F449492

General Info

Members Datasets Scaffolds Average Seq Length
465 271 448 234

Family's Representative Sequence

Representative Sequence 3300025273|Ga0209673_1033174|Ga0209673_10331742
Length 234
Sequence MNDMTHVVPHTGVVLSCQGLTKRFSEGGLDVEVLRGVDLEVHAGETLAIVGASGSGKSTLLHLLGGLDAPSSGSVQLMGQDLARLDPATQGRLRNQHLGFVYQFHHLLPEFSALDNVGMPLRIRREPVEAMHRQAQEMLAAVGLADELSGGERQRVAIARALVAHPACVLADEPTGNLDRGTADVVFALMLRLARERGTAFVMVTHDEQLAARCGRTLRLTTGKLGEPQAVAEA

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2643221570 Acidovorax sp. Root568 Isolate Unclassified
3 2643221596 Acidovorax sp. Root70 Isolate Unclassified
4 2643221609 Acidovorax sp. Root217 Isolate Unclassified
5 2643221611 Acidovorax sp. Root219 Isolate Unclassified
6 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
7 2643221652 Acidovorax sp. Root402 Isolate Unclassified
8 2643221717 Acidovorax sp. Root267 Isolate Unclassified
9 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
10 2738543012 Acidovorax sp. CF301 Isolate Unclassified
11 2816332133 Acidovorax radicis 2721A Isolate Unclassified
12 2831864461 Roseateles noduli HZ7 Isolate Nodule
13 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
14 2842733646 Variovorax sp. R-72446 Isolate Unclassified
15 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
16 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
17 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
183 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
184 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
191 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
192 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
193 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
194 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
264 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
265 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
266 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
267 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
268 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
269 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.38
Nodule 0.22
Rhizoplane 4.73
Rhizosphere 82.37
Stem 0
Stem Tuber 0
Unclassified 7.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10021281 3300001979 Bacteria 2250
2 Ga0055532_1001463 3300003758 Bacteria 6560
3 Ga0055527_1000957 3300003760 Bacteria 7100
4 Ga0055535_1002277 3300003761 Bacteria 7106
5 Ga0055531_10009072 3300003794 Bacteria 5132
6 Ga0065707_10087025 3300005295 Bacteria 5200
7 Ga0070676_10126379 3300005328 Bacteria 1612
8 Ga0070683_100072069 3300005329 Bacteria 3224
9 Ga0070683_100362904 3300005329 Bacteria 1379
10 Ga0070670_100002208 3300005331 Bacteria 15994
11 Ga0070670_100181780 3300005331 Bacteria 1826
12 Ga0070677_10088615 3300005333 Bacteria 1341
13 Ga0068869_100003076 3300005334 Bacteria 10155
14 Ga0070666_10090035 3300005335 Bacteria 2107
15 Ga0070680_100507524 3300005336 Bacteria 1032
16 Ga0068868_100157511 3300005338 Bacteria 1873
17 Ga0068868_100179194 3300005338 Bacteria 1757
18 Ga0070660_100307034 3300005339 Bacteria 1301
19 Ga0070661_100075267 3300005344 Bacteria 2487
20 Ga0070661_100386237 3300005344 Bacteria 1104
21 Ga0070692_10395974 3300005345 Bacteria 871
22 Ga0070668_100044881 3300005347 Bacteria 3391
23 Ga0070668_100055174 3300005347 Bacteria 3066
24 Ga0070669_100036437 3300005353 Bacteria 3564
25 Ga0070669_100150282 3300005353 Bacteria 1802
26 Ga0070669_100247364 3300005353 Bacteria 1419
27 Ga0070669_100329636 3300005353 Bacteria 1234
28 Ga0070675_100001332 3300005354 Bacteria 18063
29 Ga0070675_100051929 3300005354 Bacteria 3369
30 Ga0070675_100060990 3300005354 Bacteria 3114
31 Ga0070675_100668617 3300005354 Bacteria 945
32 Ga0070674_100199006 3300005356 Bacteria 1546
33 Ga0070674_100711545 3300005356 Bacteria 859
34 Ga0070673_100042252 3300005364 Bacteria 3513
35 Ga0070673_100120950 3300005364 Bacteria 2184
36 Ga0070659_100006591 3300005366 Bacteria 8385
37 Ga0070659_100244258 3300005366 Bacteria 1487
38 Ga0070667_100186723 3300005367 Bacteria 1835
39 Ga0070667_100660213 3300005367 Bacteria 966
40 Ga0070708_100089240 3300005445 Bacteria 2805
41 Ga0070663_100015570 3300005455 Bacteria 4914
42 Ga0070678_100024292 3300005456 Bacteria 4056
43 Ga0070678_100053793 3300005456 Bacteria 2930
44 Ga0070678_100072757 3300005456 Bacteria 2578
45 Ga0070678_100319350 3300005456 Bacteria 1326
46 Ga0070678_100417786 3300005456 Bacteria 1168
47 Ga0070662_100039923 3300005457 Bacteria 3340
48 Ga0070662_100110803 3300005457 Bacteria 2091
49 Ga0070662_100185128 3300005457 Bacteria 1644
50 Ga0070662_100546207 3300005457 Bacteria 970
51 Ga0068867_100126739 3300005459 Bacteria 1979
52 Ga0068867_100182873 3300005459 Bacteria 1668
53 Ga0070679_100007237 3300005530 Bacteria 10357
54 Ga0070684_100088817 3300005535 Bacteria 2746
55 Ga0068853_100021163 3300005539 Bacteria 5417
56 Ga0070672_100008285 3300005543 Bacteria 7104
57 Ga0070672_100043838 3300005543 Bacteria 3453
58 Ga0070672_100395732 3300005543 Bacteria 1183
59 Ga0070665_100026163 3300005548 Bacteria 5875
60 Ga0070665_100309982 3300005548 Bacteria 1582
61 Ga0068855_100016435 3300005563 Bacteria 8896
62 Ga0068855_100742838 3300005563 Bacteria 1047
63 Ga0070664_100253021 3300005564 Bacteria 1584
64 Ga0070664_100783935 3300005564 Bacteria 891
65 Ga0068854_100009054 3300005578 Bacteria 6415
66 Ga0068856_100041290 3300005614 Bacteria 4533
67 Ga0068856_100529169 3300005614 Bacteria 1200
68 Ga0070702_100160247 3300005615 Bacteria 1454
69 Ga0068852_100000615 3300005616 Bacteria 23368
70 Ga0068852_100208331 3300005616 Bacteria 1853
71 Ga0068859_101056010 3300005617 Bacteria 893
72 Ga0068864_100001994 3300005618 Bacteria 16807
73 Ga0068864_100051167 3300005618 Bacteria 3557
74 Ga0068864_100066168 3300005618 Bacteria 3136
75 Ga0068864_100233657 3300005618 Bacteria 1701
76 Ga0068861_100000384 3300005719 Bacteria 25460
77 Ga0068861_100329427 3300005719 Bacteria 1332
78 Ga0068851_10017104 3300005834 Bacteria 3479
79 Ga0068851_10342024 3300005834 Bacteria 868
80 Ga0068863_100029895 3300005841 Bacteria 5204
81 Ga0068863_100099810 3300005841 Bacteria 2758
82 Ga0068858_100006859 3300005842 Bacteria 11068
83 Ga0068860_100007870 3300005843 Bacteria 10641
84 Ga0068860_100046656 3300005843 Bacteria 4131
85 Ga0068860_100494334 3300005843 Bacteria 1221
86 Ga0068860_101136594 3300005843 Bacteria 801
87 Ga0068862_100040990 3300005844 Bacteria 3938
88 Ga0068862_100041574 3300005844 Bacteria 3912
89 Ga0075365_10014106 3300006038 Bacteria 4800
90 Ga0075366_10007203 3300006195 Bacteria 6129
91 Ga0097621_100174729 3300006237 Bacteria 1853
92 Ga0075370_10035059 3300006353 Bacteria 2815
93 Ga0068871_100090646 3300006358 Bacteria 2546
94 Ga0068871_100367993 3300006358 Bacteria 1274
95 Ga0075429_100530232 3300006880 Bacteria 1032
96 Ga0097620_101056030 3300006931 Bacteria 893
97 Ga0105240_10003836 3300009093 Bacteria 23255
98 Ga0105240_10011131 3300009093 Bacteria 12570
99 Ga0105240_10760754 3300009093 Bacteria 1052
100 Ga0111539_10438954 3300009094 Bacteria 1520
101 Ga0111539_11053104 3300009094 Bacteria 945
102 Ga0105245_10021575 3300009098 Bacteria 5652
103 Ga0105245_10040737 3300009098 Bacteria 4139
104 Ga0105243_10273598 3300009148 Bacteria 1518
105 Ga0105241_10060119 3300009174 Bacteria 2922
106 Ga0105248_10007485 3300009177 Bacteria 11977
107 Ga0105237_10001634 3300009545 Bacteria 29121
108 Ga0105237_10099539 3300009545 Bacteria 2899
109 Ga0105237_10308681 3300009545 Bacteria 1585
110 Ga0105238_10007933 3300009551 Bacteria 10621
111 Ga0105238_10107029 3300009551 Bacteria 2778
112 Ga0105238_10188888 3300009551 Bacteria 2037
113 Ga0105239_10002435 3300010375 Bacteria 23714
114 Ga0105239_10030967 3300010375 Bacteria 5886
115 Ga0157319_1000016 3300012497 Bacteria 127256
116 Ga0157369_10116573 3300013105 Bacteria 2836
117 Ga0157374_10009696 3300013296 Bacteria 8267
118 Ga0157374_10085973 3300013296 Bacteria 2991
119 Ga0157374_10580235 3300013296 Bacteria 1130
120 Ga0157378_10316251 3300013297 Bacteria 1516
121 Ga0163162_10000830 3300013306 Bacteria 28736
122 Ga0163162_10438293 3300013306 Bacteria 1439
123 Ga0157372_10015817 3300013307 Bacteria 8093
124 Ga0157372_10066444 3300013307 Bacteria 4051
125 Ga0157375_10002326 3300013308 Bacteria 16416
126 Ga0157375_10748051 3300013308 Bacteria 1129
127 Ga0163163_10532849 3300014325 Bacteria 1237
128 Ga0157380_10008226 3300014326 Bacteria 7432
129 Ga0157380_10123305 3300014326 Bacteria 2198
130 Ga0157380_10586393 3300014326 Bacteria 1100
131 Ga0157377_10022908 3300014745 Bacteria 3303
132 Ga0157379_10001870 3300014968 Bacteria 17410
133 Ga0157379_10014560 3300014968 Bacteria 6901
134 Ga0157376_10043662 3300014969 Bacteria 3680
135 Ga0157376_10045808 3300014969 Bacteria 3603
136 Ga0157376_10079429 3300014969 Bacteria 2812
137 Ga0157376_10125291 3300014969 Bacteria 2284
138 Ga0163161_10013308 3300017792 Bacteria 5722
139 Ga0163161_10127064 3300017792 Bacteria 1921
140 Ga0213872_10000004 3300021361 Bacteria 306230
141 Ga0213872_10000006 3300021361 Bacteria 249845
142 Ga0213872_10001699 3300021361 Bacteria 13851
143 Ga0213872_10042404 3300021361 Bacteria 2075
144 Ga0213876_10114879 3300021384 Bacteria 1429
145 Ga0209673_1033174 3300025273 Bacteria 1579
146 Ga0209673_1040048 3300025273 Bacteria 1345
147 Ga0209130_1050140 3300025284 Bacteria 764
148 Ga0209564_1000008 3300025295 Bacteria 953227
149 Ga0209256_1002812 3300025299 Bacteria 13308
150 Ga0209051_1000173 3300025303 Bacteria 117170
151 Ga0209257_1000096 3300025304 Bacteria 259390
152 Ga0209257_1001623 3300025304 Bacteria 25764
153 Ga0207697_10057069 3300025315 Bacteria 1621
154 Ga0207656_10012195 3300025321 Bacteria 3263
155 Ga0207656_10133447 3300025321 Bacteria 1165
156 Ga0207656_10159720 3300025321 Bacteria 1072
157 Ga0207682_10017191 3300025893 Bacteria 2824
158 Ga0207682_10094469 3300025893 Bacteria 1301
159 Ga0207688_10020026 3300025901 Bacteria 3649
160 Ga0207688_10288256 3300025901 Bacteria 1002
161 Ga0207680_10120360 3300025903 Bacteria 1716
162 Ga0207680_10187565 3300025903 Bacteria 1402
163 Ga0207680_10225413 3300025903 Bacteria 1286
164 Ga0207699_10035108 3300025906 Bacteria 2851
165 Ga0207645_10017147 3300025907 Bacteria 4783
166 Ga0207645_10227954 3300025907 Bacteria 1229
167 Ga0207654_10144336 3300025911 Bacteria 1521
168 Ga0207654_10227811 3300025911 Bacteria 1240
169 Ga0207695_10043897 3300025913 Bacteria 4759
170 Ga0207695_10158947 3300025913 Bacteria 2193
171 Ga0207695_10504126 3300025913 Bacteria 1092
172 Ga0207695_10706040 3300025913 Bacteria 889
173 Ga0207671_10003234 3300025914 Bacteria 16385
174 Ga0207671_10047595 3300025914 Bacteria 3174
175 Ga0207660_10068292 3300025917 Bacteria 2578
176 Ga0207657_10007783 3300025919 Bacteria 10938
177 Ga0207657_10057474 3300025919 Bacteria 3352
178 Ga0207657_10094859 3300025919 Bacteria 2483
179 Ga0207649_10010725 3300025920 Bacteria 5038
180 Ga0207649_10107824 3300025920 Bacteria 1855
181 Ga0207649_10498131 3300025920 Bacteria 926
182 Ga0207652_10024848 3300025921 Bacteria 4972
183 Ga0207652_10045633 3300025921 Bacteria 3736
184 Ga0207681_10015331 3300025923 Bacteria 4779
185 Ga0207681_10287046 3300025923 Bacteria 1297
186 Ga0207694_10012902 3300025924 Bacteria 6292
187 Ga0207694_10230887 3300025924 Bacteria 1511
188 Ga0207650_10005150 3300025925 Bacteria 8921
189 Ga0207650_10143301 3300025925 Bacteria 1880
190 Ga0207650_10464806 3300025925 Bacteria 1054
191 Ga0207659_10066978 3300025926 Bacteria 2608
192 Ga0207659_10250822 3300025926 Bacteria 1436
193 Ga0207659_10363502 3300025926 Bacteria 1203
194 Ga0207659_10775598 3300025926 Bacteria 823
195 Ga0207687_10063014 3300025927 Bacteria 2624
196 Ga0207687_10066819 3300025927 Bacteria 2556
197 Ga0207687_10069245 3300025927 Bacteria 2516
198 Ga0207700_10135045 3300025928 Bacteria 2019
199 Ga0207644_10010073 3300025931 Bacteria 6225
200 Ga0207644_10075627 3300025931 Bacteria 2475
201 Ga0207690_10019744 3300025932 Bacteria 4155
202 Ga0207706_10006991 3300025933 Bacteria 10429
203 Ga0207706_10081479 3300025933 Bacteria 2844
204 Ga0207706_10541133 3300025933 Bacteria 1003
205 Ga0207706_10729047 3300025933 Bacteria 845
206 Ga0207669_10071747 3300025937 Bacteria 2177
207 Ga0207691_10006709 3300025940 Bacteria 11103
208 Ga0207691_10030588 3300025940 Bacteria 5030
209 Ga0207691_10097268 3300025940 Bacteria 2631
210 Ga0207691_10125284 3300025940 Bacteria 2274
211 Ga0207691_10146774 3300025940 Bacteria 2076
212 Ga0207711_10013899 3300025941 Bacteria 6686
213 Ga0207711_10197588 3300025941 Bacteria 1834
214 Ga0207689_10000856 3300025942 Bacteria 29352
215 Ga0207689_10419291 3300025942 Bacteria 1117
216 Ga0207661_10312767 3300025944 Bacteria 1410
217 Ga0207679_10204990 3300025945 Bacteria 1650
218 Ga0207679_10277341 3300025945 Bacteria 1436
219 Ga0207667_10292227 3300025949 Bacteria 1665
220 Ga0207667_10817060 3300025949 Bacteria 928
221 Ga0207651_10092202 3300025960 Bacteria 2221
222 Ga0207651_10095313 3300025960 Bacteria 2191
223 Ga0207712_10024887 3300025961 Bacteria 3971
224 Ga0207668_10042974 3300025972 Bacteria 3064
225 Ga0207640_10091237 3300025981 Bacteria 2110
226 Ga0207658_10023177 3300025986 Bacteria 4330
227 Ga0207658_10436660 3300025986 Bacteria 1157
228 Ga0207658_10548375 3300025986 Bacteria 1034
229 Ga0207677_10035957 3300026023 Bacteria 3222
230 Ga0207677_10140180 3300026023 Bacteria 1850
231 Ga0207703_10033407 3300026035 Bacteria 4078
232 Ga0207703_10105155 3300026035 Bacteria 2399
233 Ga0207703_10442811 3300026035 Bacteria 1212
234 Ga0207639_10029251 3300026041 Bacteria 4031
235 Ga0207678_10019938 3300026067 Bacteria 5894
236 Ga0207678_10402427 3300026067 Bacteria 1185
237 Ga0207702_10383974 3300026078 Bacteria 1351
238 Ga0207648_10294368 3300026089 Bacteria 1454
239 Ga0207648_10537361 3300026089 Bacteria 1072
240 Ga0207676_10013641 3300026095 Bacteria 5833
241 Ga0207676_10015011 3300026095 Bacteria 5583
242 Ga0207676_10070033 3300026095 Bacteria 2811
243 Ga0207676_10181010 3300026095 Bacteria 1845
244 Ga0207676_10818858 3300026095 Bacteria 909
245 Ga0207674_10227486 3300026116 Bacteria 1813
246 Ga0207675_100000879 3300026118 Bacteria 29982
247 Ga0207675_100371154 3300026118 Bacteria 1405
248 Ga0207683_10042058 3300026121 Bacteria 3991
249 Ga0207683_10077671 3300026121 Bacteria 2941
250 Ga0207683_10127732 3300026121 Bacteria 2286
251 Ga0207683_10153108 3300026121 Bacteria 2082
252 Ga0207683_10239941 3300026121 Bacteria 1653
253 Ga0207698_10003937 3300026142 Bacteria 8993
254 Ga0207698_10018671 3300026142 Bacteria 4732
255 Ga0207698_10836299 3300026142 Bacteria 925
256 Ga0268266_10063255 3300028379 Bacteria 3194
257 Ga0268265_10066840 3300028380 Bacteria 2780
258 Ga0268265_10185860 3300028380 Bacteria 1790
259 Ga0268264_10033051 3300028381 Bacteria 4247
260 Ga0268264_10083977 3300028381 Bacteria 2729
261 Ga0268264_10450083 3300028381 Bacteria 1247
262 Ga0307517_10072119 3300028786 Bacteria 3083
263 Ga0307517_10258351 3300028786 Bacteria 1014
264 Ga0307515_10018709 3300028794 Bacteria 12507
265 Ga0307515_10026937 3300028794 Bacteria 9857
266 Ga0307515_10183332 3300028794 Bacteria 2033
267 Ga0265332_10091301 3300031238 Bacteria 1287
268 Ga0265328_10002207 3300031239 Bacteria 8773
269 Ga0265327_10000341 3300031251 Bacteria 88581
270 Ga0265316_10001758 3300031344 Bacteria 22928
271 Ga0307509_10001098 3300031507 Bacteria 46348
272 Ga0307408_100000296 3300031548 Bacteria 48437
273 Ga0307408_100414294 3300031548 Bacteria 1160
274 Ga0307408_100423714 3300031548 Bacteria 1148
275 Ga0307408_100486627 3300031548 Bacteria 1077
276 Ga0307508_10017316 3300031616 Bacteria 6550
277 Ga0265314_10006635 3300031711 Bacteria 10171
278 Ga0265342_10076435 3300031712 Bacteria 1941
279 Ga0307516_10000054 3300031730 Bacteria 126288
280 Ga0307516_10000398 3300031730 Bacteria 56825
281 Ga0307516_10244645 3300031730 Bacteria 1491
282 Ga0307406_10000499 3300031901 Bacteria 22485
283 Ga0307416_100623868 3300032002 Bacteria 1160
284 Ga0307507_10185446 3300033179 Bacteria 1476
285 Ga0307510_10015140 3300033180 Bacteria 9116
286 Ga0307510_10144665 3300033180 Bacteria 2012
287 Ga0373932_0131158 3300035112 Bacteria 845
288 Ga0373961_0041338 3300035241 Bacteria 1332
289 Ga0373924_0058126 3300035410 Bacteria 1614
290 Ga0373931_0002539 3300035691 Bacteria 8112
291 Ga0373931_0029627 3300035691 Bacteria 2812
292 Ga0373935_0069443 3300035692 Bacteria 2269
293 Ga0373933_0335488 3300035724 Bacteria 981
294 Ga0373937_0050900 3300036401 Bacteria 3796
295 Ga0373925_0159219 3300037068 Bacteria 1777
296 Ga0373925_0219581 3300037068 Bacteria 1517
297 Ga0395899_0029996 3300037312 Bacteria 4092
298 Ga0395900_0000058 3300037418 Bacteria 206785
299 Ga0395900_0016468 3300037418 Bacteria 7538
300 Ga0395900_0031313 3300037418 Bacteria 5464
301 Ga0395900_0052384 3300037418 Bacteria 4201
302 Ga0395900_0070382 3300037418 Bacteria 3596
303 Ga0395900_0498060 3300037418 Bacteria 1169
304 Ga0395898_0000283 3300037466 Bacteria 122630
305 Ga0395898_0022575 3300037466 Bacteria 6372
306 Ga0395898_0037496 3300037466 Bacteria 4807
307 Ga0395898_0215028 3300037466 Bacteria 1834
308 Ga0395905_0000025 3300037471 Bacteria 317571
309 Ga0395905_0016841 3300037471 Bacteria 6945
310 Ga0395905_0023364 3300037471 Bacteria 5843
311 Ga0395905_0025632 3300037471 Bacteria 5560
312 Ga0395905_0040137 3300037471 Bacteria 4390
313 Ga0395905_0043807 3300037471 Bacteria 4198
314 Ga0395905_0058196 3300037471 Bacteria 3614
315 Ga0395905_0109025 3300037471 Bacteria 2599
316 Ga0395905_0196720 3300037471 Bacteria 1890
317 Ga0395905_0387726 3300037471 Bacteria 1291
318 Ga0395905_0396949 3300037471 Bacteria 1274
319 Ga0316581_0085236 3300037588 Bacteria 972
320 Ga0395901_0078598 3300038443 Bacteria 3444
321 Ga0395901_0500833 3300038443 Bacteria 1236
322 Ga0395901_0549927 3300038443 Bacteria 1170
323 Ga0395901_1001130 3300038443 Bacteria 812
324 Ga0400484_07608 3300038725 Bacteria 4337
325 Ga0400486_14336 3300038742 Bacteria 1706
326 Ga0400483_090995 3300039062 Bacteria 12035
327 Ga0436365_1842446 3300039437 Bacteria 3602
328 Ga0436361_0167644 3300039447 Bacteria 4106
329 Ga0436361_0215868 3300039447 Bacteria 46672
330 Ga0436361_0337087 3300039447 Bacteria 12820
331 Ga0436361_0371412 3300039447 Bacteria 22181
332 Ga0436361_0609661 3300039447 Bacteria 30960
333 Ga0439436_0067245 3300041404 Bacteria 1000
334 Ga0451843_0004696 3300041509 Bacteria 839
335 Ga0439449_0002125 3300042007 Bacteria 7778
336 Ga0450919_000679 3300042121 Bacteria 4280
337 Ga0450920_049005 3300042122 Bacteria 846
338 Ga0450923_019287 3300042125 Bacteria 1313
339 Ga0450890_001391 3300042127 Bacteria 3493
340 Ga0450897_004126 3300042128 Bacteria 1199
341 Ga0439446_0034022 3300042156 Bacteria 1482
342 Ga0439434_0066396 3300042435 Bacteria 1132
343 Ga0439464_0028116 3300042439 Bacteria 1566
344 Ga0450918_000036 3300042531 Bacteria 26790
345 Ga0451577_0000152 3300042876 Bacteria 153284
346 Ga0451577_0106813 3300042876 Bacteria 2502
347 Ga0451577_0436624 3300042876 Bacteria 1189
348 Ga0466969_0000007 3300044656 Bacteria 152114
349 Ga0466969_0009596 3300044656 Bacteria 5128
350 Ga0466969_0040450 3300044656 Bacteria 2335
351 Ga0466972_0001197 3300044658 Bacteria 12476
352 Ga0453683_0008042 3300044673 Bacteria 7101
353 Ga0466965_0018707 3300044683 Bacteria 3324
354 Ga0466966_0016953 3300044684 Bacteria 4815
355 Ga0466966_0019857 3300044684 Bacteria 4419
356 Ga0466966_0135736 3300044684 Bacteria 1504
357 Ga0466966_0200626 3300044684 Bacteria 1207
358 Ga0466961_0031064 3300044693 Bacteria 3433
359 Ga0466964_0049605 3300044706 Bacteria 1719
360 Ga0453684_0000122 3300044712 Bacteria 340529
361 Ga0453684_0093521 3300044712 Bacteria 3703
362 Ga0453684_0309203 3300044712 Bacteria 1794
363 Ga0453684_0390890 3300044712 Bacteria 1560
364 Ga0466971_0027410 3300044719 Bacteria 2552
365 Ga0466971_0096394 3300044719 Bacteria 1357
366 Ga0466968_0011931 3300044735 Bacteria 3392
367 Ga0466970_0011713 3300044765 Bacteria 4473
368 Ga0466957_0135235 3300044842 Bacteria 1583
369 Ga0466959_0000073 3300045049 Bacteria 66721
370 Ga0466959_0026727 3300045049 Bacteria 4279
371 Ga0466959_0222187 3300045049 Bacteria 1309
372 Ga0451576_0024152 3300045051 Bacteria 6568
373 Ga0451576_0079041 3300045051 Bacteria 3422
374 Ga0451576_0324837 3300045051 Bacteria 1610
375 Ga0451576_0737072 3300045051 Bacteria 1035
376 Ga0466967_0004818 3300045976 Bacteria 9195
377 Ga0495592_0000863 3300046454 Bacteria 20970
378 Ga0495629_0202875 3300046459 Bacteria 1371
379 Ga0495638_0094229 3300046460 Bacteria 1800
380 Ga0495618_0164591 3300046514 Bacteria 1413
381 Ga0495648_0066463 3300046524 Bacteria 2114
382 Ga0495648_0190164 3300046524 Bacteria 1036
383 Ga0495663_0040646 3300046525 Bacteria 1412
384 Ga0495666_0062052 3300046526 Bacteria 1785
385 Ga0495666_0065376 3300046526 Bacteria 1735
386 Ga0495642_0033405 3300046528 Bacteria 2068
387 Ga0495621_0001659 3300046539 Bacteria 5834
388 Ga0495621_0013480 3300046539 Bacteria 2570
389 Ga0495622_0031631 3300046557 Bacteria 2472
390 Ga0495656_0008462 3300046615 Bacteria 3673
391 Ga0495635_0213562 3300046663 Bacteria 1306
392 Ga0495658_0145411 3300046683 Bacteria 1452
393 Ga0495624_0195502 3300046690 Bacteria 1229
394 Ga0495670_0319017 3300046691 Bacteria 834
395 Ga0495581_0111721 3300047315 Bacteria 1589
396 Ga0495674_0172668 3300047319 Bacteria 1803
397 Ga0495685_044211 3300047447 Bacteria 1519
398 Ga0495673_0127289 3300047469 Bacteria 1004
399 Ga0496100_0033359 3300048903 Bacteria 3221
400 Ga0496101_0043145 3300048904 Bacteria 3222
401 Ga0496101_0706066 3300048904 Bacteria 796
402 Ga0496102_0077900 3300048905 Bacteria 3051
403 Ga0496104_0160139 3300048907 Bacteria 2159
404 Ga0496104_0182127 3300048907 Bacteria 2011
405 Ga0496106_0042983 3300048909 Bacteria 3389
406 Ga0496107_0004328 3300048910 Bacteria 9610
407 Ga0496108_0013424 3300048911 Bacteria 6682
408 Ga0496108_0130952 3300048911 Bacteria 2156
409 Ga0496109_0131016 3300048912 Bacteria 2340
410 Ga0496109_0169394 3300048912 Bacteria 2048
411 Ga0496110_0054831 3300048913 Bacteria 3506
412 Ga0496110_0060922 3300048913 Bacteria 3329
413 Ga0496110_0212923 3300048913 Bacteria 1757
414 Ga0496111_0107889 3300048914 Bacteria 2050
415 Ga0496112_0543896 3300048915 Bacteria 1095
416 Ga0496113_0040769 3300048916 Bacteria 3423
417 Ga0496114_0099325 3300048917 Bacteria 2482
418 Ga0496114_0194063 3300048917 Bacteria 1777
419 Ga0496114_0450824 3300048917 Bacteria 1139
420 Ga0496115_0064358 3300048918 Bacteria 2960
421 Ga0496121_0029537 3300048924 Bacteria 5066
422 Ga0496125_0147661 3300048928 Bacteria 1622
423 Ga0501031_0058361 3300049568 Bacteria 2514
424 Ga0501032_0141758 3300049569 Bacteria 1583
425 Ga0501034_0038138 3300049571 Bacteria 4866
426 Ga0501034_0660910 3300049571 Bacteria 946
427 Ga0501043_0356075 3300049579 Bacteria 1111
428 Ga0501046_0104015 3300049580 Bacteria 2176
429 Ga0501047_0025619 3300049581 Bacteria 5670
430 Ga0501047_0210893 3300049581 Bacteria 1801
431 Ga0501080_0080843 3300049742 Bacteria 3020
432 Ga0501035_0015734 3300049822 Bacteria 6981
433 Ga0501035_0139166 3300049822 Bacteria 2111
434 Ga0501044_0089640 3300049823 Bacteria 3104
435 Ga0501044_0128020 3300049823 Bacteria 2535
436 nmdc:mga0yw44_94075_c1 3300050492 Bacteria 1899
437 nmdc:mga0k408_10378_c1 3300050493 Bacteria 5038
438 nmdc:mga06z11_193401_c1 3300050494 Bacteria 1178
439 nmdc:mga07m45_3118_c1 3300050496 Bacteria 7936
440 Ga0500651_0194038 3300053093 Bacteria 1201
441 Ga0500652_013698 3300053131 Bacteria 2879
442 Ga0500561_0086661 3300053137 Bacteria 920
443 Ga0500573_0000061 3300053140 Bacteria 67535
444 Ga0500619_063949 3300053154 Bacteria 1215
445 Ga0500627_0090295 3300053158 Bacteria 1371
446 Ga0590075_061557 3300059424 Bacteria 967
447 Ga0590077_043182 3300059426 Bacteria 1005
448 Ga0466962_0012492 3300061719 Bacteria 4082

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025911 Ga0207654_10144336 Ga0207654_101443362 214
2 3300009098 Ga0105245_10040737 Ga0105245_100407373 216
3 3300014969 Ga0157376_10043662 Ga0157376_100436622 216
4 3300025927 Ga0207687_10066819 Ga0207687_100668192 216
5 3300006195 Ga0075366_10007203 Ga0075366_100072034 217
6 3300050493 nmdc:mga0k408_10378_c1 nmdc:mga0k408_10378_c1_2087_2767 217
7 3300050494 nmdc:mga06z11_193401_c1 nmdc:mga06z11_193401_c1_47_730 219
8 3300005295 Ga0065707_10087025 Ga0065707_100870255 220
9 3300005338 Ga0068868_100157511 Ga0068868_1001575112 220
10 3300025273 Ga0209673_1033174 Ga0209673_10331742 220
11 3300025303 Ga0209051_1000173 Ga0209051_100017333 220
12 3300025304 Ga0209257_1000096 Ga0209257_100009642 220
13 3300009545 Ga0105237_10308681 Ga0105237_103086812 221
14 3300021361 Ga0213872_10001699 Ga0213872_100016997 221
15 3300021361 Ga0213872_10042404 Ga0213872_100424042 221
16 3300037068 Ga0373925_0159219 Ga0373925_0159219_149_835 221
17 3300039447 Ga0436361_0167644 Ga0436361_0167644_696_1361 221
18 3300039447 Ga0436361_0337087 Ga0436361_0337087_5871_6536 221
19 3300044658 Ga0466972_0001197 Ga0466972_0001197_10190_10867 221
20 3300048917 Ga0496114_0450824 Ga0496114_0450824_421_1098 221
21 3300053093 Ga0500651_0194038 Ga0500651_0194038_133_810 221
22 iso_pu_bacteria 2643221644 2644246998 221
23 iso_pu_bacteria 2547132374 2548499763 222
24 iso_pu_bacteria 2643221570 2643868001 222
25 iso_pu_bacteria 2643221717 2644644910 222
26 3300021361 Ga0213872_10000006 Ga0213872_10000006224 223
27 3300025315 Ga0207697_10057069 Ga0207697_100570692 223
28 3300039447 Ga0436361_0215868 Ga0436361_0215868_6178_6855 223
29 3300006038 Ga0075365_10014106 Ga0075365_100141064 224
30 3300025906 Ga0207699_10035108 Ga0207699_100351082 224
31 3300025928 Ga0207700_10135045 Ga0207700_101350452 224
32 3300031238 Ga0265332_10091301 Ga0265332_100913011 224
33 3300031711 Ga0265314_10006635 Ga0265314_100066355 224
34 3300031712 Ga0265342_10076435 Ga0265342_100764352 224
35 3300037418 Ga0395900_0016468 Ga0395900_0016468_789_1463 224
36 3300041509 Ga0451843_0004696 Ga0451843_0004696_32_706 224
37 3300042876 Ga0451577_0000152 Ga0451577_0000152_65646_66323 224
38 3300044712 Ga0453684_0000122 Ga0453684_0000122_236120_236797 224
39 3300049568 Ga0501031_0058361 Ga0501031_0058361_672_1346 224
40 3300049823 Ga0501044_0089640 Ga0501044_0089640_302_976 224
41 3300050492 nmdc:mga0yw44_94075_c1 nmdc:mga0yw44_94075_c1_996_1670 224
42 3300053140 Ga0500573_0000061 Ga0500573_0000061_31955_32629 224
43 iso_pu_bacteria 2842718218 2842721540 224
44 iso_pu_bacteria 2974320154 2974322360 224
45 3300003758 Ga0055532_1001463 Ga0055532_10014634 225
46 3300003760 Ga0055527_1000957 Ga0055527_10009572 225
47 3300003761 Ga0055535_1002277 Ga0055535_10022775 225
48 3300005445 Ga0070708_100089240 Ga0070708_1000892402 225
49 3300005614 Ga0068856_100529169 Ga0068856_1005291692 225
50 3300005843 Ga0068860_100494334 Ga0068860_1004943342 225
51 3300009094 Ga0111539_10438954 Ga0111539_104389542 225
52 3300028381 Ga0268264_10450083 Ga0268264_104500832 225
53 3300031548 Ga0307408_100414294 Ga0307408_1004142941 225
54 3300031548 Ga0307408_100423714 Ga0307408_1004237142 225
55 3300031548 Ga0307408_100486627 Ga0307408_1004866272 225
56 3300032002 Ga0307416_100623868 Ga0307416_1006238682 225
57 3300037418 Ga0395900_0031313 Ga0395900_0031313_4068_4790 225
58 3300037466 Ga0395898_0022575 Ga0395898_0022575_896_1618 225
59 3300037471 Ga0395905_0040137 Ga0395905_0040137_3165_3887 225
60 3300037471 Ga0395905_0043807 Ga0395905_0043807_663_1340 225
61 3300037471 Ga0395905_0109025 Ga0395905_0109025_701_1384 225
62 3300037471 Ga0395905_0196720 Ga0395905_0196720_896_1579 225
63 3300037471 Ga0395905_0396949 Ga0395905_0396949_547_1257 225
64 3300037588 Ga0316581_0085236 Ga0316581_0085236_208_897 225
65 3300038443 Ga0395901_0500833 Ga0395901_0500833_11_733 225
66 3300038443 Ga0395901_0549927 Ga0395901_0549927_32_733 225
67 3300042121 Ga0450919_000679 Ga0450919_000679_509_1186 225
68 3300042122 Ga0450920_049005 Ga0450920_049005_151_828 225
69 3300042435 Ga0439434_0066396 Ga0439434_0066396_184_861 225
70 3300042531 Ga0450918_000036 Ga0450918_000036_17909_18586 225
71 3300042876 Ga0451577_0436624 Ga0451577_0436624_144_821 225
72 3300044683 Ga0466965_0018707 Ga0466965_0018707_1425_2114 225
73 3300044684 Ga0466966_0016953 Ga0466966_0016953_3386_4075 225
74 3300044693 Ga0466961_0031064 Ga0466961_0031064_2693_3382 225
75 3300044706 Ga0466964_0049605 Ga0466964_0049605_229_918 225
76 3300044712 Ga0453684_0309203 Ga0453684_0309203_65_742 225
77 3300044719 Ga0466971_0027410 Ga0466971_0027410_97_786 225
78 3300044765 Ga0466970_0011713 Ga0466970_0011713_2435_3124 225
79 3300045049 Ga0466959_0026727 Ga0466959_0026727_757_1446 225
80 3300046525 Ga0495663_0040646 Ga0495663_0040646_544_1224 225
81 3300046528 Ga0495642_0033405 Ga0495642_0033405_1182_1862 225
82 3300046615 Ga0495656_0008462 Ga0495656_0008462_81_761 225
83 3300046691 Ga0495670_0319017 Ga0495670_0319017_129_809 225
84 3300047447 Ga0495685_044211 Ga0495685_044211_387_1067 225
85 3300049571 Ga0501034_0038138 Ga0501034_0038138_3395_4087 225
86 3300049579 Ga0501043_0356075 Ga0501043_0356075_276_968 225
87 3300049580 Ga0501046_0104015 Ga0501046_0104015_792_1484 225
88 3300049581 Ga0501047_0025619 Ga0501047_0025619_4394_5086 225
89 3300049742 Ga0501080_0080843 Ga0501080_0080843_892_1584 225
90 3300049822 Ga0501035_0015734 Ga0501035_0015734_392_1084 225
91 3300061719 Ga0466962_0012492 Ga0466962_0012492_147_836 225
92 iso_pu_bacteria 2881101125 2881102918 225
93 3300005328 Ga0070676_10126379 Ga0070676_101263792 226
94 3300005329 Ga0070683_100072069 Ga0070683_1000720692 226
95 3300005329 Ga0070683_100362904 Ga0070683_1003629042 226
96 3300005334 Ga0068869_100003076 Ga0068869_10000307615 226
97 3300005335 Ga0070666_10090035 Ga0070666_100900352 226
98 3300005336 Ga0070680_100507524 Ga0070680_1005075241 226
99 3300005338 Ga0068868_100179194 Ga0068868_1001791942 226
100 3300005339 Ga0070660_100307034 Ga0070660_1003070342 226
101 3300005344 Ga0070661_100075267 Ga0070661_1000752672 226
102 3300005344 Ga0070661_100386237 Ga0070661_1003862372 226
103 3300005345 Ga0070692_10395974 Ga0070692_103959741 226
104 3300005347 Ga0070668_100044881 Ga0070668_1000448812 226
105 3300005354 Ga0070675_100001332 Ga0070675_10000133211 226
106 3300005366 Ga0070659_100006591 Ga0070659_10000659111 226
107 3300005366 Ga0070659_100244258 Ga0070659_1002442581 226
108 3300005367 Ga0070667_100186723 Ga0070667_1001867232 226
109 3300005455 Ga0070663_100015570 Ga0070663_1000155705 226
110 3300005456 Ga0070678_100319350 Ga0070678_1003193502 226
111 3300005457 Ga0070662_100039923 Ga0070662_1000399233 226
112 3300005535 Ga0070684_100088817 Ga0070684_1000888172 226
113 3300005543 Ga0070672_100043838 Ga0070672_1000438385 226
114 3300005563 Ga0068855_100742838 Ga0068855_1007428381 226
115 3300005578 Ga0068854_100009054 Ga0068854_1000090545 226
116 3300005614 Ga0068856_100041290 Ga0068856_1000412904 226
117 3300005615 Ga0070702_100160247 Ga0070702_1001602472 226
118 3300005616 Ga0068852_100000615 Ga0068852_10000061529 226
119 3300005616 Ga0068852_100208331 Ga0068852_1002083312 226
120 3300005618 Ga0068864_100051167 Ga0068864_1000511673 226
121 3300005719 Ga0068861_100000384 Ga0068861_10000038427 226
122 3300005834 Ga0068851_10017104 Ga0068851_100171043 226
123 3300005834 Ga0068851_10342024 Ga0068851_103420242 226
124 3300005842 Ga0068858_100006859 Ga0068858_1000068595 226
125 3300005843 Ga0068860_100007870 Ga0068860_10000787014 226
126 3300005843 Ga0068860_100046656 Ga0068860_1000466562 226
127 3300005844 Ga0068862_100041574 Ga0068862_1000415744 226
128 3300006237 Ga0097621_100174729 Ga0097621_1001747292 226
129 3300006358 Ga0068871_100090646 Ga0068871_1000906462 226
130 3300006880 Ga0075429_100530232 Ga0075429_1005302321 226
131 3300009093 Ga0105240_10760754 Ga0105240_107607542 226
132 3300009094 Ga0111539_11053104 Ga0111539_110531042 226
133 3300009098 Ga0105245_10021575 Ga0105245_1002157510 226
134 3300009174 Ga0105241_10060119 Ga0105241_100601192 226
135 3300009177 Ga0105248_10007485 Ga0105248_1000748511 226
136 3300009545 Ga0105237_10099539 Ga0105237_100995392 226
137 3300009551 Ga0105238_10107029 Ga0105238_101070293 226
138 3300009551 Ga0105238_10188888 Ga0105238_101888882 226
139 3300010375 Ga0105239_10030967 Ga0105239_100309673 226
140 3300013105 Ga0157369_10116573 Ga0157369_101165733 226
141 3300013296 Ga0157374_10009696 Ga0157374_100096966 226
142 3300013296 Ga0157374_10580235 Ga0157374_105802352 226
143 3300013306 Ga0163162_10000830 Ga0163162_1000083012 226
144 3300013307 Ga0157372_10015817 Ga0157372_1001581713 226
145 3300013307 Ga0157372_10066444 Ga0157372_100664443 226
146 3300013308 Ga0157375_10748051 Ga0157375_107480512 226
147 3300014326 Ga0157380_10008226 Ga0157380_100082268 226
148 3300014745 Ga0157377_10022908 Ga0157377_100229082 226
149 3300014968 Ga0157379_10001870 Ga0157379_100018705 226
150 3300014968 Ga0157379_10014560 Ga0157379_1001456012 226
151 3300014969 Ga0157376_10125291 Ga0157376_101252912 226
152 3300017792 Ga0163161_10013308 Ga0163161_100133089 226
153 3300021361 Ga0213872_10000004 Ga0213872_100000048 226
154 3300025284 Ga0209130_1050140 Ga0209130_10501401 226
155 3300025321 Ga0207656_10012195 Ga0207656_100121953 226
156 3300025321 Ga0207656_10133447 Ga0207656_101334472 226
157 3300025901 Ga0207688_10020026 Ga0207688_100200262 226
158 3300025903 Ga0207680_10120360 Ga0207680_101203602 226
159 3300025903 Ga0207680_10187565 Ga0207680_101875652 226
160 3300025907 Ga0207645_10017147 Ga0207645_100171478 226
161 3300025911 Ga0207654_10227811 Ga0207654_102278112 226
162 3300025913 Ga0207695_10504126 Ga0207695_105041262 226
163 3300025913 Ga0207695_10706040 Ga0207695_107060402 226
164 3300025914 Ga0207671_10047595 Ga0207671_100475953 226
165 3300025919 Ga0207657_10057474 Ga0207657_100574743 226
166 3300025919 Ga0207657_10094859 Ga0207657_100948592 226
167 3300025920 Ga0207649_10010725 Ga0207649_100107252 226
168 3300025920 Ga0207649_10107824 Ga0207649_101078242 226
169 3300025923 Ga0207681_10015331 Ga0207681_100153313 226
170 3300025924 Ga0207694_10230887 Ga0207694_102308872 226
171 3300025926 Ga0207659_10066978 Ga0207659_100669782 226
172 3300025927 Ga0207687_10063014 Ga0207687_100630143 226
173 3300025932 Ga0207690_10019744 Ga0207690_100197443 226
174 3300025933 Ga0207706_10006991 Ga0207706_100069912 226
175 3300025940 Ga0207691_10097268 Ga0207691_100972682 226
176 3300025941 Ga0207711_10013899 Ga0207711_1001389911 226
177 3300025942 Ga0207689_10000856 Ga0207689_100008563 226
178 3300025944 Ga0207661_10312767 Ga0207661_103127672 226
179 3300025945 Ga0207679_10277341 Ga0207679_102773411 226
180 3300025949 Ga0207667_10292227 Ga0207667_102922272 226
181 3300025949 Ga0207667_10817060 Ga0207667_108170602 226
182 3300025972 Ga0207668_10042974 Ga0207668_100429742 226
183 3300025981 Ga0207640_10091237 Ga0207640_100912372 226
184 3300025986 Ga0207658_10023177 Ga0207658_100231777 226
185 3300025986 Ga0207658_10548375 Ga0207658_105483751 226
186 3300026023 Ga0207677_10035957 Ga0207677_100359572 226
187 3300026035 Ga0207703_10033407 Ga0207703_100334072 226
188 3300026035 Ga0207703_10105155 Ga0207703_101051552 226
189 3300026067 Ga0207678_10019938 Ga0207678_100199382 226
190 3300026078 Ga0207702_10383974 Ga0207702_103839742 226
191 3300026095 Ga0207676_10015011 Ga0207676_100150115 226
192 3300026095 Ga0207676_10818858 Ga0207676_108188582 226
193 3300026116 Ga0207674_10227486 Ga0207674_102274862 226
194 3300026118 Ga0207675_100000879 Ga0207675_10000087911 226
195 3300026121 Ga0207683_10239941 Ga0207683_102399412 226
196 3300026142 Ga0207698_10003937 Ga0207698_100039372 226
197 3300026142 Ga0207698_10018671 Ga0207698_100186712 226
198 3300028380 Ga0268265_10185860 Ga0268265_101858602 226
199 3300028381 Ga0268264_10033051 Ga0268264_100330512 226
200 3300028381 Ga0268264_10083977 Ga0268264_100839772 226
201 3300028786 Ga0307517_10258351 Ga0307517_102583512 226
202 3300031239 Ga0265328_10002207 Ga0265328_100022076 226
203 3300031251 Ga0265327_10000341 Ga0265327_1000034140 226
204 3300035112 Ga0373932_0131158 Ga0373932_0131158_132_830 226
205 3300035241 Ga0373961_0041338 Ga0373961_0041338_119_817 226
206 3300035691 Ga0373931_0002539 Ga0373931_0002539_2297_2995 226
207 3300037418 Ga0395900_0498060 Ga0395900_0498060_216_905 226
208 3300037466 Ga0395898_0215028 Ga0395898_0215028_885_1568 226
209 3300037471 Ga0395905_0016841 Ga0395905_0016841_5670_6356 226
210 3300037471 Ga0395905_0023364 Ga0395905_0023364_1189_1884 226
211 3300037471 Ga0395905_0025632 Ga0395905_0025632_3376_4068 226
212 3300037471 Ga0395905_0387726 Ga0395905_0387726_68_757 226
213 3300038443 Ga0395901_1001130 Ga0395901_1001130_43_726 226
214 3300039447 Ga0436361_0371412 Ga0436361_0371412_13906_14595 226
215 3300039447 Ga0436361_0609661 Ga0436361_0609661_8140_8826 226
216 3300042125 Ga0450923_019287 Ga0450923_019287_443_1201 226
217 3300042128 Ga0450897_004126 Ga0450897_004126_306_1064 226
218 3300042156 Ga0439446_0034022 Ga0439446_0034022_299_1057 226
219 3300044656 Ga0466969_0000007 Ga0466969_0000007_121596_122279 226
220 3300044656 Ga0466969_0009596 Ga0466969_0009596_2015_2707 226
221 3300044656 Ga0466969_0040450 Ga0466969_0040450_741_1439 226
222 3300044684 Ga0466966_0019857 Ga0466966_0019857_83_766 226
223 3300044684 Ga0466966_0135736 Ga0466966_0135736_491_1189 226
224 3300044684 Ga0466966_0200626 Ga0466966_0200626_406_1095 226
225 3300044719 Ga0466971_0096394 Ga0466971_0096394_345_1031 226
226 3300044842 Ga0466957_0135235 Ga0466957_0135235_116_814 226
227 3300045049 Ga0466959_0000073 Ga0466959_0000073_23733_24431 226
228 3300045049 Ga0466959_0222187 Ga0466959_0222187_420_1103 226
229 3300045051 Ga0451576_0324837 Ga0451576_0324837_447_1145 226
230 3300045976 Ga0466967_0004818 Ga0466967_0004818_1967_2665 226
231 3300048903 Ga0496100_0033359 Ga0496100_0033359_987_1685 226
232 3300048904 Ga0496101_0043145 Ga0496101_0043145_1074_1772 226
233 3300048905 Ga0496102_0077900 Ga0496102_0077900_866_1564 226
234 3300048907 Ga0496104_0182127 Ga0496104_0182127_521_1219 226
235 3300048909 Ga0496106_0042983 Ga0496106_0042983_1966_2664 226
236 3300048910 Ga0496107_0004328 Ga0496107_0004328_1743_2441 226
237 3300048911 Ga0496108_0130952 Ga0496108_0130952_18_716 226
238 3300048912 Ga0496109_0169394 Ga0496109_0169394_327_1025 226
239 3300048913 Ga0496110_0060922 Ga0496110_0060922_593_1291 226
240 3300048914 Ga0496111_0107889 Ga0496111_0107889_232_930 226
241 3300048915 Ga0496112_0543896 Ga0496112_0543896_255_953 226
242 3300048916 Ga0496113_0040769 Ga0496113_0040769_1450_2148 226
243 3300048917 Ga0496114_0194063 Ga0496114_0194063_309_1007 226
244 3300048918 Ga0496115_0064358 Ga0496115_0064358_1481_2179 226
245 3300048924 Ga0496121_0029537 Ga0496121_0029537_684_1364 226
246 3300048928 Ga0496125_0147661 Ga0496125_0147661_155_835 226
247 3300049571 Ga0501034_0660910 Ga0501034_0660910_166_864 226
248 iso_pu_bacteria 2643221609 2644059563 226
249 iso_pu_bacteria 2643221611 2644074705 226
250 iso_pu_bacteria 2643221652 2644293609 226
251 iso_pu_bacteria 2738543012 2739241093 226
252 iso_pu_bacteria 2816332133 2816471829 226
253 iso_pu_bacteria 2842733646 2842734164 226
254 3300005456 Ga0070678_100072757 Ga0070678_1000727573 227
255 3300005530 Ga0070679_100007237 Ga0070679_1000072371 227
256 3300005539 Ga0068853_100021163 Ga0068853_1000211632 227
257 3300005563 Ga0068855_100016435 Ga0068855_1000164356 227
258 3300009093 Ga0105240_10003836 Ga0105240_1000383614 227
259 3300009093 Ga0105240_10011131 Ga0105240_100111314 227
260 3300009545 Ga0105237_10001634 Ga0105237_1000163410 227
261 3300009551 Ga0105238_10007933 Ga0105238_1000793310 227
262 3300010375 Ga0105239_10002435 Ga0105239_100024356 227
263 3300025913 Ga0207695_10043897 Ga0207695_100438972 227
264 3300025913 Ga0207695_10158947 Ga0207695_101589472 227
265 3300025914 Ga0207671_10003234 Ga0207671_100032342 227
266 3300025917 Ga0207660_10068292 Ga0207660_100682922 227
267 3300025919 Ga0207657_10007783 Ga0207657_1000778314 227
268 3300025921 Ga0207652_10024848 Ga0207652_100248482 227
269 3300025924 Ga0207694_10012902 Ga0207694_100129023 227
270 3300026041 Ga0207639_10029251 Ga0207639_100292514 227
271 3300026067 Ga0207678_10402427 Ga0207678_104024272 227
272 3300026121 Ga0207683_10153108 Ga0207683_101531083 227
273 3300026142 Ga0207698_10836299 Ga0207698_108362991 227
274 3300028786 Ga0307517_10072119 Ga0307517_100721194 227
275 3300028794 Ga0307515_10018709 Ga0307515_100187094 227
276 3300028794 Ga0307515_10026937 Ga0307515_100269374 227
277 3300031344 Ga0265316_10001758 Ga0265316_1000175811 227
278 3300031507 Ga0307509_10001098 Ga0307509_1000109812 227
279 3300031616 Ga0307508_10017316 Ga0307508_100173164 227
280 3300031730 Ga0307516_10000054 Ga0307516_1000005415 227
281 3300031730 Ga0307516_10244645 Ga0307516_102446452 227
282 3300033179 Ga0307507_10185446 Ga0307507_101854462 227
283 3300033180 Ga0307510_10015140 Ga0307510_100151405 227
284 3300033180 Ga0307510_10144665 Ga0307510_101446653 227
285 3300035691 Ga0373931_0029627 Ga0373931_0029627_37_732 227
286 3300037471 Ga0395905_0000025 Ga0395905_0000025_202038_202778 227
287 3300037471 Ga0395905_0058196 Ga0395905_0058196_751_1458 227
288 3300038725 Ga0400484_07608 Ga0400484_07608_1813_2511 227
289 3300038742 Ga0400486_14336 Ga0400486_14336_57_752 227
290 3300039062 Ga0400483_090995 Ga0400483_090995_7537_8235 227
291 3300044712 Ga0453684_0093521 Ga0453684_0093521_2970_3671 227
292 3300045051 Ga0451576_0079041 Ga0451576_0079041_1709_2410 227
293 3300046454 Ga0495592_0000863 Ga0495592_0000863_13191_13886 227
294 3300046459 Ga0495629_0202875 Ga0495629_0202875_239_934 227
295 3300046460 Ga0495638_0094229 Ga0495638_0094229_492_1187 227
296 3300046524 Ga0495648_0066463 Ga0495648_0066463_821_1516 227
297 3300046524 Ga0495648_0190164 Ga0495648_0190164_107_802 227
298 3300046526 Ga0495666_0062052 Ga0495666_0062052_967_1662 227
299 3300046526 Ga0495666_0065376 Ga0495666_0065376_811_1506 227
300 3300046557 Ga0495622_0031631 Ga0495622_0031631_1379_2074 227
301 3300046690 Ga0495624_0195502 Ga0495624_0195502_128_823 227
302 3300047315 Ga0495581_0111721 Ga0495581_0111721_246_941 227
303 3300047469 Ga0495673_0127289 Ga0495673_0127289_267_962 227
304 3300048912 Ga0496109_0131016 Ga0496109_0131016_77_760 227
305 3300048913 Ga0496110_0054831 Ga0496110_0054831_2665_3348 227
306 3300049569 Ga0501032_0141758 Ga0501032_0141758_466_1164 227
307 3300049822 Ga0501035_0139166 Ga0501035_0139166_373_1071 227
308 3300049823 Ga0501044_0128020 Ga0501044_0128020_872_1570 227
309 3300053131 Ga0500652_013698 Ga0500652_013698_1551_2249 227
310 3300053137 Ga0500561_0086661 Ga0500561_0086661_30_755 227
311 3300053154 Ga0500619_063949 Ga0500619_063949_272_967 227
312 3300053158 Ga0500627_0090295 Ga0500627_0090295_460_1185 227
313 iso_pu_bacteria 2721755763 2723878524 227
314 iso_pu_bacteria 2831864461 2831865486 227
315 3300005618 Ga0068864_100233657 Ga0068864_1002336572 228
316 3300005841 Ga0068863_100029895 Ga0068863_1000298952 228
317 3300026095 Ga0207676_10181010 Ga0207676_101810102 228
318 3300028794 Ga0307515_10183332 Ga0307515_101833322 228
319 3300031730 Ga0307516_10000398 Ga0307516_1000039839 228
320 3300005347 Ga0070668_100055174 Ga0070668_1000551742 229
321 3300005353 Ga0070669_100150282 Ga0070669_1001502821 229
322 3300005353 Ga0070669_100329636 Ga0070669_1003296361 229
323 3300005354 Ga0070675_100668617 Ga0070675_1006686171 229
324 3300005356 Ga0070674_100711545 Ga0070674_1007115451 229
325 3300005367 Ga0070667_100660213 Ga0070667_1006602132 229
326 3300005456 Ga0070678_100417786 Ga0070678_1004177861 229
327 3300005457 Ga0070662_100546207 Ga0070662_1005462072 229
328 3300005459 Ga0068867_100126739 Ga0068867_1001267392 229
329 3300005543 Ga0070672_100395732 Ga0070672_1003957322 229
330 3300005548 Ga0070665_100026163 Ga0070665_1000261636 229
331 3300005548 Ga0070665_100309982 Ga0070665_1003099822 229
332 3300005564 Ga0070664_100783935 Ga0070664_1007839351 229
333 3300005618 Ga0068864_100066168 Ga0068864_1000661682 229
334 3300005719 Ga0068861_100329427 Ga0068861_1003294272 229
335 3300005843 Ga0068860_101136594 Ga0068860_1011365942 229
336 3300005844 Ga0068862_100040990 Ga0068862_1000409903 229
337 3300009148 Ga0105243_10273598 Ga0105243_102735981 229
338 3300013297 Ga0157378_10316251 Ga0157378_103162512 229
339 3300013306 Ga0163162_10438293 Ga0163162_104382932 229
340 3300014326 Ga0157380_10586393 Ga0157380_105863932 229
341 3300014969 Ga0157376_10079429 Ga0157376_100794293 229
342 3300017792 Ga0163161_10127064 Ga0163161_101270642 229
343 3300021384 Ga0213876_10114879 Ga0213876_101148792 229
344 3300025903 Ga0207680_10225413 Ga0207680_102254132 229
345 3300025907 Ga0207645_10227954 Ga0207645_102279541 229
346 3300025920 Ga0207649_10498131 Ga0207649_104981311 229
347 3300025921 Ga0207652_10045633 Ga0207652_100456333 229
348 3300025923 Ga0207681_10287046 Ga0207681_102870462 229
349 3300025925 Ga0207650_10464806 Ga0207650_104648062 229
350 3300025926 Ga0207659_10250822 Ga0207659_102508221 229
351 3300025926 Ga0207659_10775598 Ga0207659_107755981 229
352 3300025927 Ga0207687_10069245 Ga0207687_100692454 229
353 3300025931 Ga0207644_10075627 Ga0207644_100756273 229
354 3300025933 Ga0207706_10541133 Ga0207706_105411332 229
355 3300025933 Ga0207706_10729047 Ga0207706_107290471 229
356 3300025937 Ga0207669_10071747 Ga0207669_100717474 229
357 3300025940 Ga0207691_10146774 Ga0207691_101467741 229
358 3300025941 Ga0207711_10197588 Ga0207711_101975882 229
359 3300025942 Ga0207689_10419291 Ga0207689_104192912 229
360 3300025960 Ga0207651_10092202 Ga0207651_100922022 229
361 3300025961 Ga0207712_10024887 Ga0207712_100248877 229
362 3300025986 Ga0207658_10436660 Ga0207658_104366602 229
363 3300026023 Ga0207677_10140180 Ga0207677_101401801 229
364 3300026089 Ga0207648_10294368 Ga0207648_102943682 229
365 3300026095 Ga0207676_10070033 Ga0207676_100700333 229
366 3300026118 Ga0207675_100371154 Ga0207675_1003711542 229
367 3300026121 Ga0207683_10127732 Ga0207683_101277323 229
368 3300028379 Ga0268266_10063255 Ga0268266_100632554 229
369 3300028380 Ga0268265_10066840 Ga0268265_100668402 229
370 3300031548 Ga0307408_100000296 Ga0307408_10000029637 229
371 3300031901 Ga0307406_10000499 Ga0307406_100004992 229
372 3300037312 Ga0395899_0029996 Ga0395899_0029996_1160_1912 229
373 3300037418 Ga0395900_0000058 Ga0395900_0000058_94462_95190 229
374 3300037418 Ga0395900_0070382 Ga0395900_0070382_1153_1905 229
375 3300037466 Ga0395898_0000283 Ga0395898_0000283_40385_41113 229
376 3300037466 Ga0395898_0037496 Ga0395898_0037496_2295_3047 229
377 3300038443 Ga0395901_0078598 Ga0395901_0078598_2584_3336 229
378 3300039437 Ga0436365_1842446 Ga0436365_1842446_2371_3096 229
379 3300041404 Ga0439436_0067245 Ga0439436_0067245_262_987 229
380 3300042007 Ga0439449_0002125 Ga0439449_0002125_6813_7538 229
381 3300042439 Ga0439464_0028116 Ga0439464_0028116_796_1506 229
382 3300042876 Ga0451577_0106813 Ga0451577_0106813_365_1129 229
383 3300044673 Ga0453683_0008042 Ga0453683_0008042_1543_2271 229
384 3300044712 Ga0453684_0390890 Ga0453684_0390890_447_1211 229
385 3300044735 Ga0466968_0011931 Ga0466968_0011931_729_1508 229
386 3300045051 Ga0451576_0024152 Ga0451576_0024152_2324_3052 229
387 3300045051 Ga0451576_0737072 Ga0451576_0737072_134_898 229
388 3300046539 Ga0495621_0013480 Ga0495621_0013480_1438_2142 229
389 3300048904 Ga0496101_0706066 Ga0496101_0706066_46_750 229
390 3300048907 Ga0496104_0160139 Ga0496104_0160139_1178_1882 229
391 3300048917 Ga0496114_0099325 Ga0496114_0099325_634_1338 229
392 3300049581 Ga0501047_0210893 Ga0501047_0210893_893_1630 229
393 3300059424 Ga0590075_061557 Ga0590075_061557_123_872 229
394 3300059426 Ga0590077_043182 Ga0590077_043182_12_761 229
395 iso_pu_bacteria 2643221596 2643993994 229
396 iso_pu_bacteria 2990710928 2990713634 229
397 3300001979 JGI24740J21852_10021281 JGI24740J21852_100212812 230
398 3300003794 Ga0055531_10009072 Ga0055531_100090722 230
399 3300005331 Ga0070670_100002208 Ga0070670_10000220822 230
400 3300005331 Ga0070670_100181780 Ga0070670_1001817802 230
401 3300005333 Ga0070677_10088615 Ga0070677_100886151 230
402 3300005353 Ga0070669_100036437 Ga0070669_1000364373 230
403 3300005353 Ga0070669_100247364 Ga0070669_1002473642 230
404 3300005354 Ga0070675_100051929 Ga0070675_1000519292 230
405 3300005354 Ga0070675_100060990 Ga0070675_1000609901 230
406 3300005356 Ga0070674_100199006 Ga0070674_1001990062 230
407 3300005364 Ga0070673_100042252 Ga0070673_1000422524 230
408 3300005364 Ga0070673_100120950 Ga0070673_1001209502 230
409 3300005456 Ga0070678_100024292 Ga0070678_1000242925 230
410 3300005456 Ga0070678_100053793 Ga0070678_1000537932 230
411 3300005457 Ga0070662_100110803 Ga0070662_1001108032 230
412 3300005457 Ga0070662_100185128 Ga0070662_1001851282 230
413 3300005459 Ga0068867_100182873 Ga0068867_1001828732 230
414 3300005543 Ga0070672_100008285 Ga0070672_1000082852 230
415 3300005564 Ga0070664_100253021 Ga0070664_1002530212 230
416 3300005617 Ga0068859_101056010 Ga0068859_1010560101 230
417 3300005618 Ga0068864_100001994 Ga0068864_1000019942 230
418 3300005841 Ga0068863_100099810 Ga0068863_1000998102 230
419 3300006353 Ga0075370_10035059 Ga0075370_100350592 230
420 3300006358 Ga0068871_100367993 Ga0068871_1003679932 230
421 3300006931 Ga0097620_101056030 Ga0097620_1010560301 230
422 3300012497 Ga0157319_1000016 Ga0157319_10000169 230
423 3300013296 Ga0157374_10085973 Ga0157374_100859732 230
424 3300013308 Ga0157375_10002326 Ga0157375_1000232633 230
425 3300014325 Ga0163163_10532849 Ga0163163_105328492 230
426 3300014326 Ga0157380_10123305 Ga0157380_101233052 230
427 3300014969 Ga0157376_10045808 Ga0157376_100458083 230
428 3300025273 Ga0209673_1040048 Ga0209673_10400482 230
429 3300025295 Ga0209564_1000008 Ga0209564_1000008848 230
430 3300025299 Ga0209256_1002812 Ga0209256_10028129 230
431 3300025304 Ga0209257_1001623 Ga0209257_100162316 230
432 3300025321 Ga0207656_10159720 Ga0207656_101597202 230
433 3300025893 Ga0207682_10017191 Ga0207682_100171913 230
434 3300025893 Ga0207682_10094469 Ga0207682_100944692 230
435 3300025901 Ga0207688_10288256 Ga0207688_102882562 230
436 3300025925 Ga0207650_10005150 Ga0207650_100051505 230
437 3300025925 Ga0207650_10143301 Ga0207650_101433012 230
438 3300025926 Ga0207659_10363502 Ga0207659_103635021 230
439 3300025931 Ga0207644_10010073 Ga0207644_100100734 230
440 3300025933 Ga0207706_10081479 Ga0207706_100814793 230
441 3300025940 Ga0207691_10006709 Ga0207691_1000670921 230
442 3300025940 Ga0207691_10030588 Ga0207691_100305883 230
443 3300025940 Ga0207691_10125284 Ga0207691_101252842 230
444 3300025945 Ga0207679_10204990 Ga0207679_102049902 230
445 3300025960 Ga0207651_10095313 Ga0207651_100953132 230
446 3300026035 Ga0207703_10442811 Ga0207703_104428112 230
447 3300026089 Ga0207648_10537361 Ga0207648_105373611 230
448 3300026095 Ga0207676_10013641 Ga0207676_100136412 230
449 3300026121 Ga0207683_10042058 Ga0207683_100420585 230
450 3300026121 Ga0207683_10077671 Ga0207683_100776713 230
451 3300035410 Ga0373924_0058126 Ga0373924_0058126_691_1425 230
452 3300035692 Ga0373935_0069443 Ga0373935_0069443_995_1729 230
453 3300035724 Ga0373933_0335488 Ga0373933_0335488_66_800 230
454 3300036401 Ga0373937_0050900 Ga0373937_0050900_1535_2269 230
455 3300037068 Ga0373925_0219581 Ga0373925_0219581_702_1436 230
456 3300037418 Ga0395900_0052384 Ga0395900_0052384_2955_3689 230
457 3300042127 Ga0450890_001391 Ga0450890_001391_1350_2099 230
458 3300046514 Ga0495618_0164591 Ga0495618_0164591_663_1397 230
459 3300046539 Ga0495621_0001659 Ga0495621_0001659_2274_3005 230
460 3300046663 Ga0495635_0213562 Ga0495635_0213562_349_1083 230
461 3300046683 Ga0495658_0145411 Ga0495658_0145411_164_898 230
462 3300047319 Ga0495674_0172668 Ga0495674_0172668_313_1047 230
463 3300048911 Ga0496108_0013424 Ga0496108_0013424_2933_3682 230
464 3300048913 Ga0496110_0212923 Ga0496110_0212923_839_1588 230
465 3300050496 nmdc:mga07m45_3118_c1 nmdc:mga07m45_3118_c1_113_862 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

34

176

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9769 11 230
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9686 9 230
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9678 9 230
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9654 9 230
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9647 10 230
ID Description Score Start End Superfamily
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9721 9 229 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9714 37 230 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9686 9 230 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9685 10 230 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9662 9 230 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A353M4F4-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD 0.9886 47 207 GO:0005524
GO:0005886
GO:0016887
AF-A0A2D4VMT8-F1-model_v4 ABC transporter 0.9857 9 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A7C3WP49-F1-model_v4 ABC transporter ATP-binding protein 0.9832 9 230 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A353M4F4-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD 0.9826 47 207 GO:0005524
GO:0005886
GO:0016887
AF-A0A538BD68-F1-model_v4 ABC transporter ATP-binding protein 0.9799 11 230 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
92.94 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map