F449439

General Info

Members Datasets Scaffolds Average Seq Length
465 186 465 178

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100010517|Ga0070659_1000105174
Length 186
Sequence LTLRQGSRQDDWRGQVLKFWFGLDPQTWWRGGDQVDHRIKQNFLKLWVEKRQLPVEAFTGDPLTSLAAVILFDQLPRNMFRGDAEQFATDHLALAIAKGAIDKGFDEQLERQERGFLYMPFQHSEQVADQDRSMLLFTALGDDYQLGYAKKHHEVIARFGRFPHRNEMLGRAPRADEIAAGDVVPW

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
167 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.38
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4604851 2162886011 Bacteria 814
2 JGI24736J21556_1010664 3300001904 Bacteria 1500
3 JGI24741J21665_1000304 3300001915 Bacteria 14779
4 JGI24752J21851_1006776 3300001976 Bacteria 1498
5 JGI24740J21852_10000281 3300001979 Bacteria 21617
6 JGI24740J21852_10000432 3300001979 Bacteria 17873
7 JGI24740J21852_10001858 3300001979 Bacteria 9669
8 JGI24739J22299_10000244 3300001989 Bacteria 18398
9 JGI24739J22299_10000914 3300001989 Bacteria 10953
10 JGI24739J22299_10024487 3300001989 Bacteria 2128
11 JGI24737J22298_10000021 3300001990 Bacteria 45543
12 JGI24737J22298_10083047 3300001990 Bacteria 953
13 JGI24737J22298_10089279 3300001990 Bacteria 915
14 JGI24735J21928_10018541 3300002067 Bacteria 2144
15 JGI24748J21848_1003721 3300002074 Bacteria 1743
16 JGI24738J21930_10000082 3300002075 Bacteria 21091
17 JGI24744J21845_10019092 3300002077 Bacteria 1356
18 JGI24742J22300_10011246 3300002244 Bacteria 1484
19 rootH1_10329372 3300003323 Bacteria 1252
20 Ga0065712_10107630 3300005290 Bacteria 1868
21 Ga0065712_10309642 3300005290 Bacteria 834
22 Ga0070658_10027614 3300005327 Bacteria 4552
23 Ga0070658_10084709 3300005327 Bacteria 2606
24 Ga0070658_10232574 3300005327 Bacteria 1561
25 Ga0070676_10009191 3300005328 Bacteria 5342
26 Ga0070676_10126932 3300005328 Bacteria 1608
27 Ga0070683_100006161 3300005329 Bacteria 10058
28 Ga0070683_100051975 3300005329 Bacteria 3795
29 Ga0070670_100014667 3300005331 Bacteria 6728
30 Ga0070670_100016938 3300005331 Bacteria 6255
31 Ga0070670_100028233 3300005331 Bacteria 4829
32 Ga0070670_100557602 3300005331 Bacteria 1022
33 Ga0070670_100773788 3300005331 Bacteria 866
34 Ga0068869_100011031 3300005334 Bacteria 5919
35 Ga0068869_100340715 3300005334 Bacteria 1220
36 Ga0070666_10015565 3300005335 Bacteria 4853
37 Ga0070666_10035962 3300005335 Bacteria 3285
38 Ga0070666_10138102 3300005335 Bacteria 1697
39 Ga0070680_100000499 3300005336 Bacteria 26967
40 Ga0070680_100863879 3300005336 Bacteria 780
41 Ga0070682_100016503 3300005337 Bacteria 4294
42 Ga0070682_100092465 3300005337 Bacteria 1982
43 Ga0070682_100150536 3300005337 Bacteria 1596
44 Ga0068868_100000637 3300005338 Bacteria 23618
45 Ga0070660_100057027 3300005339 Bacteria 3024
46 Ga0070660_100066817 3300005339 Bacteria 2800
47 Ga0070660_100538767 3300005339 Bacteria 973
48 Ga0070687_100053102 3300005343 Bacteria 2106
49 Ga0070687_100220109 3300005343 Bacteria 1162
50 Ga0070661_100005039 3300005344 Bacteria 9110
51 Ga0070661_100113707 3300005344 Bacteria 2023
52 Ga0070692_10057377 3300005345 Bacteria 2041
53 Ga0070668_100059896 3300005347 Bacteria 2947
54 Ga0070668_100843957 3300005347 Bacteria 816
55 Ga0070669_100016384 3300005353 Bacteria 5287
56 Ga0070669_100023107 3300005353 Bacteria 4451
57 Ga0070669_100448907 3300005353 Bacteria 1063
58 Ga0070671_100009526 3300005355 Bacteria 7798
59 Ga0070671_100014608 3300005355 Bacteria 6349
60 Ga0070671_100034356 3300005355 Bacteria 4197
61 Ga0070671_100112880 3300005355 Bacteria 2283
62 Ga0070671_100259258 3300005355 Bacteria 1477
63 Ga0070671_100288038 3300005355 Bacteria 1397
64 Ga0070674_100014594 3300005356 Bacteria 4887
65 Ga0070674_100052634 3300005356 Bacteria 2809
66 Ga0070674_100399904 3300005356 Bacteria 1122
67 Ga0070673_100000209 3300005364 Bacteria 29078
68 Ga0070673_100020208 3300005364 Bacteria 4799
69 Ga0070673_100025695 3300005364 Bacteria 4339
70 Ga0070673_100206653 3300005364 Bacteria 1693
71 Ga0070659_100001928 3300005366 Bacteria 14819
72 Ga0070659_100010517 3300005366 Bacteria 6809
73 Ga0070659_100065982 3300005366 Bacteria 2867
74 Ga0070659_100090022 3300005366 Bacteria 2459
75 Ga0070659_100098857 3300005366 Bacteria 2347
76 Ga0070659_100658909 3300005366 Bacteria 903
77 Ga0070667_100001148 3300005367 Bacteria 24009
78 Ga0070667_100017583 3300005367 Bacteria 5925
79 Ga0070667_100288601 3300005367 Bacteria 1475
80 Ga0070667_100507226 3300005367 Bacteria 1106
81 Ga0070667_100809704 3300005367 Bacteria 870
82 Ga0070667_100944333 3300005367 Bacteria 803
83 Ga0070713_100629744 3300005436 Bacteria 1020
84 Ga0070663_100010582 3300005455 Bacteria 5754
85 Ga0070663_100027702 3300005455 Bacteria 3850
86 Ga0070663_100047488 3300005455 Bacteria 3041
87 Ga0070663_100135939 3300005455 Bacteria 1872
88 Ga0070663_100343438 3300005455 Bacteria 1207
89 Ga0070663_100406830 3300005455 Bacteria 1113
90 Ga0070678_100203482 3300005456 Bacteria 1636
91 Ga0070662_100001649 3300005457 Bacteria 13729
92 Ga0070662_100002054 3300005457 Bacteria 12334
93 Ga0070662_100011288 3300005457 Bacteria 5890
94 Ga0070662_100045421 3300005457 Bacteria 3152
95 Ga0070662_100104304 3300005457 Bacteria 2151
96 Ga0070662_100106522 3300005457 Bacteria 2130
97 Ga0070662_100177064 3300005457 Bacteria 1679
98 Ga0070662_100189243 3300005457 Bacteria 1626
99 Ga0070662_100204369 3300005457 Bacteria 1569
100 Ga0070681_10601380 3300005458 Bacteria 1014
101 Ga0070681_10823264 3300005458 Bacteria 846
102 Ga0068867_100000633 3300005459 Bacteria 23213
103 Ga0070679_100000001 3300005530 Bacteria 764811
104 Ga0070684_100097752 3300005535 Bacteria 2619
105 Ga0068853_100002063 3300005539 Bacteria 14889
106 Ga0068853_100018426 3300005539 Bacteria 5778
107 Ga0068853_100402799 3300005539 Bacteria 1281
108 Ga0068853_100542070 3300005539 Bacteria 1101
109 Ga0070672_100012738 3300005543 Bacteria 5919
110 Ga0070696_100067516 3300005546 Bacteria 2510
111 Ga0070693_100012860 3300005547 Bacteria 4248
112 Ga0070693_100123177 3300005547 Bacteria 1611
113 Ga0070693_100125459 3300005547 Bacteria 1598
114 Ga0070693_100571626 3300005547 Bacteria 812
115 Ga0070665_100000590 3300005548 Bacteria 50563
116 Ga0070665_100031421 3300005548 Bacteria 5345
117 Ga0070665_100891837 3300005548 Bacteria 902
118 Ga0068855_100008129 3300005563 Bacteria 12680
119 Ga0068855_100035353 3300005563 Bacteria 5952
120 Ga0068855_100057562 3300005563 Bacteria 4556
121 Ga0068855_101096167 3300005563 Bacteria 832
122 Ga0070664_100009810 3300005564 Bacteria 7758
123 Ga0070664_100012119 3300005564 Bacteria 7002
124 Ga0070664_100020515 3300005564 Bacteria 5442
125 Ga0070664_100050715 3300005564 Bacteria 3513
126 Ga0070664_100061549 3300005564 Bacteria 3199
127 Ga0070664_100177974 3300005564 Bacteria 1889
128 Ga0070664_100314125 3300005564 Bacteria 1418
129 Ga0070664_100755930 3300005564 Bacteria 907
130 Ga0070664_100888794 3300005564 Bacteria 835
131 Ga0068857_100000570 3300005577 Bacteria 26956
132 Ga0068857_100009347 3300005577 Bacteria 8511
133 Ga0068857_100020536 3300005577 Bacteria 5810
134 Ga0068857_100164321 3300005577 Bacteria 2015
135 Ga0068854_100005509 3300005578 Bacteria 7997
136 Ga0068854_100007545 3300005578 Bacteria 6950
137 Ga0068854_100095872 3300005578 Bacteria 2215
138 Ga0068854_100760226 3300005578 Bacteria 841
139 Ga0068856_100978691 3300005614 Bacteria 864
140 Ga0068852_100000446 3300005616 Bacteria 27187
141 Ga0068852_100118792 3300005616 Bacteria 2416
142 Ga0068852_100135718 3300005616 Bacteria 2271
143 Ga0068852_100147842 3300005616 Bacteria 2181
144 Ga0068852_100150134 3300005616 Bacteria 2166
145 Ga0068852_100471134 3300005616 Bacteria 1246
146 Ga0068859_100000478 3300005617 Bacteria 39430
147 Ga0068864_100000174 3300005618 Bacteria 59338
148 Ga0068864_100003287 3300005618 Bacteria 13355
149 Ga0068864_100004705 3300005618 Bacteria 11194
150 Ga0068864_100011378 3300005618 Bacteria 7353
151 Ga0068866_10513525 3300005718 Bacteria 795
152 Ga0068851_10027270 3300005834 Bacteria 2814
153 Ga0068851_10156475 3300005834 Bacteria 1249
154 Ga0068870_10053833 3300005840 Bacteria 2139
155 Ga0068863_100011027 3300005841 Bacteria 8767
156 Ga0068863_100029507 3300005841 Bacteria 5235
157 Ga0068863_100121740 3300005841 Bacteria 2488
158 Ga0068858_100000600 3300005842 Bacteria 37662
159 Ga0068860_100069187 3300005843 Bacteria 3355
160 Ga0097621_100086047 3300006237 Bacteria 2622
161 Ga0097621_101053861 3300006237 Bacteria 762
162 Ga0068871_100014538 3300006358 Bacteria 5871
163 Ga0068871_100052836 3300006358 Bacteria 3292
164 Ga0075429_100336967 3300006880 Bacteria 1320
165 Ga0068865_100000240 3300006881 Bacteria 30384
166 Ga0097620_100000478 3300006931 Bacteria 39430
167 Ga0105251_10053026 3300009011 Bacteria 1929
168 Ga0105240_10703811 3300009093 Bacteria 1102
169 Ga0105245_10000300 3300009098 Bacteria 47446
170 Ga0105243_10056406 3300009148 Bacteria 3124
171 Ga0105241_10002793 3300009174 Bacteria 13069
172 Ga0105241_10092429 3300009174 Bacteria 2389
173 Ga0105248_10002741 3300009177 Bacteria 19562
174 Ga0105248_10006633 3300009177 Bacteria 12692
175 Ga0105248_10214889 3300009177 Bacteria 2166
176 Ga0105248_10429269 3300009177 Bacteria 1488
177 Ga0105237_10289053 3300009545 Bacteria 1642
178 Ga0105238_10137448 3300009551 Bacteria 2421
179 Ga0105239_10118781 3300010375 Bacteria 2934
180 Ga0105246_10005263 3300011119 Bacteria 7871
181 Ga0157373_10131941 3300013100 Bacteria 1757
182 Ga0157373_10448330 3300013100 Bacteria 928
183 Ga0157371_10000677 3300013102 Bacteria 40414
184 Ga0157371_10094407 3300013102 Bacteria 2120
185 Ga0157369_10007317 3300013105 Bacteria 12709
186 Ga0157374_10249850 3300013296 Bacteria 1745
187 Ga0157374_10575414 3300013296 Bacteria 1135
188 Ga0157374_11361270 3300013296 Bacteria 732
189 Ga0157378_10002011 3300013297 Bacteria 18196
190 Ga0157372_10035190 3300013307 Bacteria 5511
191 Ga0157372_10056080 3300013307 Bacteria 4402
192 Ga0157372_10195110 3300013307 Bacteria 2346
193 Ga0157372_10217089 3300013307 Bacteria 2217
194 Ga0157375_10021146 3300013308 Bacteria 5960
195 Ga0163163_11178924 3300014325 Bacteria 829
196 Ga0157380_10388116 3300014326 Bacteria 1320
197 Ga0182008_10044086 3300014497 Bacteria 2219
198 Ga0157377_10096475 3300014745 Bacteria 1754
199 Ga0157379_10011600 3300014968 Bacteria 7696
200 Ga0163161_10618801 3300017792 Bacteria 894
201 Ga0207673_1000715 3300025290 Bacteria 3551
202 Ga0207697_10000026 3300025315 Bacteria 52498
203 Ga0207656_10028971 3300025321 Bacteria 2277
204 Ga0207656_10082711 3300025321 Bacteria 1445
205 Ga0207656_10133486 3300025321 Bacteria 1165
206 Ga0207682_10011024 3300025893 Bacteria 3538
207 Ga0207682_10065187 3300025893 Bacteria 1533
208 Ga0207642_10421906 3300025899 Bacteria 803
209 Ga0207688_10000055 3300025901 Bacteria 41067
210 Ga0207688_10433821 3300025901 Bacteria 818
211 Ga0207680_10035008 3300025903 Bacteria 2878
212 Ga0207680_10066088 3300025903 Bacteria 2223
213 Ga0207680_10095813 3300025903 Bacteria 1897
214 Ga0207680_10137881 3300025903 Bacteria 1614
215 Ga0207647_10011937 3300025904 Bacteria 6066
216 Ga0207647_10050113 3300025904 Bacteria 2587
217 Ga0207645_10014133 3300025907 Bacteria 5349
218 Ga0207645_10015763 3300025907 Bacteria 5012
219 Ga0207645_10151215 3300025907 Bacteria 1515
220 Ga0207643_10037984 3300025908 Bacteria 2704
221 Ga0207705_10003295 3300025909 Bacteria 12292
222 Ga0207705_10036469 3300025909 Bacteria 3518
223 Ga0207705_10076939 3300025909 Bacteria 2426
224 Ga0207705_10077104 3300025909 Bacteria 2424
225 Ga0207705_10132811 3300025909 Bacteria 1854
226 Ga0207705_10202106 3300025909 Bacteria 1506
227 Ga0207654_10150568 3300025911 Bacteria 1493
228 Ga0207707_10002141 3300025912 Bacteria 17883
229 Ga0207707_10074804 3300025912 Bacteria 2955
230 Ga0207695_10599119 3300025913 Bacteria 983
231 Ga0207671_10143796 3300025914 Bacteria 1839
232 Ga0207660_10002214 3300025917 Bacteria 12870
233 Ga0207660_10005781 3300025917 Bacteria 8027
234 Ga0207660_10574789 3300025917 Bacteria 917
235 Ga0207662_10080477 3300025918 Bacteria 1987
236 Ga0207657_10002401 3300025919 Bacteria 20253
237 Ga0207657_10038221 3300025919 Bacteria 4276
238 Ga0207657_10050634 3300025919 Bacteria 3614
239 Ga0207657_10076629 3300025919 Bacteria 2820
240 Ga0207657_10143613 3300025919 Bacteria 1948
241 Ga0207649_10050942 3300025920 Bacteria 2562
242 Ga0207649_10054470 3300025920 Bacteria 2489
243 Ga0207649_10083738 3300025920 Bacteria 2071
244 Ga0207649_10440204 3300025920 Bacteria 982
245 Ga0207649_10713654 3300025920 Bacteria 778
246 Ga0207652_10000002 3300025921 Bacteria 878035
247 Ga0207652_10011443 3300025921 Bacteria 7152
248 Ga0207652_10783071 3300025921 Bacteria 848
249 Ga0207652_10889412 3300025921 Bacteria 787
250 Ga0207681_10006475 3300025923 Bacteria 7190
251 Ga0207681_10057501 3300025923 Bacteria 2658
252 Ga0207681_10552014 3300025923 Bacteria 948
253 Ga0207681_10783468 3300025923 Bacteria 796
254 Ga0207694_10179794 3300025924 Bacteria 1715
255 Ga0207650_10038694 3300025925 Bacteria 3485
256 Ga0207650_10273983 3300025925 Bacteria 1372
257 Ga0207650_10320550 3300025925 Bacteria 1269
258 Ga0207650_10662730 3300025925 Bacteria 880
259 Ga0207687_10003666 3300025927 Bacteria 10346
260 Ga0207700_10483331 3300025928 Bacteria 1094
261 Ga0207664_10203114 3300025929 Bacteria 1712
262 Ga0207664_10215355 3300025929 Bacteria 1663
263 Ga0207664_11015078 3300025929 Bacteria 743
264 Ga0207644_10000052 3300025931 Bacteria 91473
265 Ga0207644_10027473 3300025931 Bacteria 3930
266 Ga0207644_10182200 3300025931 Bacteria 1647
267 Ga0207644_10191651 3300025931 Bacteria 1607
268 Ga0207644_10401561 3300025931 Bacteria 1120
269 Ga0207644_10770913 3300025931 Bacteria 804
270 Ga0207690_10001000 3300025932 Bacteria 18055
271 Ga0207690_10006748 3300025932 Bacteria 6804
272 Ga0207690_10052119 3300025932 Bacteria 2740
273 Ga0207690_10221280 3300025932 Bacteria 1448
274 Ga0207690_10396155 3300025932 Bacteria 1100
275 Ga0207690_10493320 3300025932 Bacteria 990
276 Ga0207706_10000278 3300025933 Bacteria 55758
277 Ga0207706_10009996 3300025933 Bacteria 8694
278 Ga0207706_10014251 3300025933 Bacteria 7204
279 Ga0207706_10092373 3300025933 Bacteria 2661
280 Ga0207706_10099789 3300025933 Bacteria 2554
281 Ga0207706_10188672 3300025933 Bacteria 1810
282 Ga0207706_10245197 3300025933 Bacteria 1566
283 Ga0207706_10275318 3300025933 Bacteria 1468
284 Ga0207706_10495738 3300025933 Bacteria 1055
285 Ga0207709_10390069 3300025935 Bacteria 1062
286 Ga0207669_10244638 3300025937 Bacteria 1332
287 Ga0207669_10334070 3300025937 Bacteria 1164
288 Ga0207704_10015117 3300025938 Bacteria 3923
289 Ga0207691_10000045 3300025940 Bacteria 99798
290 Ga0207691_10745369 3300025940 Bacteria 825
291 Ga0207711_10002953 3300025941 Bacteria 14871
292 Ga0207711_10048618 3300025941 Bacteria 3628
293 Ga0207711_10479986 3300025941 Bacteria 1158
294 Ga0207711_10540061 3300025941 Bacteria 1087
295 Ga0207689_10000182 3300025942 Bacteria 54476
296 Ga0207661_10020749 3300025944 Bacteria 4915
297 Ga0207661_10353896 3300025944 Bacteria 1325
298 Ga0207679_10008820 3300025945 Bacteria 6428
299 Ga0207679_10013464 3300025945 Bacteria 5363
300 Ga0207679_10033101 3300025945 Bacteria 3635
301 Ga0207679_10034825 3300025945 Bacteria 3557
302 Ga0207679_10074670 3300025945 Bacteria 2570
303 Ga0207679_10270044 3300025945 Bacteria 1454
304 Ga0207679_10340523 3300025945 Bacteria 1304
305 Ga0207679_10651029 3300025945 Bacteria 953
306 Ga0207679_10679128 3300025945 Bacteria 933
307 Ga0207667_10048363 3300025949 Bacteria 4497
308 Ga0207667_10058163 3300025949 Bacteria 4056
309 Ga0207667_10552100 3300025949 Bacteria 1165
310 Ga0207651_10000633 3300025960 Bacteria 14881
311 Ga0207651_10116105 3300025960 Bacteria 2020
312 Ga0207651_10442853 3300025960 Bacteria 1113
313 Ga0207668_10227579 3300025972 Bacteria 1501
314 Ga0207640_10000849 3300025981 Bacteria 17357
315 Ga0207640_10010451 3300025981 Bacteria 5228
316 Ga0207640_10172552 3300025981 Bacteria 1613
317 Ga0207640_10622666 3300025981 Bacteria 916
318 Ga0207658_10013020 3300025986 Bacteria 5681
319 Ga0207658_10106011 3300025986 Bacteria 2212
320 Ga0207658_10175026 3300025986 Bacteria 1771
321 Ga0207658_10725063 3300025986 Bacteria 899
322 Ga0207677_10017169 3300026023 Bacteria 4307
323 Ga0207677_10238917 3300026023 Bacteria 1468
324 Ga0207703_10022196 3300026035 Bacteria 4976
325 Ga0207639_10018415 3300026041 Bacteria 4961
326 Ga0207639_10020013 3300026041 Bacteria 4785
327 Ga0207639_10429276 3300026041 Bacteria 1196
328 Ga0207678_10008896 3300026067 Bacteria 8841
329 Ga0207678_10014184 3300026067 Bacteria 7006
330 Ga0207678_10021464 3300026067 Bacteria 5662
331 Ga0207678_10049159 3300026067 Bacteria 3644
332 Ga0207678_10169604 3300026067 Bacteria 1863
333 Ga0207678_10240303 3300026067 Bacteria 1551
334 Ga0207678_10538841 3300026067 Bacteria 1020
335 Ga0207678_10548154 3300026067 Bacteria 1011
336 Ga0207702_10034068 3300026078 Bacteria 4255
337 Ga0207702_10039707 3300026078 Bacteria 3945
338 Ga0207641_10079535 3300026088 Bacteria 2842
339 Ga0207641_10361155 3300026088 Bacteria 1386
340 Ga0207648_10000222 3300026089 Bacteria 61156
341 Ga0207676_10001410 3300026095 Bacteria 17854
342 Ga0207676_10004133 3300026095 Bacteria 10250
343 Ga0207676_10009108 3300026095 Bacteria 7070
344 Ga0207676_10064541 3300026095 Bacteria 2912
345 Ga0207674_10000284 3300026116 Bacteria 64099
346 Ga0207674_10000793 3300026116 Bacteria 41212
347 Ga0207674_10001981 3300026116 Bacteria 25946
348 Ga0207674_10012301 3300026116 Bacteria 9568
349 Ga0207674_10023342 3300026116 Bacteria 6628
350 Ga0207675_101236765 3300026118 Bacteria 767
351 Ga0207683_10053905 3300026121 Bacteria 3527
352 Ga0207698_10006662 3300026142 Bacteria 7220
353 Ga0207698_10136688 3300026142 Bacteria 2104
354 Ga0207698_10190758 3300026142 Bacteria 1825
355 Ga0207698_10424895 3300026142 Bacteria 1276
356 Ga0207698_10733798 3300026142 Bacteria 985
357 Ga0209967_1023126 3300027364 Bacteria 914
358 Ga0268266_10001084 3300028379 Bacteria 34117
359 Ga0268264_10094928 3300028381 Bacteria 2579
360 Ga0268264_10329014 3300028381 Bacteria 1447
361 Ga0307408_100375268 3300031548 Bacteria 1214
362 Ga0307408_100458398 3300031548 Bacteria 1107
363 Ga0307405_10199348 3300031731 Bacteria 1452
364 Ga0307405_10795354 3300031731 Bacteria 792
365 Ga0307410_10105817 3300031852 Bacteria 2026
366 Ga0307410_10164376 3300031852 Bacteria 1666
367 Ga0307406_10119516 3300031901 Bacteria 1829
368 Ga0307406_10127714 3300031901 Bacteria 1779
369 Ga0307406_10189508 3300031901 Bacteria 1504
370 Ga0307407_10223600 3300031903 Bacteria 1274
371 Ga0307412_10260206 3300031911 Bacteria 1352
372 Ga0307412_10596307 3300031911 Bacteria 935
373 Ga0307412_10681039 3300031911 Bacteria 880
374 Ga0307409_100275344 3300031995 Bacteria 1552
375 Ga0307416_100000426 3300032002 Bacteria 21506
376 Ga0307416_100455162 3300032002 Bacteria 1333
377 Ga0307416_101659068 3300032002 Bacteria 744
378 Ga0307416_101792828 3300032002 Bacteria 718
379 Ga0307414_11038219 3300032004 Bacteria 755
380 Ga0307411_10051302 3300032005 Bacteria 2690
381 Ga0307415_100016060 3300032126 Bacteria 4450
382 Ga0307415_100065264 3300032126 Bacteria 2536
383 Ga0307415_100187915 3300032126 Bacteria 1627
384 Ga0307415_100229324 3300032126 Bacteria 1494
385 Ga0373931_0202153 3300035691 Bacteria 1187
386 Ga0395899_0000157 3300037312 Bacteria 103574
387 Ga0395899_0005498 3300037312 Bacteria 9818
388 Ga0395899_0031909 3300037312 Bacteria 3958
389 Ga0395899_0261283 3300037312 Bacteria 1184
390 Ga0395899_0294981 3300037312 Bacteria 1099
391 Ga0395899_0323435 3300037312 Bacteria 1038
392 Ga0395899_0386598 3300037312 Bacteria 929
393 Ga0395900_0000296 3300037418 Bacteria 74995
394 Ga0395900_0013040 3300037418 Bacteria 8495
395 Ga0395900_0057762 3300037418 Bacteria 3995
396 Ga0395900_0250580 3300037418 Bacteria 1772
397 Ga0395900_0334110 3300037418 Bacteria 1492
398 Ga0395900_0923049 3300037418 Bacteria 795
399 Ga0395898_0000054 3300037466 Bacteria 279561
400 Ga0395898_0012372 3300037466 Bacteria 8824
401 Ga0395898_0055561 3300037466 Bacteria 3861
402 Ga0395898_0061652 3300037466 Bacteria 3644
403 Ga0395898_0078506 3300037466 Bacteria 3185
404 Ga0395898_0150021 3300037466 Bacteria 2231
405 Ga0395898_0892959 3300037466 Bacteria 827
406 Ga0395905_0000046 3300037471 Bacteria 240463
407 Ga0395905_0001856 3300037471 Bacteria 24336
408 Ga0395905_0013370 3300037471 Bacteria 7864
409 Ga0395905_0017019 3300037471 Bacteria 6902
410 Ga0395905_0019060 3300037471 Bacteria 6508
411 Ga0395905_0049072 3300037471 Bacteria 3955
412 Ga0395905_0052877 3300037471 Bacteria 3802
413 Ga0395905_0074142 3300037471 Bacteria 3189
414 Ga0395905_0150271 3300037471 Bacteria 2191
415 Ga0395905_0194185 3300037471 Bacteria 1903
416 Ga0395905_0200818 3300037471 Bacteria 1869
417 Ga0395905_0318560 3300037471 Bacteria 1445
418 Ga0395905_0365575 3300037471 Bacteria 1336
419 Ga0395905_0595354 3300037471 Bacteria 1007
420 Ga0395905_0700551 3300037471 Bacteria 915
421 Ga0395901_0001633 3300038443 Bacteria 23187
422 Ga0395901_0008013 3300038443 Bacteria 10668
423 Ga0395901_0043229 3300038443 Bacteria 4674
424 Ga0395901_0047022 3300038443 Bacteria 4483
425 Ga0395901_0057600 3300038443 Bacteria 4041
426 Ga0395901_0184331 3300038443 Bacteria 2189
427 Ga0395901_0307289 3300038443 Bacteria 1643
428 Ga0395901_0335517 3300038443 Bacteria 1562
429 Ga0395901_1104598 3300038443 Bacteria 763
430 Ga0451800_1265494 3300041459 Bacteria 734
431 Ga0439448_0009481 3300042005 Bacteria 2871
432 Ga0450889_010405 3300042144 Bacteria 960
433 Ga0439458_0000052 3300042157 Bacteria 19610
434 Ga0466963_0230677 3300044694 Bacteria 1297
435 Ga0453684_1326087 3300044712 Bacteria 750
436 Ga0466959_0049025 3300045049 Bacteria 3102
437 Ga0466958_0058851 3300045836 Bacteria 2337
438 Ga0495669_0006704 3300046684 Bacteria 4819
439 Ga0495669_0021969 3300046684 Bacteria 2772
440 Ga0496100_0503921 3300048903 Bacteria 933
441 Ga0496102_0018756 3300048905 Bacteria 6084
442 Ga0496103_0136671 3300048906 Bacteria 1566
443 Ga0496103_0310065 3300048906 Bacteria 1015
444 Ga0496104_0050059 3300048907 Bacteria 3942
445 Ga0496106_0059457 3300048909 Bacteria 2895
446 Ga0496107_0087602 3300048910 Bacteria 2273
447 Ga0496107_0295044 3300048910 Bacteria 1207
448 Ga0496108_0004150 3300048911 Bacteria 11653
449 Ga0496108_0091656 3300048911 Bacteria 2583
450 Ga0496108_0249164 3300048911 Bacteria 1545
451 Ga0496109_0008253 3300048912 Bacteria 8844
452 Ga0496109_0021967 3300048912 Bacteria 5649
453 Ga0496109_0728966 3300048912 Bacteria 929
454 Ga0496110_0056994 3300048913 Bacteria 3438
455 Ga0496110_0688395 3300048913 Bacteria 923
456 Ga0496110_0709905 3300048913 Bacteria 907
457 Ga0496111_0015950 3300048914 Bacteria 5168
458 Ga0496111_0165892 3300048914 Bacteria 1640
459 Ga0496112_0004584 3300048915 Bacteria 11750
460 Ga0496112_0149318 3300048915 Bacteria 2304
461 Ga0496113_0027515 3300048916 Bacteria 4077
462 Ga0496113_0063723 3300048916 Bacteria 2786
463 Ga0496113_0092123 3300048916 Bacteria 2337
464 nmdc:mga09592_320199_c1 3300050508 Bacteria 1343
465 Ga0466962_0073912 3300061719 Bacteria 1629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10027614 Ga0070658_100276145 149
2 3300025909 Ga0207705_10132811 Ga0207705_101328112 157
3 3300005336 Ga0070680_100000499 Ga0070680_1000004998 169
4 3300005530 Ga0070679_100000001 Ga0070679_100000001349 169
5 3300025917 Ga0207660_10002214 Ga0207660_100022143 169
6 3300025921 Ga0207652_10000002 Ga0207652_10000002912 169
7 3300037471 Ga0395905_0052877 Ga0395905_0052877_229_762 170
8 3300001990 JGI24737J22298_10083047 JGI24737J22298_100830472 171
9 3300045049 Ga0466959_0049025 Ga0466959_0049025_1850_2386 171
10 2162886011 MRS1b_contig_4604851 MRS1b_0693.00001650 172
11 3300001904 JGI24736J21556_1010664 JGI24736J21556_10106643 172
12 3300001915 JGI24741J21665_1000304 JGI24741J21665_100030414 172
13 3300001976 JGI24752J21851_1006776 JGI24752J21851_10067762 172
14 3300001979 JGI24740J21852_10000281 JGI24740J21852_100002816 172
15 3300001979 JGI24740J21852_10000432 JGI24740J21852_1000043214 172
16 3300001979 JGI24740J21852_10001858 JGI24740J21852_100018582 172
17 3300001989 JGI24739J22299_10000244 JGI24739J22299_100002444 172
18 3300001989 JGI24739J22299_10000914 JGI24739J22299_100009146 172
19 3300001989 JGI24739J22299_10024487 JGI24739J22299_100244873 172
20 3300001990 JGI24737J22298_10000021 JGI24737J22298_1000002115 172
21 3300001990 JGI24737J22298_10089279 JGI24737J22298_100892792 172
22 3300002067 JGI24735J21928_10018541 JGI24735J21928_100185413 172
23 3300002074 JGI24748J21848_1003721 JGI24748J21848_10037213 172
24 3300002075 JGI24738J21930_10000082 JGI24738J21930_1000008221 172
25 3300002077 JGI24744J21845_10019092 JGI24744J21845_100190922 172
26 3300002244 JGI24742J22300_10011246 JGI24742J22300_100112461 172
27 3300003323 rootH1_10329372 rootH1_103293721 172
28 3300005290 Ga0065712_10107630 Ga0065712_101076302 172
29 3300005290 Ga0065712_10309642 Ga0065712_103096422 172
30 3300005327 Ga0070658_10084709 Ga0070658_100847092 172
31 3300005327 Ga0070658_10232574 Ga0070658_102325742 172
32 3300005328 Ga0070676_10009191 Ga0070676_100091914 172
33 3300005328 Ga0070676_10126932 Ga0070676_101269324 172
34 3300005329 Ga0070683_100006161 Ga0070683_1000061616 172
35 3300005329 Ga0070683_100051975 Ga0070683_1000519751 172
36 3300005331 Ga0070670_100014667 Ga0070670_1000146675 172
37 3300005331 Ga0070670_100016938 Ga0070670_1000169382 172
38 3300005331 Ga0070670_100028233 Ga0070670_1000282334 172
39 3300005331 Ga0070670_100557602 Ga0070670_1005576022 172
40 3300005331 Ga0070670_100773788 Ga0070670_1007737881 172
41 3300005334 Ga0068869_100011031 Ga0068869_1000110315 172
42 3300005334 Ga0068869_100340715 Ga0068869_1003407152 172
43 3300005335 Ga0070666_10015565 Ga0070666_100155653 172
44 3300005335 Ga0070666_10035962 Ga0070666_100359624 172
45 3300005335 Ga0070666_10138102 Ga0070666_101381023 172
46 3300005336 Ga0070680_100863879 Ga0070680_1008638791 172
47 3300005337 Ga0070682_100016503 Ga0070682_1000165035 172
48 3300005337 Ga0070682_100092465 Ga0070682_1000924652 172
49 3300005337 Ga0070682_100150536 Ga0070682_1001505364 172
50 3300005338 Ga0068868_100000637 Ga0068868_10000063717 172
51 3300005339 Ga0070660_100057027 Ga0070660_1000570272 172
52 3300005339 Ga0070660_100066817 Ga0070660_1000668174 172
53 3300005339 Ga0070660_100538767 Ga0070660_1005387671 172
54 3300005343 Ga0070687_100053102 Ga0070687_1000531023 172
55 3300005343 Ga0070687_100220109 Ga0070687_1002201093 172
56 3300005344 Ga0070661_100005039 Ga0070661_1000050397 172
57 3300005344 Ga0070661_100113707 Ga0070661_1001137074 172
58 3300005345 Ga0070692_10057377 Ga0070692_100573772 172
59 3300005347 Ga0070668_100059896 Ga0070668_1000598962 172
60 3300005347 Ga0070668_100843957 Ga0070668_1008439572 172
61 3300005353 Ga0070669_100016384 Ga0070669_1000163842 172
62 3300005353 Ga0070669_100023107 Ga0070669_1000231075 172
63 3300005353 Ga0070669_100448907 Ga0070669_1004489071 172
64 3300005355 Ga0070671_100009526 Ga0070671_1000095263 172
65 3300005355 Ga0070671_100014608 Ga0070671_1000146084 172
66 3300005355 Ga0070671_100034356 Ga0070671_1000343562 172
67 3300005355 Ga0070671_100112880 Ga0070671_1001128804 172
68 3300005355 Ga0070671_100259258 Ga0070671_1002592581 172
69 3300005355 Ga0070671_100288038 Ga0070671_1002880382 172
70 3300005356 Ga0070674_100014594 Ga0070674_1000145946 172
71 3300005356 Ga0070674_100052634 Ga0070674_1000526344 172
72 3300005356 Ga0070674_100399904 Ga0070674_1003999042 172
73 3300005364 Ga0070673_100000209 Ga0070673_10000020920 172
74 3300005364 Ga0070673_100020208 Ga0070673_1000202082 172
75 3300005364 Ga0070673_100025695 Ga0070673_1000256954 172
76 3300005364 Ga0070673_100206653 Ga0070673_1002066532 172
77 3300005366 Ga0070659_100001928 Ga0070659_1000019284 172
78 3300005366 Ga0070659_100010517 Ga0070659_1000105174 172
79 3300005366 Ga0070659_100065982 Ga0070659_1000659824 172
80 3300005366 Ga0070659_100090022 Ga0070659_1000900223 172
81 3300005366 Ga0070659_100098857 Ga0070659_1000988572 172
82 3300005366 Ga0070659_100658909 Ga0070659_1006589092 172
83 3300005367 Ga0070667_100001148 Ga0070667_10000114823 172
84 3300005367 Ga0070667_100017583 Ga0070667_1000175834 172
85 3300005367 Ga0070667_100288601 Ga0070667_1002886012 172
86 3300005367 Ga0070667_100507226 Ga0070667_1005072262 172
87 3300005367 Ga0070667_100809704 Ga0070667_1008097041 172
88 3300005367 Ga0070667_100944333 Ga0070667_1009443331 172
89 3300005436 Ga0070713_100629744 Ga0070713_1006297442 172
90 3300005455 Ga0070663_100010582 Ga0070663_1000105823 172
91 3300005455 Ga0070663_100027702 Ga0070663_1000277023 172
92 3300005455 Ga0070663_100047488 Ga0070663_1000474882 172
93 3300005455 Ga0070663_100135939 Ga0070663_1001359394 172
94 3300005455 Ga0070663_100343438 Ga0070663_1003434383 172
95 3300005455 Ga0070663_100406830 Ga0070663_1004068302 172
96 3300005456 Ga0070678_100203482 Ga0070678_1002034822 172
97 3300005457 Ga0070662_100001649 Ga0070662_1000016496 172
98 3300005457 Ga0070662_100002054 Ga0070662_1000020549 172
99 3300005457 Ga0070662_100011288 Ga0070662_1000112883 172
100 3300005457 Ga0070662_100045421 Ga0070662_1000454214 172
101 3300005457 Ga0070662_100104304 Ga0070662_1001043042 172
102 3300005457 Ga0070662_100106522 Ga0070662_1001065222 172
103 3300005457 Ga0070662_100177064 Ga0070662_1001770642 172
104 3300005457 Ga0070662_100189243 Ga0070662_1001892432 172
105 3300005457 Ga0070662_100204369 Ga0070662_1002043693 172
106 3300005458 Ga0070681_10601380 Ga0070681_106013802 172
107 3300005458 Ga0070681_10823264 Ga0070681_108232641 172
108 3300005459 Ga0068867_100000633 Ga0068867_10000063317 172
109 3300005535 Ga0070684_100097752 Ga0070684_1000977523 172
110 3300005539 Ga0068853_100002063 Ga0068853_1000020636 172
111 3300005539 Ga0068853_100018426 Ga0068853_1000184262 172
112 3300005539 Ga0068853_100402799 Ga0068853_1004027992 172
113 3300005539 Ga0068853_100542070 Ga0068853_1005420702 172
114 3300005543 Ga0070672_100012738 Ga0070672_1000127385 172
115 3300005546 Ga0070696_100067516 Ga0070696_1000675163 172
116 3300005547 Ga0070693_100012860 Ga0070693_1000128602 172
117 3300005547 Ga0070693_100123177 Ga0070693_1001231772 172
118 3300005547 Ga0070693_100125459 Ga0070693_1001254592 172
119 3300005547 Ga0070693_100571626 Ga0070693_1005716262 172
120 3300005548 Ga0070665_100000590 Ga0070665_10000059035 172
121 3300005548 Ga0070665_100031421 Ga0070665_1000314213 172
122 3300005548 Ga0070665_100891837 Ga0070665_1008918372 172
123 3300005563 Ga0068855_100008129 Ga0068855_10000812911 172
124 3300005563 Ga0068855_100035353 Ga0068855_1000353536 172
125 3300005563 Ga0068855_100057562 Ga0068855_1000575623 172
126 3300005563 Ga0068855_101096167 Ga0068855_1010961672 172
127 3300005564 Ga0070664_100009810 Ga0070664_1000098102 172
128 3300005564 Ga0070664_100012119 Ga0070664_1000121191 172
129 3300005564 Ga0070664_100020515 Ga0070664_1000205153 172
130 3300005564 Ga0070664_100050715 Ga0070664_1000507154 172
131 3300005564 Ga0070664_100061549 Ga0070664_1000615492 172
132 3300005564 Ga0070664_100177974 Ga0070664_1001779742 172
133 3300005564 Ga0070664_100314125 Ga0070664_1003141252 172
134 3300005564 Ga0070664_100755930 Ga0070664_1007559302 172
135 3300005564 Ga0070664_100888794 Ga0070664_1008887942 172
136 3300005577 Ga0068857_100000570 Ga0068857_10000057026 172
137 3300005577 Ga0068857_100009347 Ga0068857_1000093474 172
138 3300005577 Ga0068857_100020536 Ga0068857_1000205363 172
139 3300005577 Ga0068857_100164321 Ga0068857_1001643214 172
140 3300005578 Ga0068854_100005509 Ga0068854_1000055095 172
141 3300005578 Ga0068854_100007545 Ga0068854_1000075457 172
142 3300005578 Ga0068854_100095872 Ga0068854_1000958723 172
143 3300005578 Ga0068854_100760226 Ga0068854_1007602261 172
144 3300005614 Ga0068856_100978691 Ga0068856_1009786912 172
145 3300005616 Ga0068852_100000446 Ga0068852_10000044626 172
146 3300005616 Ga0068852_100118792 Ga0068852_1001187922 172
147 3300005616 Ga0068852_100135718 Ga0068852_1001357182 172
148 3300005616 Ga0068852_100147842 Ga0068852_1001478424 172
149 3300005616 Ga0068852_100150134 Ga0068852_1001501342 172
150 3300005616 Ga0068852_100471134 Ga0068852_1004711341 172
151 3300005617 Ga0068859_100000478 Ga0068859_10000047826 172
152 3300005618 Ga0068864_100000174 Ga0068864_10000017461 172
153 3300005618 Ga0068864_100003287 Ga0068864_10000328717 172
154 3300005618 Ga0068864_100004705 Ga0068864_1000047054 172
155 3300005618 Ga0068864_100011378 Ga0068864_1000113784 172
156 3300005718 Ga0068866_10513525 Ga0068866_105135252 172
157 3300005834 Ga0068851_10027270 Ga0068851_100272704 172
158 3300005834 Ga0068851_10156475 Ga0068851_101564751 172
159 3300005840 Ga0068870_10053833 Ga0068870_100538332 172
160 3300005841 Ga0068863_100011027 Ga0068863_1000110274 172
161 3300005841 Ga0068863_100029507 Ga0068863_1000295074 172
162 3300005841 Ga0068863_100121740 Ga0068863_1001217403 172
163 3300005842 Ga0068858_100000600 Ga0068858_1000006001 172
164 3300005843 Ga0068860_100069187 Ga0068860_1000691874 172
165 3300006237 Ga0097621_100086047 Ga0097621_1000860474 172
166 3300006237 Ga0097621_101053861 Ga0097621_1010538612 172
167 3300006358 Ga0068871_100014538 Ga0068871_1000145384 172
168 3300006358 Ga0068871_100052836 Ga0068871_1000528365 172
169 3300006880 Ga0075429_100336967 Ga0075429_1003369672 172
170 3300006881 Ga0068865_100000240 Ga0068865_1000002409 172
171 3300006931 Ga0097620_100000478 Ga0097620_10000047826 172
172 3300009011 Ga0105251_10053026 Ga0105251_100530264 172
173 3300009093 Ga0105240_10703811 Ga0105240_107038112 172
174 3300009098 Ga0105245_10000300 Ga0105245_1000030017 172
175 3300009148 Ga0105243_10056406 Ga0105243_100564063 172
176 3300009174 Ga0105241_10002793 Ga0105241_1000279311 172
177 3300009174 Ga0105241_10092429 Ga0105241_100924293 172
178 3300009177 Ga0105248_10002741 Ga0105248_100027414 172
179 3300009177 Ga0105248_10006633 Ga0105248_100066338 172
180 3300009177 Ga0105248_10214889 Ga0105248_102148892 172
181 3300009177 Ga0105248_10429269 Ga0105248_104292692 172
182 3300009545 Ga0105237_10289053 Ga0105237_102890534 172
183 3300009551 Ga0105238_10137448 Ga0105238_101374484 172
184 3300010375 Ga0105239_10118781 Ga0105239_101187812 172
185 3300011119 Ga0105246_10005263 Ga0105246_100052636 172
186 3300013100 Ga0157373_10131941 Ga0157373_101319414 172
187 3300013100 Ga0157373_10448330 Ga0157373_104483302 172
188 3300013102 Ga0157371_10000677 Ga0157371_1000067720 172
189 3300013102 Ga0157371_10094407 Ga0157371_100944072 172
190 3300013105 Ga0157369_10007317 Ga0157369_100073173 172
191 3300013296 Ga0157374_10249850 Ga0157374_102498502 172
192 3300013296 Ga0157374_10575414 Ga0157374_105754142 172
193 3300013296 Ga0157374_11361270 Ga0157374_113612702 172
194 3300013297 Ga0157378_10002011 Ga0157378_100020115 172
195 3300013307 Ga0157372_10035190 Ga0157372_100351903 172
196 3300013307 Ga0157372_10056080 Ga0157372_100560802 172
197 3300013307 Ga0157372_10195110 Ga0157372_101951102 172
198 3300013307 Ga0157372_10217089 Ga0157372_102170894 172
199 3300013308 Ga0157375_10021146 Ga0157375_100211464 172
200 3300014325 Ga0163163_11178924 Ga0163163_111789242 172
201 3300014326 Ga0157380_10388116 Ga0157380_103881162 172
202 3300014497 Ga0182008_10044086 Ga0182008_100440863 172
203 3300014745 Ga0157377_10096475 Ga0157377_100964752 172
204 3300014968 Ga0157379_10011600 Ga0157379_100116009 172
205 3300017792 Ga0163161_10618801 Ga0163161_106188012 172
206 3300025290 Ga0207673_1000715 Ga0207673_10007153 172
207 3300025315 Ga0207697_10000026 Ga0207697_1000002626 172
208 3300025321 Ga0207656_10028971 Ga0207656_100289712 172
209 3300025321 Ga0207656_10082711 Ga0207656_100827112 172
210 3300025321 Ga0207656_10133486 Ga0207656_101334863 172
211 3300025893 Ga0207682_10011024 Ga0207682_100110242 172
212 3300025893 Ga0207682_10065187 Ga0207682_100651872 172
213 3300025899 Ga0207642_10421906 Ga0207642_104219062 172
214 3300025901 Ga0207688_10000055 Ga0207688_1000005522 172
215 3300025901 Ga0207688_10433821 Ga0207688_104338212 172
216 3300025903 Ga0207680_10035008 Ga0207680_100350082 172
217 3300025903 Ga0207680_10066088 Ga0207680_100660882 172
218 3300025903 Ga0207680_10095813 Ga0207680_100958132 172
219 3300025903 Ga0207680_10137881 Ga0207680_101378813 172
220 3300025904 Ga0207647_10011937 Ga0207647_100119376 172
221 3300025904 Ga0207647_10050113 Ga0207647_100501133 172
222 3300025907 Ga0207645_10014133 Ga0207645_100141335 172
223 3300025907 Ga0207645_10015763 Ga0207645_100157631 172
224 3300025907 Ga0207645_10151215 Ga0207645_101512152 172
225 3300025908 Ga0207643_10037984 Ga0207643_100379844 172
226 3300025909 Ga0207705_10003295 Ga0207705_100032952 172
227 3300025909 Ga0207705_10036469 Ga0207705_100364694 172
228 3300025909 Ga0207705_10076939 Ga0207705_100769393 172
229 3300025909 Ga0207705_10077104 Ga0207705_100771044 172
230 3300025909 Ga0207705_10202106 Ga0207705_102021063 172
231 3300025911 Ga0207654_10150568 Ga0207654_101505682 172
232 3300025912 Ga0207707_10002141 Ga0207707_100021415 172
233 3300025912 Ga0207707_10074804 Ga0207707_100748042 172
234 3300025913 Ga0207695_10599119 Ga0207695_105991192 172
235 3300025914 Ga0207671_10143796 Ga0207671_101437962 172
236 3300025917 Ga0207660_10005781 Ga0207660_100057817 172
237 3300025917 Ga0207660_10574789 Ga0207660_105747892 172
238 3300025918 Ga0207662_10080477 Ga0207662_100804772 172
239 3300025919 Ga0207657_10002401 Ga0207657_1000240114 172
240 3300025919 Ga0207657_10038221 Ga0207657_100382213 172
241 3300025919 Ga0207657_10050634 Ga0207657_100506342 172
242 3300025919 Ga0207657_10076629 Ga0207657_100766292 172
243 3300025919 Ga0207657_10143613 Ga0207657_101436132 172
244 3300025920 Ga0207649_10050942 Ga0207649_100509424 172
245 3300025920 Ga0207649_10054470 Ga0207649_100544702 172
246 3300025920 Ga0207649_10083738 Ga0207649_100837383 172
247 3300025920 Ga0207649_10440204 Ga0207649_104402042 172
248 3300025920 Ga0207649_10713654 Ga0207649_107136542 172
249 3300025921 Ga0207652_10011443 Ga0207652_100114437 172
250 3300025921 Ga0207652_10783071 Ga0207652_107830712 172
251 3300025921 Ga0207652_10889412 Ga0207652_108894122 172
252 3300025923 Ga0207681_10006475 Ga0207681_100064755 172
253 3300025923 Ga0207681_10057501 Ga0207681_100575012 172
254 3300025923 Ga0207681_10552014 Ga0207681_105520142 172
255 3300025923 Ga0207681_10783468 Ga0207681_107834681 172
256 3300025924 Ga0207694_10179794 Ga0207694_101797942 172
257 3300025925 Ga0207650_10038694 Ga0207650_100386942 172
258 3300025925 Ga0207650_10273983 Ga0207650_102739833 172
259 3300025925 Ga0207650_10320550 Ga0207650_103205503 172
260 3300025925 Ga0207650_10662730 Ga0207650_106627302 172
261 3300025927 Ga0207687_10003666 Ga0207687_1000366613 172
262 3300025928 Ga0207700_10483331 Ga0207700_104833312 172
263 3300025929 Ga0207664_10203114 Ga0207664_102031142 172
264 3300025929 Ga0207664_10215355 Ga0207664_102153552 172
265 3300025929 Ga0207664_11015078 Ga0207664_110150782 172
266 3300025931 Ga0207644_10000052 Ga0207644_1000005286 172
267 3300025931 Ga0207644_10027473 Ga0207644_100274734 172
268 3300025931 Ga0207644_10182200 Ga0207644_101822002 172
269 3300025931 Ga0207644_10191651 Ga0207644_101916512 172
270 3300025931 Ga0207644_10401561 Ga0207644_104015613 172
271 3300025931 Ga0207644_10770913 Ga0207644_107709132 172
272 3300025932 Ga0207690_10001000 Ga0207690_100010005 172
273 3300025932 Ga0207690_10006748 Ga0207690_100067484 172
274 3300025932 Ga0207690_10052119 Ga0207690_100521194 172
275 3300025932 Ga0207690_10221280 Ga0207690_102212802 172
276 3300025932 Ga0207690_10396155 Ga0207690_103961552 172
277 3300025932 Ga0207690_10493320 Ga0207690_104933202 172
278 3300025933 Ga0207706_10000278 Ga0207706_1000027834 172
279 3300025933 Ga0207706_10009996 Ga0207706_100099967 172
280 3300025933 Ga0207706_10014251 Ga0207706_100142515 172
281 3300025933 Ga0207706_10092373 Ga0207706_100923734 172
282 3300025933 Ga0207706_10099789 Ga0207706_100997892 172
283 3300025933 Ga0207706_10188672 Ga0207706_101886723 172
284 3300025933 Ga0207706_10245197 Ga0207706_102451973 172
285 3300025933 Ga0207706_10275318 Ga0207706_102753182 172
286 3300025933 Ga0207706_10495738 Ga0207706_104957383 172
287 3300025935 Ga0207709_10390069 Ga0207709_103900692 172
288 3300025937 Ga0207669_10244638 Ga0207669_102446382 172
289 3300025937 Ga0207669_10334070 Ga0207669_103340702 172
290 3300025938 Ga0207704_10015117 Ga0207704_100151174 172
291 3300025940 Ga0207691_10000045 Ga0207691_1000004534 172
292 3300025940 Ga0207691_10745369 Ga0207691_107453692 172
293 3300025941 Ga0207711_10002953 Ga0207711_1000295317 172
294 3300025941 Ga0207711_10048618 Ga0207711_100486184 172
295 3300025941 Ga0207711_10479986 Ga0207711_104799861 172
296 3300025941 Ga0207711_10540061 Ga0207711_105400612 172
297 3300025942 Ga0207689_10000182 Ga0207689_1000018223 172
298 3300025944 Ga0207661_10020749 Ga0207661_100207493 172
299 3300025944 Ga0207661_10353896 Ga0207661_103538962 172
300 3300025945 Ga0207679_10008820 Ga0207679_100088201 172
301 3300025945 Ga0207679_10013464 Ga0207679_100134645 172
302 3300025945 Ga0207679_10033101 Ga0207679_100331015 172
303 3300025945 Ga0207679_10034825 Ga0207679_100348252 172
304 3300025945 Ga0207679_10074670 Ga0207679_100746704 172
305 3300025945 Ga0207679_10270044 Ga0207679_102700442 172
306 3300025945 Ga0207679_10340523 Ga0207679_103405232 172
307 3300025945 Ga0207679_10651029 Ga0207679_106510292 172
308 3300025945 Ga0207679_10679128 Ga0207679_106791281 172
309 3300025949 Ga0207667_10048363 Ga0207667_100483636 172
310 3300025949 Ga0207667_10058163 Ga0207667_100581634 172
311 3300025949 Ga0207667_10552100 Ga0207667_105521002 172
312 3300025960 Ga0207651_10000633 Ga0207651_100006332 172
313 3300025960 Ga0207651_10116105 Ga0207651_101161053 172
314 3300025960 Ga0207651_10442853 Ga0207651_104428532 172
315 3300025972 Ga0207668_10227579 Ga0207668_102275792 172
316 3300025981 Ga0207640_10000849 Ga0207640_1000084921 172
317 3300025981 Ga0207640_10010451 Ga0207640_100104512 172
318 3300025981 Ga0207640_10172552 Ga0207640_101725524 172
319 3300025981 Ga0207640_10622666 Ga0207640_106226662 172
320 3300025986 Ga0207658_10013020 Ga0207658_100130205 172
321 3300025986 Ga0207658_10106011 Ga0207658_101060113 172
322 3300025986 Ga0207658_10175026 Ga0207658_101750262 172
323 3300025986 Ga0207658_10725063 Ga0207658_107250632 172
324 3300026023 Ga0207677_10017169 Ga0207677_100171694 172
325 3300026023 Ga0207677_10238917 Ga0207677_102389173 172
326 3300026035 Ga0207703_10022196 Ga0207703_100221964 172
327 3300026041 Ga0207639_10018415 Ga0207639_100184154 172
328 3300026041 Ga0207639_10020013 Ga0207639_100200133 172
329 3300026041 Ga0207639_10429276 Ga0207639_104292762 172
330 3300026067 Ga0207678_10008896 Ga0207678_100088967 172
331 3300026067 Ga0207678_10014184 Ga0207678_100141842 172
332 3300026067 Ga0207678_10021464 Ga0207678_100214642 172
333 3300026067 Ga0207678_10049159 Ga0207678_100491592 172
334 3300026067 Ga0207678_10169604 Ga0207678_101696042 172
335 3300026067 Ga0207678_10240303 Ga0207678_102403032 172
336 3300026067 Ga0207678_10538841 Ga0207678_105388412 172
337 3300026067 Ga0207678_10548154 Ga0207678_105481542 172
338 3300026078 Ga0207702_10034068 Ga0207702_100340683 172
339 3300026078 Ga0207702_10039707 Ga0207702_100397074 172
340 3300026088 Ga0207641_10079535 Ga0207641_100795353 172
341 3300026088 Ga0207641_10361155 Ga0207641_103611553 172
342 3300026089 Ga0207648_10000222 Ga0207648_1000022229 172
343 3300026095 Ga0207676_10001410 Ga0207676_100014103 172
344 3300026095 Ga0207676_10004133 Ga0207676_100041335 172
345 3300026095 Ga0207676_10009108 Ga0207676_100091084 172
346 3300026095 Ga0207676_10064541 Ga0207676_100645413 172
347 3300026116 Ga0207674_10000284 Ga0207674_1000028426 172
348 3300026116 Ga0207674_10000793 Ga0207674_1000079346 172
349 3300026116 Ga0207674_10001981 Ga0207674_100019816 172
350 3300026116 Ga0207674_10012301 Ga0207674_100123015 172
351 3300026116 Ga0207674_10023342 Ga0207674_100233426 172
352 3300026118 Ga0207675_101236765 Ga0207675_1012367652 172
353 3300026121 Ga0207683_10053905 Ga0207683_100539054 172
354 3300026142 Ga0207698_10006662 Ga0207698_100066624 172
355 3300026142 Ga0207698_10136688 Ga0207698_101366882 172
356 3300026142 Ga0207698_10190758 Ga0207698_101907582 172
357 3300026142 Ga0207698_10424895 Ga0207698_104248952 172
358 3300026142 Ga0207698_10733798 Ga0207698_107337982 172
359 3300027364 Ga0209967_1023126 Ga0209967_10231262 172
360 3300028379 Ga0268266_10001084 Ga0268266_100010846 172
361 3300028381 Ga0268264_10094928 Ga0268264_100949284 172
362 3300028381 Ga0268264_10329014 Ga0268264_103290142 172
363 3300031548 Ga0307408_100375268 Ga0307408_1003752682 172
364 3300031548 Ga0307408_100458398 Ga0307408_1004583982 172
365 3300031731 Ga0307405_10199348 Ga0307405_101993482 172
366 3300031731 Ga0307405_10795354 Ga0307405_107953542 172
367 3300031852 Ga0307410_10105817 Ga0307410_101058172 172
368 3300031852 Ga0307410_10164376 Ga0307410_101643762 172
369 3300031901 Ga0307406_10119516 Ga0307406_101195163 172
370 3300031901 Ga0307406_10127714 Ga0307406_101277142 172
371 3300031901 Ga0307406_10189508 Ga0307406_101895083 172
372 3300031903 Ga0307407_10223600 Ga0307407_102236003 172
373 3300031911 Ga0307412_10260206 Ga0307412_102602062 172
374 3300031911 Ga0307412_10596307 Ga0307412_105963073 172
375 3300031911 Ga0307412_10681039 Ga0307412_106810392 172
376 3300031995 Ga0307409_100275344 Ga0307409_1002753442 172
377 3300032002 Ga0307416_100000426 Ga0307416_1000004264 172
378 3300032002 Ga0307416_100455162 Ga0307416_1004551622 172
379 3300032002 Ga0307416_101659068 Ga0307416_1016590681 172
380 3300032002 Ga0307416_101792828 Ga0307416_1017928282 172
381 3300032004 Ga0307414_11038219 Ga0307414_110382191 172
382 3300032005 Ga0307411_10051302 Ga0307411_100513024 172
383 3300032126 Ga0307415_100016060 Ga0307415_1000160605 172
384 3300032126 Ga0307415_100065264 Ga0307415_1000652642 172
385 3300032126 Ga0307415_100187915 Ga0307415_1001879153 172
386 3300032126 Ga0307415_100229324 Ga0307415_1002293243 172
387 3300035691 Ga0373931_0202153 Ga0373931_0202153_442_978 172
388 3300037312 Ga0395899_0000157 Ga0395899_0000157_23127_23663 172
389 3300037312 Ga0395899_0005498 Ga0395899_0005498_381_917 172
390 3300037312 Ga0395899_0031909 Ga0395899_0031909_2329_2868 172
391 3300037312 Ga0395899_0261283 Ga0395899_0261283_134_694 172
392 3300037312 Ga0395899_0294981 Ga0395899_0294981_233_772 172
393 3300037312 Ga0395899_0323435 Ga0395899_0323435_273_812 172
394 3300037312 Ga0395899_0386598 Ga0395899_0386598_173_712 172
395 3300037418 Ga0395900_0000296 Ga0395900_0000296_68004_68540 172
396 3300037418 Ga0395900_0013040 Ga0395900_0013040_1042_1581 172
397 3300037418 Ga0395900_0057762 Ga0395900_0057762_1756_2295 172
398 3300037418 Ga0395900_0250580 Ga0395900_0250580_899_1438 172
399 3300037418 Ga0395900_0334110 Ga0395900_0334110_387_926 172
400 3300037418 Ga0395900_0923049 Ga0395900_0923049_224_760 172
401 3300037466 Ga0395898_0000054 Ga0395898_0000054_130959_131495 172
402 3300037466 Ga0395898_0012372 Ga0395898_0012372_5589_6125 172
403 3300037466 Ga0395898_0055561 Ga0395898_0055561_3199_3738 172
404 3300037466 Ga0395898_0061652 Ga0395898_0061652_762_1301 172
405 3300037466 Ga0395898_0078506 Ga0395898_0078506_1857_2396 172
406 3300037466 Ga0395898_0150021 Ga0395898_0150021_1482_2021 172
407 3300037466 Ga0395898_0892959 Ga0395898_0892959_112_672 172
408 3300037471 Ga0395905_0000046 Ga0395905_0000046_91965_92501 172
409 3300037471 Ga0395905_0001856 Ga0395905_0001856_20239_20775 172
410 3300037471 Ga0395905_0013370 Ga0395905_0013370_6451_6990 172
411 3300037471 Ga0395905_0017019 Ga0395905_0017019_4966_5502 172
412 3300037471 Ga0395905_0019060 Ga0395905_0019060_2598_3134 172
413 3300037471 Ga0395905_0049072 Ga0395905_0049072_736_1278 172
414 3300037471 Ga0395905_0074142 Ga0395905_0074142_464_1003 172
415 3300037471 Ga0395905_0150271 Ga0395905_0150271_513_1073 172
416 3300037471 Ga0395905_0194185 Ga0395905_0194185_151_690 172
417 3300037471 Ga0395905_0200818 Ga0395905_0200818_355_891 172
418 3300037471 Ga0395905_0318560 Ga0395905_0318560_600_1136 172
419 3300037471 Ga0395905_0365575 Ga0395905_0365575_506_1045 172
420 3300037471 Ga0395905_0595354 Ga0395905_0595354_198_737 172
421 3300037471 Ga0395905_0700551 Ga0395905_0700551_156_692 172
422 3300038443 Ga0395901_0001633 Ga0395901_0001633_16132_16668 172
423 3300038443 Ga0395901_0008013 Ga0395901_0008013_6646_7185 172
424 3300038443 Ga0395901_0043229 Ga0395901_0043229_346_885 172
425 3300038443 Ga0395901_0047022 Ga0395901_0047022_3602_4141 172
426 3300038443 Ga0395901_0057600 Ga0395901_0057600_2210_2746 172
427 3300038443 Ga0395901_0184331 Ga0395901_0184331_472_1011 172
428 3300038443 Ga0395901_0307289 Ga0395901_0307289_1079_1615 172
429 3300038443 Ga0395901_0335517 Ga0395901_0335517_61_621 172
430 3300038443 Ga0395901_1104598 Ga0395901_1104598_21_560 172
431 3300041459 Ga0451800_1265494 Ga0451800_1265494_120_656 172
432 3300042005 Ga0439448_0009481 Ga0439448_0009481_481_1017 172
433 3300042144 Ga0450889_010405 Ga0450889_010405_24_560 172
434 3300042157 Ga0439458_0000052 Ga0439458_0000052_16168_16704 172
435 3300044694 Ga0466963_0230677 Ga0466963_0230677_185_724 172
436 3300044712 Ga0453684_1326087 Ga0453684_1326087_104_640 172
437 3300045836 Ga0466958_0058851 Ga0466958_0058851_1632_2171 172
438 3300046684 Ga0495669_0006704 Ga0495669_0006704_1171_1713 172
439 3300046684 Ga0495669_0021969 Ga0495669_0021969_200_736 172
440 3300048903 Ga0496100_0503921 Ga0496100_0503921_120_656 172
441 3300048905 Ga0496102_0018756 Ga0496102_0018756_1932_2468 172
442 3300048906 Ga0496103_0136671 Ga0496103_0136671_898_1434 172
443 3300048906 Ga0496103_0310065 Ga0496103_0310065_101_637 172
444 3300048907 Ga0496104_0050059 Ga0496104_0050059_2140_2676 172
445 3300048909 Ga0496106_0059457 Ga0496106_0059457_1519_2055 172
446 3300048910 Ga0496107_0087602 Ga0496107_0087602_1264_1803 172
447 3300048910 Ga0496107_0295044 Ga0496107_0295044_384_920 172
448 3300048911 Ga0496108_0004150 Ga0496108_0004150_9874_10410 172
449 3300048911 Ga0496108_0091656 Ga0496108_0091656_1780_2316 172
450 3300048911 Ga0496108_0249164 Ga0496108_0249164_268_804 172
451 3300048912 Ga0496109_0008253 Ga0496109_0008253_5961_6497 172
452 3300048912 Ga0496109_0021967 Ga0496109_0021967_4608_5144 172
453 3300048912 Ga0496109_0728966 Ga0496109_0728966_298_834 172
454 3300048913 Ga0496110_0056994 Ga0496110_0056994_333_869 172
455 3300048913 Ga0496110_0688395 Ga0496110_0688395_19_555 172
456 3300048913 Ga0496110_0709905 Ga0496110_0709905_337_873 172
457 3300048914 Ga0496111_0015950 Ga0496111_0015950_3241_3777 172
458 3300048914 Ga0496111_0165892 Ga0496111_0165892_895_1431 172
459 3300048915 Ga0496112_0004584 Ga0496112_0004584_11162_11698 172
460 3300048915 Ga0496112_0149318 Ga0496112_0149318_1392_1928 172
461 3300048916 Ga0496113_0027515 Ga0496113_0027515_3286_3822 172
462 3300048916 Ga0496113_0063723 Ga0496113_0063723_286_822 172
463 3300048916 Ga0496113_0092123 Ga0496113_0092123_777_1313 172
464 3300050508 nmdc:mga09592_320199_c1 nmdc:mga09592_320199_c1_136_675 172
465 3300061719 Ga0466962_0073912 Ga0466962_0073912_342_884 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06041

DUF924

Bacterial protein of unknown function (DUF924)

16

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.9006 4 166
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.8519 4 166
2kcv-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.5815 53 145
2kcl-assembly1.cif.gz_A solution nmr structure of tetratricopeptide repeat domain protein sru_0103 from salinibacter ruber, northeast structural genomics consortium (nesg) target srr115c 0.5601 52 145
1nzn-assembly1.cif.gz_A cytosolic domain of the human mitchondrial fission protein fis1 adopts a tpr fold 0.5526 25 144
ID Description Score Start End Superfamily
2i6hB02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9366 76 166 1.25.40.10
2i6hB02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8721 76 166 1.25.40.10
2i6hB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;TPR-like 0.7834 4 76 1.20.58.320
2i6hB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;TPR-like 0.7206 4 76 1.20.58.320
af_A0A2R8PZK5_749_903_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6243 57 156 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A4Q6CYM2-F1-model_v4 deleted 0.9832 82 165
AF-A0A534GSG6-F1-model_v4 DUF924 domain-containing protein 0.979 78 165
AF-A0A832EB98-F1-model_v4 deleted 0.9752 103 165
AF-A0A4Q6D462-F1-model_v4 deleted 0.9727 93 165
AF-A0A482YWZ1-F1-model_v4 DUF924 domain-containing protein 0.9699 107 165

Feature Viewer

pLDDT pTM Quality
91.54 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map