347
49 iso_pu_bacteria 2718218334 2721025881 347
50 iso_pu_bacteria 2904479285 2904479825 347
51 3300053111 Ga0500572_001181 Ga0500572_001181_4399_5448 348
52 iso_pu_bacteria 2884338543 2884339218 348
53 3300003187 JGI25151J46595_10000162 JGI25151J46595_1000016251 349
54 3300025294 Ga0209025_1000146 Ga0209025_100014631 349
55 3300025297 Ga0209758_1000614 Ga0209758_100061420 349
56 3300046694 Ga0495649_0000715 Ga0495649_0000715_25287_26372 349
57 3300048091 Ga0495626_0007741 Ga0495626_0007741_804_1889 349
58 3300053139 Ga0500568_0000221 Ga0500568_0000221_20231_21316 349
59 iso_pu_bacteria 2857564685 2857567036 349
60 iso_pu_bacteria 2643221609 2644058160 350
61 iso_pu_bacteria 2643221611 2644073200 350
62 iso_pu_bacteria 2657244999 2657685964 350
63 iso_pu_bacteria 2738543012 2739244493 350
64 iso_pu_bacteria 2802429268 2804755453 350
65 iso_pu_bacteria 2816332133 2816469936 350
66 iso_pu_bacteria 2854681122 2854683223 350
67 3300002067 JGI24735J21928_10025980 JGI24735J21928_100259802 351
68 3300005335 Ga0070666_10000003 Ga0070666_10000003237 351
69 3300005842 Ga0068858_100059154 Ga0068858_1000591542 351
70 3300013306 Ga0163162_10000378 Ga0163162_1000037830 351
71 3300014497 Ga0182008_10048928 Ga0182008_100489282 351
72 3300015261 Ga0182006_1000061 Ga0182006_1000061119 351
73 3300015262 Ga0182007_10027827 Ga0182007_100278272 351
74 3300025303 Ga0209051_1015011 Ga0209051_10150112 351
75 3300026035 Ga0207703_10134084 Ga0207703_101340842 351
76 3300046452 Ga0495617_000412 Ga0495617_000412_16164_17219 351
77 3300046457 Ga0495590_0015416 Ga0495590_0015416_1313_2368 351
78 3300046460 Ga0495638_0000148 Ga0495638_0000148_84679_85734 351
79 3300046460 Ga0495638_0013155 Ga0495638_0013155_1178_2233 351
80 3300046501 Ga0495607_0000029 Ga0495607_0000029_102872_103927 351
81 3300046501 Ga0495607_0000100 Ga0495607_0000100_38129_39184 351
82 3300046507 Ga0495606_0000351 Ga0495606_0000351_25680_26735 351
83 3300046507 Ga0495606_0136142 Ga0495606_0136142_335_1390 351
84 3300046513 Ga0495616_0071680 Ga0495616_0071680_557_1612 351
85 3300046515 Ga0495620_0012505 Ga0495620_0012505_881_1936 351
86 3300046518 Ga0495631_0000055 Ga0495631_0000055_19679_20734 351
87 3300046519 Ga0495632_0005237 Ga0495632_0005237_819_1874 351
88 3300046524 Ga0495648_0000324 Ga0495648_0000324_17417_18472 351
89 3300046524 Ga0495648_0019556 Ga0495648_0019556_71_1126 351
90 3300046538 Ga0495609_0015702 Ga0495609_0015702_2112_3167 351
91 3300046616 Ga0495668_0014476 Ga0495668_0014476_577_1632 351
92 3300046616 Ga0495668_0114183 Ga0495668_0114183_409_1464 351
93 3300046648 Ga0495611_0000003 Ga0495611_0000003_140729_141784 351
94 3300046648 Ga0495611_0000018 Ga0495611_0000018_106309_107364 351
95 3300046660 Ga0495625_0000019 Ga0495625_0000019_164866_165921 351
96 3300046660 Ga0495625_0007982 Ga0495625_0007982_3535_4590 351
97 3300046660 Ga0495625_0037328 Ga0495625_0037328_1054_2109 351
98 3300046665 Ga0495661_0025609 Ga0495661_0025609_635_1690 351
99 3300046691 Ga0495670_0003618 Ga0495670_0003618_4673_5728 351
100 3300046692 Ga0495671_0000611 Ga0495671_0000611_13905_14960 351
101 3300046794 Ga0495589_0000018 Ga0495589_0000018_94408_95463 351
102 3300046810 Ga0495660_0000164 Ga0495660_0000164_52394_53449 351
103 3300046810 Ga0495660_0000223 Ga0495660_0000223_54793_55848 351
104 3300047446 Ga0495679_000017 Ga0495679_000017_121429_122484 351
105 3300047469 Ga0495673_0000004 Ga0495673_0000004_822984_824039 351
106 3300047469 Ga0495673_0000133 Ga0495673_0000133_15483_16538 351
107 3300047469 Ga0495673_0000318 Ga0495673_0000318_43893_44948 351
108 3300047472 Ga0495686_0007793 Ga0495686_0007793_3705_4760 351
109 3300047472 Ga0495686_0028491 Ga0495686_0028491_2132_3187 351
110 3300048924 Ga0496121_0000633 Ga0496121_0000633_10919_11974 351
111 3300048924 Ga0496121_0036240 Ga0496121_0036240_2731_3786 351
112 3300048924 Ga0496121_0158870 Ga0496121_0158870_175_1230 351
113 3300048924 Ga0496121_0279235 Ga0496121_0279235_24_1079 351
114 3300048928 Ga0496125_0143355 Ga0496125_0143355_79_1134 351
115 3300048929 Ga0496126_0027549 Ga0496126_0027549_111_1166 351
116 3300049459 Ga0495678_000152 Ga0495678_000152_82213_83268 351
117 3300049460 Ga0495682_0001052 Ga0495682_0001052_10589_11644 351
118 3300053087 Ga0500643_000029 Ga0500643_000029_141185_142240 351
119 3300053103 Ga0500555_000768 Ga0500555_000768_5845_6900 351
120 3300053160 Ga0500633_0000751 Ga0500633_0000751_3292_4347 351
121 iso_pu_bacteria 2547132374 2548500518 351
122 iso_pu_bacteria 2643221570 2643864469 351
123 iso_pu_bacteria 2643221652 2644291841 351
124 iso_pu_bacteria 2643221717 2644646933 351
125 iso_pu_bacteria 2990710928 2990715055 351
126 iso_pu_bacteria 8057160832 8057163693 351
127 3300044683 Ga0466965_0027638 Ga0466965_0027638_54_1193 352
128 3300046471 Ga0495650_0000653 Ga0495650_0000653_6177_7364 352
129 3300046474 Ga0495605_0000068 Ga0495605_0000068_78644_79756 352
130 3300047472 Ga0495686_0000033 Ga0495686_0000033_319380_320438 352
131 3300048921 Ga0496118_0000865 Ga0496118_0000865_12404_13462 352
132 3300054114 Ga0501084_0089176 Ga0501084_0089176_989_2083 353
133 3300046452 Ga0495617_000003 Ga0495617_000003_113997_115211 354
134 3300046507 Ga0495606_0009348 Ga0495606_0009348_6575_7666 354
135 3300046512 Ga0495610_0005195 Ga0495610_0005195_300_1376 354
136 3300046524 Ga0495648_0000328 Ga0495648_0000328_15550_16827 354
137 3300047446 Ga0495679_023404 Ga0495679_023404_447_1661 354
138 3300047469 Ga0495673_0000016 Ga0495673_0000016_393667_394881 354
139 3300049574 Ga0501038_0013297 Ga0501038_0013297_2860_3957 354
140 3300049577 Ga0501041_0004798 Ga0501041_0004798_2651_3748 354
141 3300049578 Ga0501042_0040398 Ga0501042_0040398_1003_2100 354
142 3300049582 Ga0501048_0022502 Ga0501048_0022502_1966_3063 354
143 3300049588 Ga0501072_0000859 Ga0501072_0000859_10806_11903 354
144 3300049591 Ga0501075_0018233 Ga0501075_0018233_3528_4625 354
145 3300049592 Ga0501076_0023698 Ga0501076_0023698_734_1831 354
146 3300049593 Ga0501077_0079815 Ga0501077_0079815_184_1281 354
147 3300049741 Ga0501079_0009427 Ga0501079_0009427_3582_4679 354
148 3300049824 Ga0501045_0004967 Ga0501045_0004967_2812_3909 354
149 3300053125 Ga0500618_015224 Ga0500618_015224_621_1745 354
150 3300053125 Ga0500618_022006 Ga0500618_022006_369_1499 354
151 3300054114 Ga0501084_0016268 Ga0501084_0016268_3512_4609 354
152 3300061734 Ga0530510_0022225 Ga0530510_0022225_541_1638 354
153 iso_pu_bacteria 2508501122 2509107271 354
154 iso_pu_bacteria 2842775625 2842778627 354
155 3300031548 Ga0307408_100061180 Ga0307408_1000611802 355
156 iso_pu_bacteria 2509276019 2509374762 355
157 iso_pu_bacteria 2510461076 2510899576 355
158 iso_pu_bacteria 2513237084 2513569951 355
159 iso_pu_bacteria 2513237138 2513868678 355
160 iso_pu_bacteria 2513237144 2513909315 355
161 iso_pu_bacteria 2513237146 2513924704 355
162 iso_pu_bacteria 2513237162 2514023323 355
163 iso_pu_bacteria 2515154113 2515632505 355
164 iso_pu_bacteria 2516143018 2516206313 355
165 iso_pu_bacteria 2582581866 2585394556 355
166 iso_pu_bacteria 2582581867 2585404854 355
167 iso_pu_bacteria 2585427608 2585902624 355
168 iso_pu_bacteria 2599185170 2599416257 355
169 iso_pu_bacteria 2643221723 2644672051 355
170 iso_pu_bacteria 2667528174 2671115525 355
171 iso_pu_bacteria 2690316117 2692317940 355
172 iso_pu_bacteria 2738541333 2739034501 355
173 iso_pu_bacteria 2751185821 2753459171 355
174 iso_pu_bacteria 2765235802 2765464485 355
175 iso_pu_bacteria 2775506902 2776268355 355
176 iso_pu_bacteria 2775506904 2776280300 355
177 iso_pu_bacteria 2791355082 2792583707 355
178 iso_pu_bacteria 2791355092 2792629920 355
179 iso_pu_bacteria 2791355094 2792641284 355
180 iso_pu_bacteria 2791355265 2793355225 355
181 iso_pu_bacteria 2802429634 2806055647 355
182 iso_pu_bacteria 2802429635 2806061327 355
183 iso_pu_bacteria 2802429636 2806069851 355
184 iso_pu_bacteria 2818991448 2819610805 355
185 iso_pu_bacteria 2838029111 2838030391 355
186 iso_pu_bacteria 2838035591 2838036381 355
187 iso_pu_bacteria 2838074704 2838079118 355
188 iso_pu_bacteria 2838661181 2838668492 355
189 iso_pu_bacteria 2838680041 2838684233 355
190 iso_pu_bacteria 2838694306 2838699723 355
191 iso_pu_bacteria 2838707686 2838711991 355
192 iso_pu_bacteria 2842077413 2842081699 355
193 iso_pu_bacteria 2842118031 2842122275 355
194 iso_pu_bacteria 2842237096 2842241403 355
195 iso_pu_bacteria 2842285085 2842289847 355
196 iso_pu_bacteria 2842291075 2842295355 355
197 iso_pu_bacteria 2842370503 2842375898 355
198 iso_pu_bacteria 2842377471 2842381870 355
199 iso_pu_bacteria 2842384541 2842388824 355
200 iso_pu_bacteria 2842395702 2842400327 355
201 iso_pu_bacteria 2842402390 2842407013 355
202 iso_pu_bacteria 2842409023 2842413905 355
203 iso_pu_bacteria 2842415677 2842420547 355
204 iso_pu_bacteria 2842475841 2842477329 355
205 iso_pu_bacteria 2842502639 2842504126 355
206 iso_pu_bacteria 2847417321 2847423559 355
207 iso_pu_bacteria 2848992105 2848997332 355
208 iso_pu_bacteria 2850079185 2850080209 355
209 iso_pu_bacteria 2854916844 2854922531 355
210 iso_pu_bacteria 2856342000 2856342332 355
211 iso_pu_bacteria 2874123672 2874127213 355
212 iso_pu_bacteria 2885334103 2885338821 355
213 iso_pu_bacteria 2888343758 2888346636 355
214 iso_pu_bacteria 2896384573 2896385748 355
215 iso_pu_bacteria 2903448605 2903453180 355
216 iso_pu_bacteria 2904578770 2904583800 355
217 iso_pu_bacteria 2913295892 2913301067 355
218 iso_pu_bacteria 2919100787 2919104882 355
219 iso_pu_bacteria 2919119836 2919124414 355
220 iso_pu_bacteria 2919408235 2919412181 355
221 iso_pu_bacteria 2920760137 2920766419 355
222 iso_pu_bacteria 2920822456 2920826233 355
223 iso_pu_bacteria 2923556063 2923561832 355
224 iso_pu_bacteria 2928521798 2928524853 355
225 iso_pu_bacteria 2929138655 2929143826 355
226 iso_pu_bacteria 2933016740 2933017262 355
227 iso_pu_bacteria 2935894831 2935898426 355
228 iso_pu_bacteria 2936367885 2936370478 355
229 iso_pu_bacteria 2936375103 2936378138 355
230 iso_pu_bacteria 2952252522 2952254287 355
231 iso_pu_bacteria 2954011201 2954011525 355
232 iso_pu_bacteria 2957415311 2957420739 355
233 iso_pu_bacteria 3004203850 3004211222 355
234 iso_pu_bacteria 3005416602 3005419839 355
235 iso_pu_bacteria 3005445848 3005447586 355
236 iso_pu_bacteria 643692032 643822480 355
237 iso_pu_bacteria 8005301065 8005305213 355
238 iso_pu_bacteria 8005376324 8005382148 355
239 iso_pu_bacteria 8005484373 8005486781 355
240 iso_pu_bacteria 8005645114 8005651452 355
241 iso_pu_bacteria 8005658619 8005661087 355
242 iso_pu_bacteria 8005682033 8005685779 355
243 iso_pu_bacteria 8005688590 8005689235 355
244 iso_pu_bacteria 8005695170 8005701233 355
245 iso_pu_bacteria 8024479707 8024485808 355
246 iso_pu_bacteria 8049293176 8049298069 355
247 iso_pu_bacteria 8055431914 8055434810 355
248 iso_pu_bacteria 8055617313 8055619051 355
249 iso_pu_bacteria 2734482264 2735834155 356
250 iso_pu_bacteria 2738543009 2739225565 356
251 iso_pu_bacteria 2818991440 2819566082 356
252 iso_pu_bacteria 2842918807 2842920574 356
253 iso_pu_bacteria 2904463128 2904466353 356
254 iso_pu_bacteria 2919085039 2919086068 356
255 iso_pu_bacteria 2953994433 2953995862 356
256 3300001979 JGI24740J21852_10000002 JGI24740J21852_1000000292 357
257 3300002737 JGI25162J39368_1000144 JGI25162J39368_100014458 357
258 3300002773 JGI25152J39213_1006505 JGI25152J39213_10065052 357
259 3300002774 JGI25150J39212_1002431 JGI25150J39212_10024312 357
260 3300002987 JGI25159J45721_1001625 JGI25159J45721_10016256 357
261 3300003187 JGI25151J46595_10001390 JGI25151J46595_100013906 357
262 3300003187 JGI25151J46595_10002227 JGI25151J46595_100022277 357
263 3300003187 JGI25151J46595_10015023 JGI25151J46595_100150234 357
264 3300003203 JGI25406J46586_10005302 JGI25406J46586_100053024 357
265 3300003214 JGI25165J46597_1000075 JGI25165J46597_100007573 357
266 3300003215 JGI25153J46596_10007943 JGI25153J46596_100079435 357
267 3300003215 JGI25153J46596_10011794 JGI25153J46596_100117942 357
268 3300003320 rootH2_10080170 rootH2_100801703 357
269 3300003322 rootL2_10018242 rootL2_1001824212 357
270 3300003323 rootH1_10159869 rootH1_101598694 357
271 3300003354 JGI25160J50197_1002208 JGI25160J50197_10022086 357
272 3300003374 JGI25161J50226_1001090 JGI25161J50226_10010906 357
273 3300003762 Ga0055542_1000797 Ga0055542_100079712 357
274 3300003771 Ga0055526_1003147 Ga0055526_10031474 357
275 3300003781 Ga0055536_1005210 Ga0055536_10052102 357
276 3300003792 Ga0055540_1014280 Ga0055540_10142802 357
277 3300003794 Ga0055531_10004242 Ga0055531_1000424210 357
278 3300004625 Ga0055543_1000310 Ga0055543_10003106 357
279 3300004625 Ga0055543_1000822 Ga0055543_10008225 357
280 3300005262 Ga0065165_1002081 Ga0065165_10020815 357
281 3300005262 Ga0065165_1004196 Ga0065165_10041966 357
282 3300005614 Ga0068856_100080384 Ga0068856_1000803842 357
283 3300005985 Ga0081539_10000076 Ga0081539_1000007634 357
284 3300006051 Ga0075364_10008309 Ga0075364_100083095 357
285 3300006178 Ga0075367_10026005 Ga0075367_100260052 357
286 3300009765 Ga0123341_1008686 Ga0123341_10086865 357
287 3300013249 Ga0171463_1009 Ga0171463_100958 357
288 3300015690 Ga0183363_1251 Ga0183363_12512 357
289 3300021320 Ga0214544_1007618 Ga0214544_10076182 357
290 3300021321 Ga0214542_1000014 Ga0214542_1000014139 357
291 3300021321 Ga0214542_1028231 Ga0214542_10282312 357
292 3300021327 Ga0214543_1000003 Ga0214543_1000003207 357
293 3300021327 Ga0214543_1000056 Ga0214543_100005680 357
294 3300021361 Ga0213872_10000547 Ga0213872_1000054718 357
295 3300025208 Ga0209436_101175 Ga0209436_1011757 357
296 3300025233 Ga0209437_100131 Ga0209437_10013170 357
297 3300025245 Ga0207425_1001139 Ga0207425_10011392 357
298 3300025245 Ga0207425_1016755 Ga0207425_10167551 357
299 3300025254 Ga0209148_1000302 Ga0209148_100030246 357
300 3300025254 Ga0209148_1006061 Ga0209148_10060612 357
301 3300025258 Ga0209129_1001890 Ga0209129_100189013 357
302 3300025258 Ga0209129_1002589 Ga0209129_10025893 357
303 3300025258 Ga0209129_1002913 Ga0209129_10029138 357
304 3300025261 Ga0209233_1000132 Ga0209233_100013289 357
305 3300025272 Ga0209455_1000284 Ga0209455_100028426 357
306 3300025273 Ga0209673_1000022 Ga0209673_100002223 357
307 3300025273 Ga0209673_1000621 Ga0209673_100062138 357
308 3300025284 Ga0209130_1000234 Ga0209130_100023469 357
309 3300025291 Ga0209675_1016062 Ga0209675_10160622 357
310 3300025292 Ga0209676_1001969 Ga0209676_100196910 357
311 3300025294 Ga0209025_1000418 Ga0209025_100041831 357
312 3300025294 Ga0209025_1001085 Ga0209025_10010859 357
313 3300025294 Ga0209025_1004748 Ga0209025_100474816 357
314 3300025294 Ga0209025_1053444 Ga0209025_10534442 357
315 3300025295 Ga0209564_1000117 Ga0209564_1000117171 357
316 3300025295 Ga0209564_1001607 Ga0209564_10016076 357
317 3300025295 Ga0209564_1003761 Ga0209564_10037619 357
318 3300025297 Ga0209758_1000603 Ga0209758_100060351 357
319 3300025297 Ga0209758_1012086 Ga0209758_10120864 357
320 3300025298 Ga0209050_1006671 Ga0209050_10066712 357
321 3300025299 Ga0209256_1000565 Ga0209256_100056517 357
322 3300025299 Ga0209256_1000622 Ga0209256_10006224 357
323 3300025302 Ga0207426_1000299 Ga0207426_100029919 357
324 3300025302 Ga0207426_1000410 Ga0207426_100041069 357
325 3300025303 Ga0209051_1003919 Ga0209051_10039197 357
326 3300025303 Ga0209051_1014268 Ga0209051_10142686 357
327 3300025304 Ga0209257_1002072 Ga0209257_10020724 357
328 3300025304 Ga0209257_1008072 Ga0209257_10080723 357
329 3300026078 Ga0207702_10060630 Ga0207702_100606302 357
330 3300027312 Ga0209371_1000821 Ga0209371_100082122 357
331 3300030500 Ga0268256_1000474 Ga0268256_100047423 357
332 3300033180 Ga0307510_10008270 Ga0307510_100082707 357
333 3300039447 Ga0436361_0527730 Ga0436361_0527730_25316_26452 357
334 3300041492 Ga0451835_0842717 Ga0451835_0842717_2660_3742 357
335 3300041494 Ga0451837_1735123 Ga0451837_1735123_2167_3249 357
336 3300041496 Ga0451839_0809352 Ga0451839_0809352_3919_5001 357
337 3300041498 Ga0451841_0076186 Ga0451841_0076186_7763_8845 357
338 3300041501 Ga0451845_0279688 Ga0451845_0279688_112_1194 357
339 3300041503 Ga0451847_0353095 Ga0451847_0353095_1884_2966 357
340 3300041505 Ga0451849_0356336 Ga0451849_0356336_3918_5000 357
341 3300041507 Ga0451851_0671713 Ga0451851_0671713_4630_5712 357
342 3300041509 Ga0451843_1145762 Ga0451843_1145762_2660_3742 357
343 3300041511 Ga0451855_1072631 Ga0451855_1072631_2121_3203 357
344 3300041512 Ga0451853_1661544 Ga0451853_1661544_2755_3837 357
345 3300048920 Ga0496117_0019850 Ga0496117_0019850_1545_2627 357
346 3300048922 Ga0496119_0013661 Ga0496119_0013661_2137_3219 357
347 3300048924 Ga0496121_0029177 Ga0496121_0029177_2475_3557 357
348 3300048925 Ga0496122_0010820 Ga0496122_0010820_5319_6425 357
349 3300048925 Ga0496122_0013752 Ga0496122_0013752_3604_4686 357
350 3300048925 Ga0496122_0043065 Ga0496122_0043065_1106_2188 357
351 3300048926 Ga0496123_0003670 Ga0496123_0003670_3016_4098 357
352 3300048926 Ga0496123_0028107 Ga0496123_0028107_166_1248 357
353 3300048927 Ga0496124_0004873 Ga0496124_0004873_12130_13212 357
354 3300048928 Ga0496125_0000093 Ga0496125_0000093_197368_198450 357
355 3300048928 Ga0496125_0000376 Ga0496125_0000376_50832_51938 357
356 3300048928 Ga0496125_0088219 Ga0496125_0088219_656_1738 357
357 3300048929 Ga0496126_0031219 Ga0496126_0031219_2139_3221 357
358 3300049585 Ga0501069_0044185 Ga0501069_0044185_720_1811 357
359 3300049586 Ga0501070_0067011 Ga0501070_0067011_1207_2298 357
360 3300050491 nmdc:mga00v17_19841_c1 nmdc:mga00v17_19841_c1_492_1574 357
361 3300053125 Ga0500618_015703 Ga0500618_015703_721_1803 357
362 3300053177 Ga0500636_0001339 Ga0500636_0001339_4578_5660 357
363 iso_pu_bacteria 2885305155 2885306710 357
364 iso_pu_bacteria 2885326080 2885328670 357
365 iso_pu_bacteria 2919046199 2919050340 357
366 iso_pu_bacteria 2941471342 2941475838 357
367 iso_pu_bacteria 2968083720 2968086546 357
368 iso_pu_bacteria 637000159 637078850 357
369 iso_pu_bacteria 8005289223 8005289455 357
370 3300037471 Ga0395905_0086103 Ga0395905_0086103_958_2088 358
371 3300046471 Ga0495650_0000564 Ga0495650_0000564_32147_33322 358
372 3300046500 Ga0495596_0026988 Ga0495596_0026988_839_2002 358
373 3300046506 Ga0495583_0000160 Ga0495583_0000160_23409_24572 358
374 3300046518 Ga0495631_0003605 Ga0495631_0003605_6827_7990 358
375 3300046519 Ga0495632_0021572 Ga0495632_0021572_1659_2822 358
376 3300046523 Ga0495644_0025930 Ga0495644_0025930_588_1751 358
377 3300046528 Ga0495642_0057561 Ga0495642_0057561_213_1376 358
378 3300046648 Ga0495611_0039521 Ga0495611_0039521_599_1762 358
379 3300046665 Ga0495661_0023855 Ga0495661_0023855_518_1681 358
380 3300046694 Ga0495649_0030153 Ga0495649_0030153_223_1386 358
381 3300046794 Ga0495589_0060422 Ga0495589_0060422_111_1274 358
382 3300047445 Ga0495677_0006096 Ga0495677_0006096_373_1536 358
383 3300047445 Ga0495677_0022598 Ga0495677_0022598_649_1812 358
384 3300048091 Ga0495626_0009104 Ga0495626_0009104_3657_4808 358
385 3300048091 Ga0495626_0009717 Ga0495626_0009717_433_1596 358
386 3300048091 Ga0495626_0023942 Ga0495626_0023942_1598_2749 358
387 3300048091 Ga0495626_0038465 Ga0495626_0038465_35_1198 358
388 iso_pu_bacteria 2808606386 2808984142 358
389 iso_pu_bacteria 2808606415 2809131946 358
390 iso_pu_bacteria 2808606419 2809151569 358
391 iso_pu_bacteria 2852618963 2852622972 358
392 iso_pu_bacteria 2904439833 2904440012 358
393 iso_pu_bacteria 2904530477 2904531040 358
394 iso_pu_bacteria 2904584206 2904587315 358
395 iso_pu_bacteria 2904589729 2904592650 358
396 iso_pu_bacteria 2904601388 2904604568 358
397 iso_pu_bacteria 2919079590 2919082389 358
398 3300003781 Ga0055536_1008430 Ga0055536_10084304 359
399 3300005563 Ga0068855_100016956 Ga0068855_1000169566 359
400 3300005578 Ga0068854_100036656 Ga0068854_1000366563 359
401 3300009545 Ga0105237_10003670 Ga0105237_100036705 359
402 3300009551 Ga0105238_10004877 Ga0105238_100048779 359
403 3300015261 Ga0182006_1000802 Ga0182006_100080212 359
404 3300025914 Ga0207671_10134248 Ga0207671_101342482 359
405 3300025924 Ga0207694_10004641 Ga0207694_100046413 359
406 3300025949 Ga0207667_10009983 Ga0207667_100099836 359
407 3300003320 rootH2_10009642 rootH2_1000964220 360
408 3300005262 Ga0065165_1001819 Ga0065165_10018196 360
409 3300005344 Ga0070661_100012005 Ga0070661_1000120056 360
410 3300005548 Ga0070665_100043702 Ga0070665_1000437023 360
411 3300005577 Ga0068857_100019220 Ga0068857_1000192203 360
412 3300009093 Ga0105240_10000236 Ga0105240_100002364 360
413 3300009101 Ga0105247_10044682 Ga0105247_100446822 360
414 3300010375 Ga0105239_10000110 Ga0105239_1000011032 360
415 3300013104 Ga0157370_10000858 Ga0157370_1000085825 360
416 3300015265 Ga0182005_1000036 Ga0182005_100003636 360
417 3300025302 Ga0207426_1005203 Ga0207426_10052033 360
418 3300025903 Ga0207680_10000006 Ga0207680_10000006384 360
419 3300025909 Ga0207705_10316817 Ga0207705_103168171 360
420 3300025913 Ga0207695_10000207 Ga0207695_1000020713 360
421 3300025913 Ga0207695_10001342 Ga0207695_1000134233 360
422 3300028379 Ga0268266_10000021 Ga0268266_10000021440 360
423 3300031548 Ga0307408_100314102 Ga0307408_1003141021 360
424 3300031911 Ga0307412_10000680 Ga0307412_100006808 360
425 3300041404 Ga0439436_0038647 Ga0439436_0038647_267_1349 360
426 3300041413 Ga0439465_0007071 Ga0439465_0007071_1278_2360 360
427 3300042184 Ga0450908_000040 Ga0450908_000040_7709_8863 360
428 3300044672 Ga0466982_0000162 Ga0466982_0000162_15643_16725 360
429 3300046452 Ga0495617_000114 Ga0495617_000114_20301_21383 360
430 3300046471 Ga0495650_0001488 Ga0495650_0001488_7669_8751 360
431 3300046492 Ga0495585_0000063 Ga0495585_0000063_34591_35679 360
432 3300046492 Ga0495585_0003226 Ga0495585_0003226_8568_9650 360
433 3300046501 Ga0495607_0010394 Ga0495607_0010394_2735_3817 360
434 3300046507 Ga0495606_0000427 Ga0495606_0000427_51698_52780 360
435 3300046513 Ga0495616_0000183 Ga0495616_0000183_34640_35722 360
436 3300046515 Ga0495620_0000090 Ga0495620_0000090_52389_53471 360
437 3300046518 Ga0495631_0000458 Ga0495631_0000458_17304_18392 360
438 3300046519 Ga0495632_0004019 Ga0495632_0004019_5967_7049 360
439 3300046665 Ga0495661_0001253 Ga0495661_0001253_12252_13340 360
440 3300046691 Ga0495670_0094988 Ga0495670_0094988_92_1174 360
441 3300047323 Ga0495683_0001383 Ga0495683_0001383_13526_14608 360
442 3300047472 Ga0495686_0009430 Ga0495686_0009430_4445_5527 360
443 3300048905 Ga0496102_0048907 Ga0496102_0048907_250_1332 360
444 3300048907 Ga0496104_0107254 Ga0496104_0107254_228_1310 360
445 3300048908 Ga0496105_0000587 Ga0496105_0000587_13785_14867 360
446 3300048910 Ga0496107_0072073 Ga0496107_0072073_504_1586 360
447 3300048920 Ga0496117_0111165 Ga0496117_0111165_135_1217 360
448 3300048921 Ga0496118_0006417 Ga0496118_0006417_9633_10715 360
449 3300048922 Ga0496119_0000029 Ga0496119_0000029_108040_109122 360
450 3300048923 Ga0496120_0000039 Ga0496120_0000039_93116_94198 360
451 3300048924 Ga0496121_0000408 Ga0496121_0000408_55284_56366 360
452 3300048924 Ga0496121_0000922 Ga0496121_0000922_17191_18273 360
453 3300048924 Ga0496121_0077179 Ga0496121_0077179_506_1588 360
454 3300053117 Ga0500593_000250 Ga0500593_000250_14974_16107 360
455 3300053730 Ga0500645_000287 Ga0500645_000287_16754_17842 360
456 3300001904 JGI24736J21556_1001307 JGI24736J21556_10013073 361
457 3300013105 Ga0157369_10001146 Ga0157369_1000114629 361
458 3300025904 Ga0207647_10000237 Ga0207647_1000023730 361
459 3300048920 Ga0496117_0021293 Ga0496117_0021293_1569_2654 361
460 3300048921 Ga0496118_0007263 Ga0496118_0007263_3660_4745 361
461 3300048924 Ga0496121_0000109 Ga0496121_0000109_137338_138423 361
462 3300048925 Ga0496122_0159425 Ga0496122_0159425_62_1147 361
463 3300048926 Ga0496123_0102124 Ga0496123_0102124_554_1639 361
464 3300048928 Ga0496125_0013631 Ga0496125_0013631_171_1256 361
465 3300048929 Ga0496126_0004543 Ga0496126_0004543_3827_4912 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04303

PrpF

PrpF protein

43

256

0.93

PF04303

PrpF

PrpF protein

246

422

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p3j-assembly1.cif.gz_A crystal structure of ligu 0.9498 1 351
6p3k-assembly2.cif.gz_B crystal structure of ligu(c100s) 0.9478 1 351
6p3j-assembly1.cif.gz_B crystal structure of ligu 0.9473 2 350
6p3j-assembly1.cif.gz_A crystal structure of ligu 0.9419 1 351
6p3k-assembly2.cif.gz_B crystal structure of ligu(c100s) 0.9374 1 351
ID Description Score Start End Superfamily
af_P0AAV8_179_330_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9362 180 328 3.10.310.10
af_P0AAV8_1_178_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9203 5 178 3.10.310.10
3g7kB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9184 173 331 3.10.310.10
3g7kB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9039 2 162 3.10.310.10
af_P0AAV8_1_178_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8955 5 178 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A2M8Q6N3-F1-model_v4 4-oxalomesaconate tautomerase 0.9965 177 296 GO:0016853
AF-K9NK90-F1-model_v4 deleted 0.996 197 271
AF-A0A441XJS6-F1-model_v4 4-oxalomesaconate tautomerase 0.991 172 250 GO:0016853
AF-A0A2M8Q6N3-F1-model_v4 4-oxalomesaconate tautomerase 0.9883 177 296 GO:0016853
AF-A0A3S4JUN3-F1-model_v4 PrpF protein 0.9804 182 280 GO:0016853

Feature Viewer

pLDDT pTM Quality
89.79 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map