F449404

General Info

Members Datasets Scaffolds Average Seq Length
464 249 416 386

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2855730933|2855731471
Length 435
Sequence KTPVATPAVHGDGRSNHIGMVAGEPSGDMLAARIMQGLQQRTPGVICQGIGGPRMQAQGFESWHPMHALTVFGYVDALKRIPSLLSIYGDTKRRLLAAPPSVFVGIDAPDFNLKLELQLRQAGVPTVHFVGPSIWAWRYERIHKIREAVSHMLVLFPFEEEIYQKEGIPVTYVGHPLAGTIPMHPDRAAARARLGLEQGARVLAMLPGSRSSEIKVLAPRFLQALQKLQQRDPALQCVVPMVNAQRRAEFDEFLRQYPVANLRIVTADDVAPGGLAAAGSERRNGAGNGPVNGAADGQGAPAPVAWSVMEAADAVLVASGTATLEAALFKRPMVISYYLPTWMRRIMSWKSKQQRPYLPWVGLPNVLLRDFAVPELLQDDATPEKLAEATWTALTDDANAARVEARFTAMHQELLRDTPALAAQAIIEVSSRGSV

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
3 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2643221556 Massilia sp. Root1485 Isolate Unclassified
6 2643221569 Achromobacter sp. Root565 Isolate Unclassified
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221594 Achromobacter sp. Root170 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221621 Achromobacter sp. Root83 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221684 Massilia sp. Root133 Isolate Unclassified
15 2643221717 Acidovorax sp. Root267 Isolate Unclassified
16 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
17 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
18 2721755523 Delftia sp. HK171 Isolate Unclassified
19 2738543012 Acidovorax sp. CF301 Isolate Unclassified
20 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
21 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
22 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
23 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
24 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
25 2816332133 Acidovorax radicis 2721A Isolate Unclassified
26 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
27 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
28 2855730933 Achromobacter sp. HZ28 Isolate Nodule
29 2855767633 Achromobacter sp. HZ34 Isolate Nodule
30 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
31 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
32 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
33 2858950400 Achromobacter sp. K91 Isolate Unclassified
34 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
35 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
36 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
37 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
38 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
39 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
40 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
41 2941479691
42 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
43 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
120 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
222 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
242 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
243 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
244 639633007 Azoarcus olearius BH72 Isolate Unclassified
245 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
246 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
247 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
248 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
249 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.66
Metatranscriptomes 0
Isolates 10.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.53
Nodule 1.08
Rhizoplane 3.88
Rhizosphere 77.59
Stem 0
Stem Tuber 0
Unclassified 12.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000001 3300002737 Bacteria 740113
2 JGI25151J46595_10001410 3300003187 Bacteria 16470
3 Ga0055529_1001764 3300003763 Bacteria 5375
4 Ga0055530_10017926 3300003791 Bacteria 2201
5 Ga0065165_1005223 3300005262 Bacteria 7458
6 Ga0065704_10072566 3300005289 Bacteria 8318
7 Ga0070671_100054196 3300005355 Bacteria 3334
8 Ga0070685_10000507 3300005466 Bacteria 22469
9 Ga0070665_100036086 3300005548 Bacteria 4974
10 Ga0068855_100116641 3300005563 Bacteria 3060
11 Ga0070664_100137360 3300005564 Bacteria 2150
12 Ga0068852_100002484 3300005616 Bacteria 12701
13 Ga0068859_100015273 3300005617 Bacteria 7712
14 Ga0068859_100127990 3300005617 Bacteria 2610
15 Ga0068864_100050299 3300005618 Bacteria 3587
16 Ga0068863_100014419 3300005841 Bacteria 7613
17 Ga0068860_100086822 3300005843 Bacteria 2978
18 Ga0075364_10003737 3300006051 Bacteria 8690
19 Ga0075364_10003778 3300006051 Bacteria 8660
20 Ga0075430_100066755 3300006846 Bacteria 3021
21 Ga0075431_100003069 3300006847 Bacteria 16172
22 Ga0068865_100001521 3300006881 Bacteria 13523
23 Ga0097620_100015274 3300006931 Bacteria 7712
24 Ga0097620_100127984 3300006931 Bacteria 2610
25 Ga0079104_1000025 3300006946 Bacteria 218785
26 Ga0105240_10006901 3300009093 Bacteria 16595
27 Ga0105245_10226541 3300009098 Bacteria 1806
28 Ga0105243_10000729 3300009148 Bacteria 31488
29 Ga0105242_10001773 3300009176 Bacteria 17024
30 Ga0105237_10017038 3300009545 Bacteria 7540
31 Ga0105238_10000630 3300009551 Bacteria 37045
32 Ga0105238_10004531 3300009551 Bacteria 13762
33 Ga0105246_10310909 3300011119 Bacteria 1276
34 Ga0157370_10001690 3300013104 Bacteria 27178
35 Ga0157370_10071507 3300013104 Bacteria 3273
36 Ga0163162_10004723 3300013306 Bacteria 13141
37 Ga0157375_10000202 3300013308 Bacteria 55157
38 Ga0157379_10184401 3300014968 Bacteria 1885
39 Ga0157376_10020363 3300014969 Bacteria 5130
40 Ga0213872_10000004 3300021361 Bacteria 306230
41 Ga0209672_104853 3300025228 Bacteria 2413
42 Ga0209455_1000515 3300025272 Bacteria 27385
43 Ga0209676_1006346 3300025292 Bacteria 5861
44 Ga0209025_1000018 3300025294 Bacteria 686898
45 Ga0209050_1001037 3300025298 Bacteria 34453
46 Ga0209051_1019502 3300025303 Bacteria 2956
47 Ga0207695_10000014 3300025913 Bacteria 812599
48 Ga0207663_10127258 3300025916 Bacteria 1754
49 Ga0207694_10003132 3300025924 Bacteria 13232
50 Ga0207694_10012769 3300025924 Bacteria 6328
51 Ga0207687_10032718 3300025927 Bacteria 3523
52 Ga0207686_10011196 3300025934 Bacteria 4905
53 Ga0207709_10000170 3300025935 Bacteria 87011
54 Ga0207667_10324065 3300025949 Bacteria 1573
55 Ga0207641_10014774 3300026088 Bacteria 6402
56 Ga0207676_10203639 3300026095 Bacteria 1750
57 Ga0207698_10051097 3300026142 Bacteria 3158
58 Ga0209281_1000007 3300027111 Bacteria 938265
59 Ga0209974_10001586 3300027876 Bacteria 8227
60 Ga0268266_10013874 3300028379 Bacteria 6936
61 Ga0268264_10101444 3300028381 Bacteria 2502
62 Ga0265330_10000793 3300031235 Bacteria 19922
63 Ga0265332_10000064 3300031238 Bacteria 94090
64 Ga0265328_10013082 3300031239 Bacteria 3291
65 Ga0265325_10035970 3300031241 Bacteria 2626
66 Ga0265327_10000184 3300031251 Bacteria 133023
67 Ga0265316_10000151 3300031344 Bacteria 76436
68 Ga0307509_10000815 3300031507 Bacteria 53574
69 Ga0307408_100000068 3300031548 Bacteria 120700
70 Ga0265314_10000177 3300031711 Bacteria 94090
71 Ga0316576_10146501 3300031727 Bacteria 1779
72 Ga0307405_10082658 3300031731 Bacteria 2103
73 Ga0307406_10001487 3300031901 Bacteria 12938
74 Ga0307412_10010711 3300031911 Bacteria 5287
75 Ga0307416_100089899 3300032002 Bacteria 2631
76 Ga0373927_0177106 3300035695 Bacteria 1398
77 Ga0373937_0170668 3300036401 Bacteria 2041
78 Ga0373925_0001241 3300037068 Bacteria 22498
79 Ga0395899_0000139 3300037312 Bacteria 110692
80 Ga0395900_0000402 3300037418 Bacteria 62208
81 Ga0395900_0001322 3300037418 Bacteria 30026
82 Ga0395900_0010617 3300037418 Bacteria 9417
83 Ga0395905_0030564 3300037471 Bacteria 5073
84 Ga0395901_0001370 3300038443 Bacteria 25495
85 Ga0395901_0127918 3300038443 Bacteria 2670
86 Ga0400483_089249 3300039062 Bacteria 17577
87 Ga0400483_169233 3300039062 Bacteria 17398
88 Ga0400483_241723 3300039062 Bacteria 19398
89 Ga0400487_47620 3300039110 Bacteria 4337
90 Ga0436361_0583521 3300039447 Bacteria 71514
91 Ga0439436_0044803 3300041404 Bacteria 1260
92 Ga0451577_0026518 3300042876 Bacteria 5248
93 Ga0453683_0049342 3300044673 Bacteria 2639
94 Ga0453684_0000280 3300044712 Bacteria 219955
95 Ga0453684_0000839 3300044712 Bacteria 103721
96 Ga0453684_0425924 3300044712 Bacteria 1481
97 Ga0453684_0532316 3300044712 Bacteria 1296
98 Ga0451576_0000250 3300045051 Bacteria 132101
99 Ga0451576_0024661 3300045051 Bacteria 6494
100 Ga0451576_0195018 3300045051 Bacteria 2115
101 Ga0451576_0288964 3300045051 Bacteria 1714
102 Ga0495617_000001 3300046452 Bacteria 877032
103 Ga0495617_000143 3300046452 Bacteria 47087
104 Ga0495617_007802 3300046452 Bacteria 3704
105 Ga0495627_000300 3300046453 Bacteria 48824
106 Ga0495627_008508 3300046453 Bacteria 3841
107 Ga0495592_0182539 3300046454 Bacteria 1428
108 Ga0495603_0004406 3300046455 Bacteria 8397
109 Ga0495603_0008826 3300046455 Bacteria 6093
110 Ga0495603_0056701 3300046455 Bacteria 2319
111 Ga0495590_0000024 3300046457 Bacteria 196121
112 Ga0495590_0000373 3300046457 Bacteria 22899
113 Ga0495590_0000717 3300046457 Bacteria 15146
114 Ga0495591_003683 3300046458 Bacteria 7785
115 Ga0495629_0032534 3300046459 Bacteria 3691
116 Ga0495629_0067946 3300046459 Bacteria 2487
117 Ga0495638_0051514 3300046460 Bacteria 2567
118 Ga0495638_0110556 3300046460 Bacteria 1633
119 Ga0495653_0020220 3300046463 Bacteria 5397
120 Ga0495653_0030379 3300046463 Bacteria 4304
121 Ga0495650_0000631 3300046471 Bacteria 47329
122 Ga0495650_0026937 3300046471 Bacteria 2664
123 Ga0495580_0037115 3300046472 Bacteria 3498
124 Ga0495582_0001762 3300046473 Bacteria 12222
125 Ga0495582_0006240 3300046473 Bacteria 6641
126 Ga0495605_0000004 3300046474 Bacteria 395282
127 Ga0495605_0004522 3300046474 Bacteria 8146
128 Ga0495605_0011534 3300046474 Bacteria 4922
129 Ga0495605_0022613 3300046474 Bacteria 3318
130 Ga0495605_0034511 3300046474 Bacteria 2561
131 Ga0495584_0000064 3300046491 Bacteria 75946
132 Ga0495584_0001952 3300046491 Bacteria 11867
133 Ga0495584_0004397 3300046491 Bacteria 7587
134 Ga0495584_0006813 3300046491 Bacteria 5968
135 Ga0495584_0015811 3300046491 Bacteria 3849
136 Ga0495584_0023158 3300046491 Bacteria 3149
137 Ga0495584_0041009 3300046491 Bacteria 2337
138 Ga0495585_0000032 3300046492 Bacteria 143439
139 Ga0495585_0000059 3300046492 Bacteria 111343
140 Ga0495585_0002042 3300046492 Bacteria 14887
141 Ga0495585_0004312 3300046492 Bacteria 9261
142 Ga0495585_0004840 3300046492 Bacteria 8643
143 Ga0495585_0005840 3300046492 Bacteria 7716
144 Ga0495585_0012772 3300046492 Bacteria 4941
145 Ga0495585_0031410 3300046492 Bacteria 3014
146 Ga0495585_0031711 3300046492 Bacteria 2999
147 Ga0495585_0041867 3300046492 Bacteria 2568
148 Ga0495585_0065149 3300046492 Bacteria 1996
149 Ga0495594_0005237 3300046499 Bacteria 6667
150 Ga0495594_0007270 3300046499 Bacteria 5693
151 Ga0495596_0000302 3300046500 Bacteria 32703
152 Ga0495596_0003907 3300046500 Bacteria 7387
153 Ga0495596_0007199 3300046500 Bacteria 5034
154 Ga0495596_0008947 3300046500 Bacteria 4425
155 Ga0495596_0045062 3300046500 Bacteria 1734
156 Ga0495607_0000021 3300046501 Bacteria 164571
157 Ga0495607_0002037 3300046501 Bacteria 16926
158 Ga0495607_0008715 3300046501 Bacteria 6909
159 Ga0495607_0021093 3300046501 Bacteria 4103
160 Ga0495607_0025568 3300046501 Bacteria 3670
161 Ga0495607_0026631 3300046501 Bacteria 3586
162 Ga0495583_0000494 3300046506 Bacteria 57252
163 Ga0495583_0003237 3300046506 Bacteria 12701
164 Ga0495583_0005267 3300046506 Bacteria 8862
165 Ga0495583_0007000 3300046506 Bacteria 7220
166 Ga0495583_0007617 3300046506 Bacteria 6758
167 Ga0495583_0009281 3300046506 Bacteria 5893
168 Ga0495583_0010644 3300046506 Bacteria 5347
169 Ga0495583_0011992 3300046506 Bacteria 4938
170 Ga0495583_0013050 3300046506 Bacteria 4662
171 Ga0495583_0047149 3300046506 Bacteria 1984
172 Ga0495583_0071720 3300046506 Bacteria 1521
173 Ga0495606_0000441 3300046507 Bacteria 68151
174 Ga0495606_0011752 3300046507 Bacteria 7100
175 Ga0495606_0013367 3300046507 Bacteria 6490
176 Ga0495606_0099111 3300046507 Bacteria 1777
177 Ga0495610_0000345 3300046512 Bacteria 48975
178 Ga0495616_0000404 3300046513 Bacteria 33279
179 Ga0495616_0003194 3300046513 Bacteria 10570
180 Ga0495616_0008203 3300046513 Bacteria 6201
181 Ga0495616_0010769 3300046513 Bacteria 5273
182 Ga0495616_0014824 3300046513 Bacteria 4351
183 Ga0495616_0017224 3300046513 Bacteria 3987
184 Ga0495616_0034413 3300046513 Bacteria 2631
185 Ga0495616_0045114 3300046513 Bacteria 2233
186 Ga0495620_0008072 3300046515 Bacteria 5668
187 Ga0495631_0000136 3300046518 Bacteria 49896
188 Ga0495631_0004984 3300046518 Bacteria 6998
189 Ga0495631_0005362 3300046518 Bacteria 6724
190 Ga0495631_0012084 3300046518 Bacteria 4228
191 Ga0495631_0014207 3300046518 Bacteria 3848
192 Ga0495631_0016391 3300046518 Bacteria 3532
193 Ga0495631_0016740 3300046518 Bacteria 3485
194 Ga0495631_0018949 3300046518 Bacteria 3233
195 Ga0495631_0065417 3300046518 Bacteria 1573
196 Ga0495631_0076716 3300046518 Bacteria 1442
197 Ga0495632_0000033 3300046519 Bacteria 164240
198 Ga0495632_0004300 3300046519 Bacteria 9714
199 Ga0495632_0004414 3300046519 Bacteria 9562
200 Ga0495632_0005116 3300046519 Bacteria 8759
201 Ga0495632_0005860 3300046519 Bacteria 8026
202 Ga0495637_0000008 3300046520 Bacteria 404658
203 Ga0495637_0046844 3300046520 Bacteria 1827
204 Ga0495643_0002405 3300046522 Bacteria 14902
205 Ga0495643_0009395 3300046522 Bacteria 6080
206 Ga0495643_0018503 3300046522 Bacteria 4047
207 Ga0495643_0023294 3300046522 Bacteria 3522
208 Ga0495643_0035525 3300046522 Bacteria 2744
209 Ga0495644_0028213 3300046523 Bacteria 2124
210 Ga0495644_0046587 3300046523 Bacteria 1629
211 Ga0495644_0047448 3300046523 Bacteria 1613
212 Ga0495648_0000057 3300046524 Bacteria 157446
213 Ga0495648_0004684 3300046524 Bacteria 11599
214 Ga0495648_0018298 3300046524 Bacteria 4969
215 Ga0495648_0018490 3300046524 Bacteria 4930
216 Ga0495648_0024042 3300046524 Bacteria 4158
217 Ga0495648_0057406 3300046524 Bacteria 2335
218 Ga0495666_0000637 3300046526 Bacteria 15790
219 Ga0495642_0000544 3300046528 Bacteria 18979
220 Ga0495642_0002285 3300046528 Bacteria 7821
221 Ga0495642_0003398 3300046528 Bacteria 6285
222 Ga0495642_0010736 3300046528 Bacteria 3508
223 Ga0495652_0013032 3300046529 Bacteria 7494
224 Ga0495654_0021630 3300046530 Bacteria 3345
225 Ga0495654_0022608 3300046530 Bacteria 3262
226 Ga0495586_0001068 3300046535 Bacteria 15466
227 Ga0495586_0004323 3300046535 Bacteria 7591
228 Ga0495587_0027552 3300046536 Bacteria 3459
229 Ga0495587_0089196 3300046536 Bacteria 1782
230 Ga0495609_0003818 3300046538 Bacteria 8469
231 Ga0495597_0001860 3300046542 Bacteria 14430
232 Ga0495597_0001945 3300046542 Bacteria 13917
233 Ga0495597_0003396 3300046542 Bacteria 9326
234 Ga0495597_0006969 3300046542 Bacteria 5793
235 Ga0495597_0007933 3300046542 Bacteria 5349
236 Ga0495597_0057332 3300046542 Bacteria 1704
237 Ga0495597_0059301 3300046542 Bacteria 1671
238 Ga0495622_0058020 3300046557 Bacteria 1793
239 Ga0495633_0005033 3300046558 Bacteria 8238
240 Ga0495633_0010329 3300046558 Bacteria 5103
241 Ga0495633_0010552 3300046558 Bacteria 5034
242 Ga0495633_0023271 3300046558 Bacteria 3070
243 Ga0495633_0050201 3300046558 Bacteria 1967
244 Ga0495633_0061507 3300046558 Bacteria 1758
245 Ga0495668_0001948 3300046616 Bacteria 18329
246 Ga0495668_0002081 3300046616 Bacteria 17333
247 Ga0495668_0006958 3300046616 Bacteria 7317
248 Ga0495668_0018772 3300046616 Bacteria 3996
249 Ga0495634_0043190 3300046642 Bacteria 3055
250 Ga0495611_0001540 3300046648 Bacteria 11355
251 Ga0495611_0002824 3300046648 Bacteria 7765
252 Ga0495611_0006577 3300046648 Bacteria 4952
253 Ga0495635_0002495 3300046663 Bacteria 12568
254 Ga0495661_0002561 3300046665 Bacteria 13946
255 Ga0495661_0004038 3300046665 Bacteria 10693
256 Ga0495661_0007599 3300046665 Bacteria 7552
257 Ga0495661_0015740 3300046665 Bacteria 5038
258 Ga0495661_0043883 3300046665 Bacteria 2745
259 Ga0495661_0077931 3300046665 Bacteria 1918
260 Ga0495588_0014865 3300046674 Bacteria 3735
261 Ga0495588_0051882 3300046674 Bacteria 2113
262 Ga0495623_0014663 3300046679 Bacteria 5068
263 Ga0495669_0003143 3300046684 Bacteria 6799
264 Ga0495669_0017631 3300046684 Bacteria 3066
265 Ga0495669_0018064 3300046684 Bacteria 3029
266 Ga0495669_0022981 3300046684 Bacteria 2710
267 Ga0495613_0041471 3300046689 Bacteria 3409
268 Ga0495624_0241515 3300046690 Bacteria 1093
269 Ga0495670_0002700 3300046691 Bacteria 8767
270 Ga0495670_0003329 3300046691 Bacteria 7912
271 Ga0495670_0012660 3300046691 Bacteria 4149
272 Ga0495670_0033261 3300046691 Bacteria 2565
273 Ga0495670_0124959 3300046691 Bacteria 1338
274 Ga0495671_0003414 3300046692 Bacteria 9771
275 Ga0495671_0012029 3300046692 Bacteria 4734
276 Ga0495649_0000216 3300046694 Bacteria 50649
277 Ga0495649_0012391 3300046694 Bacteria 4962
278 Ga0495649_0016951 3300046694 Bacteria 4121
279 Ga0495649_0072597 3300046694 Bacteria 1844
280 Ga0495589_0001542 3300046794 Bacteria 13281
281 Ga0495589_0002416 3300046794 Bacteria 10490
282 Ga0495589_0054810 3300046794 Bacteria 1965
283 Ga0495600_0047965 3300046809 Bacteria 2786
284 Ga0495660_0032139 3300046810 Bacteria 2947
285 Ga0495660_0077906 3300046810 Bacteria 1743
286 Ga0495581_0011150 3300047315 Bacteria 5194
287 Ga0495604_0098837 3300047317 Bacteria 2149
288 Ga0495636_0006798 3300047318 Bacteria 4496
289 Ga0495636_0046599 3300047318 Bacteria 1808
290 Ga0495674_0064488 3300047319 Bacteria 3184
291 Ga0495672_0000163 3300047320 Bacteria 96740
292 Ga0495672_0000254 3300047320 Bacteria 74545
293 Ga0495672_0012507 3300047320 Bacteria 5918
294 Ga0495676_0002063 3300047321 Bacteria 17680
295 Ga0495676_0071186 3300047321 Bacteria 2674
296 Ga0495683_0001099 3300047323 Bacteria 18660
297 Ga0495683_0003342 3300047323 Bacteria 9376
298 Ga0495683_0013322 3300047323 Bacteria 4303
299 Ga0495683_0083643 3300047323 Bacteria 1554
300 Ga0495687_000002 3300047443 Bacteria 1085770
301 Ga0495687_000007 3300047443 Bacteria 552679
302 Ga0495687_006244 3300047443 Bacteria 7352
303 Ga0495675_0004466 3300047444 Bacteria 8470
304 Ga0495675_0006848 3300047444 Bacteria 6998
305 Ga0495675_0121739 3300047444 Bacteria 1625
306 Ga0495677_0002190 3300047445 Bacteria 7743
307 Ga0495677_0003298 3300047445 Bacteria 6287
308 Ga0495677_0004366 3300047445 Bacteria 5435
309 Ga0495677_0007832 3300047445 Bacteria 3979
310 Ga0495679_003071 3300047446 Bacteria 8194
311 Ga0495679_033723 3300047446 Bacteria 1633
312 Ga0495685_000846 3300047447 Bacteria 9330
313 Ga0495685_001657 3300047447 Bacteria 6867
314 Ga0495681_0003547 3300047470 Bacteria 10856
315 Ga0495681_0004436 3300047470 Bacteria 9569
316 Ga0495681_0007449 3300047470 Bacteria 6992
317 Ga0495681_0013625 3300047470 Bacteria 4706
318 Ga0495681_0067655 3300047470 Bacteria 1627
319 Ga0495686_0085645 3300047472 Bacteria 1918
320 Ga0495593_0012478 3300047673 Bacteria 4856
321 Ga0495602_0024394 3300048088 Bacteria 5868
322 Ga0495626_0007191 3300048091 Bacteria 6224
323 Ga0495626_0019587 3300048091 Bacteria 3383
324 Ga0495626_0025395 3300048091 Bacteria 2898
325 Ga0495626_0025396 3300048091 Bacteria 2898
326 Ga0495626_0027244 3300048091 Bacteria 2779
327 Ga0495626_0045453 3300048091 Bacteria 2049
328 Ga0495626_0048744 3300048091 Bacteria 1964
329 Ga0495626_0058255 3300048091 Bacteria 1765
330 Ga0495626_0065382 3300048091 Bacteria 1646
331 Ga0495626_0073493 3300048091 Bacteria 1531
332 Ga0496100_0087031 3300048903 Bacteria 2123
333 Ga0496101_0196200 3300048904 Bacteria 1559
334 Ga0496102_0000514 3300048905 Bacteria 42248
335 Ga0496102_0280203 3300048905 Bacteria 1571
336 Ga0496103_0090246 3300048906 Bacteria 1933
337 Ga0496103_0100837 3300048906 Bacteria 1827
338 Ga0496104_0000016 3300048907 Bacteria 335025
339 Ga0496105_0000035 3300048908 Bacteria 123037
340 Ga0496109_0012888 3300048912 Bacteria 7229
341 Ga0496109_0326534 3300048912 Bacteria 1448
342 Ga0496110_0000059 3300048913 Bacteria 55725
343 Ga0496110_0076228 3300048913 Bacteria 2981
344 Ga0496112_0088432 3300048915 Bacteria 3066
345 Ga0496113_0006969 3300048916 Bacteria 7225
346 Ga0496113_0170855 3300048916 Bacteria 1722
347 Ga0496115_0027215 3300048918 Bacteria 4470
348 Ga0496115_0069325 3300048918 Bacteria 2856
349 Ga0496116_0013936 3300048919 Bacteria 6443
350 Ga0496116_0047916 3300048919 Bacteria 2872
351 Ga0496117_0006426 3300048920 Bacteria 11899
352 Ga0496118_0011683 3300048921 Bacteria 8538
353 Ga0496119_0006665 3300048922 Bacteria 10618
354 Ga0496120_0004220 3300048923 Bacteria 12259
355 Ga0496121_0000124 3300048924 Bacteria 170427
356 Ga0496121_0019886 3300048924 Bacteria 6685
357 Ga0496122_0000316 3300048925 Bacteria 106100
358 Ga0496122_0000727 3300048925 Bacteria 64439
359 Ga0496122_0038722 3300048925 Bacteria 3812
360 Ga0496123_0000297 3300048926 Bacteria 97340
361 Ga0496123_0003588 3300048926 Bacteria 17186
362 Ga0496123_0050028 3300048926 Bacteria 2796
363 Ga0496124_0000004 3300048927 Bacteria 976131
364 Ga0496124_0030423 3300048927 Bacteria 4792
365 Ga0496124_0085732 3300048927 Bacteria 2580
366 Ga0496125_0000570 3300048928 Bacteria 63252
367 Ga0496125_0002556 3300048928 Bacteria 23429
368 Ga0496125_0004074 3300048928 Bacteria 17106
369 Ga0496125_0086881 3300048928 Bacteria 2363
370 Ga0496126_0012075 3300048929 Bacteria 8875
371 Ga0496126_0015600 3300048929 Bacteria 7635
372 Ga0496126_0023381 3300048929 Bacteria 5990
373 Ga0496126_0072707 3300048929 Bacteria 3058
374 Ga0496126_0280497 3300048929 Bacteria 1380
375 Ga0495678_000157 3300049459 Bacteria 81092
376 Ga0495678_001426 3300049459 Bacteria 18837
377 Ga0495678_003661 3300049459 Bacteria 9325
378 Ga0495682_0001021 3300049460 Bacteria 16595
379 Ga0495682_0030766 3300049460 Bacteria 1985
380 Ga0495682_0032467 3300049460 Bacteria 1928
381 Ga0501031_0001496 3300049568 Bacteria 14549
382 Ga0501032_0036022 3300049569 Bacteria 3380
383 Ga0501033_0003793 3300049570 Bacteria 12288
384 Ga0501033_0023226 3300049570 Bacteria 4678
385 Ga0501034_0063189 3300049571 Bacteria 3716
386 Ga0501034_0104214 3300049571 Bacteria 2830
387 Ga0501036_0000231 3300049572 Bacteria 37336
388 Ga0501037_0004843 3300049573 Bacteria 9794
389 Ga0501037_0049549 3300049573 Bacteria 3075
390 Ga0501037_0079897 3300049573 Bacteria 2374
391 Ga0501038_0000866 3300049574 Bacteria 26777
392 Ga0501039_0149059 3300049575 Bacteria 1838
393 Ga0501043_0117970 3300049579 Bacteria 2082
394 Ga0501046_0020323 3300049580 Bacteria 5494
395 Ga0501046_0055464 3300049580 Bacteria 3113
396 Ga0501047_0006252 3300049581 Bacteria 11198
397 Ga0501047_0009830 3300049581 Bacteria 9039
398 Ga0501047_0207590 3300049581 Bacteria 1818
399 Ga0501266_000744 3300049763 Bacteria 4226
400 Ga0501035_0005235 3300049822 Bacteria 12284
401 Ga0501035_0005243 3300049822 Bacteria 12269
402 Ga0501035_0206419 3300049822 Bacteria 1683
403 Ga0501044_0000183 3300049823 Bacteria 77954
404 Ga0501044_0000308 3300049823 Bacteria 61612
405 Ga0501044_0001271 3300049823 Bacteria 29802
406 Ga0501044_0043509 3300049823 Bacteria 4664
407 nmdc:mga00v17_119775_c1 3300050491 Bacteria 1675
408 nmdc:mga00v17_1483_c1 3300050491 Bacteria 12278
409 nmdc:mga00v17_2553_c1 3300050491 Bacteria 9337
410 nmdc:mga00v17_41347_c1 3300050491 Bacteria 2768
411 nmdc:mga0k408_85089_c1 3300050493 Bacteria 1856
412 nmdc:mga0qj67_43551_c1 3300050509 Bacteria 3535
413 nmdc:mga06r32_13458_c1 3300050510 Bacteria 7411
414 Ga0500590_022453 3300053148 Bacteria 3277
415 Ga0500600_0001704 3300053149 Bacteria 11871
416 Ga0500634_0027712 3300053161 Bacteria 3087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0532316 Ga0453684_0532316_44_1069 316
2 3300050491 nmdc:mga00v17_119775_c1 nmdc:mga00v17_119775_c1_28_1068 328
3 3300046513 Ga0495616_0017224 Ga0495616_0017224_13_1017 330
4 iso_pu_bacteria 640427133 640487503 330
5 3300046518 Ga0495631_0076716 Ga0495631_0076716_33_1067 340
6 3300046691 Ga0495670_0124959 Ga0495670_0124959_303_1325 340
7 3300005616 Ga0068852_100002484 Ga0068852_1000024843 347
8 3300009093 Ga0105240_10006901 Ga0105240_100069012 347
9 3300009545 Ga0105237_10017038 Ga0105237_100170385 347
10 3300009551 Ga0105238_10000630 Ga0105238_100006304 347
11 3300025913 Ga0207695_10000014 Ga0207695_10000014535 347
12 3300025924 Ga0207694_10003132 Ga0207694_100031326 347
13 3300026142 Ga0207698_10051097 Ga0207698_100510972 347
14 3300046690 Ga0495624_0241515 Ga0495624_0241515_15_1064 349
15 iso_pu_bacteria 651053060 651175442 350
16 3300005466 Ga0070685_10000507 Ga0070685_100005075 352
17 3300044712 Ga0453684_0425924 Ga0453684_0425924_135_1319 355
18 3300044712 Ga0453684_0000839 Ga0453684_0000839_83097_84281 356
19 3300053149 Ga0500600_0001704 Ga0500600_0001704_7189_8376 356
20 3300046454 Ga0495592_0182539 Ga0495592_0182539_158_1300 357
21 3300053148 Ga0500590_022453 Ga0500590_022453_51_1193 357
22 3300048929 Ga0496126_0280497 Ga0496126_0280497_34_1242 362
23 3300046492 Ga0495585_0002042 Ga0495585_0002042_10648_11826 365
24 3300046518 Ga0495631_0005362 Ga0495631_0005362_4473_5651 365
25 3300046558 Ga0495633_0050201 Ga0495633_0050201_160_1338 365
26 3300046665 Ga0495661_0007599 Ga0495661_0007599_1469_2647 365
27 3300046691 Ga0495670_0002700 Ga0495670_0002700_2775_3953 365
28 3300047445 Ga0495677_0007832 Ga0495677_0007832_2296_3474 365
29 3300047470 Ga0495681_0003547 Ga0495681_0003547_4483_5661 365
30 3300046463 Ga0495653_0020220 Ga0495653_0020220_1943_3055 366
31 3300046491 Ga0495584_0041009 Ga0495584_0041009_12_1124 366
32 3300046492 Ga0495585_0041867 Ga0495585_0041867_1115_2215 366
33 3300046500 Ga0495596_0045062 Ga0495596_0045062_547_1659 366
34 3300046535 Ga0495586_0001068 Ga0495586_0001068_4164_5276 366
35 3300046663 Ga0495635_0002495 Ga0495635_0002495_6269_7381 366
36 3300047444 Ga0495675_0006848 Ga0495675_0006848_4977_6089 366
37 3300047673 Ga0495593_0012478 Ga0495593_0012478_2885_3997 366
38 3300049573 Ga0501037_0049549 Ga0501037_0049549_1005_2228 366
39 3300046491 Ga0495584_0015811 Ga0495584_0015811_2480_3595 367
40 3300047315 Ga0495581_0011150 Ga0495581_0011150_3060_4163 367
41 3300047317 Ga0495604_0098837 Ga0495604_0098837_789_1892 367
42 3300048922 Ga0496119_0006665 Ga0496119_0006665_4782_5978 368
43 3300031727 Ga0316576_10146501 Ga0316576_101465011 369
44 3300031911 Ga0307412_10010711 Ga0307412_100107112 369
45 3300041404 Ga0439436_0044803 Ga0439436_0044803_12_1208 369
46 3300048919 Ga0496116_0013936 Ga0496116_0013936_1286_2482 369
47 3300048919 Ga0496116_0047916 Ga0496116_0047916_371_1567 369
48 3300048920 Ga0496117_0006426 Ga0496117_0006426_5261_6457 369
49 3300048921 Ga0496118_0011683 Ga0496118_0011683_2624_3820 369
50 3300048923 Ga0496120_0004220 Ga0496120_0004220_4884_6080 369
51 3300048924 Ga0496121_0000124 Ga0496121_0000124_84517_85713 369
52 3300048925 Ga0496122_0000316 Ga0496122_0000316_83884_85080 369
53 3300048926 Ga0496123_0000297 Ga0496123_0000297_83884_85080 369
54 3300048928 Ga0496125_0000570 Ga0496125_0000570_32736_33932 369
55 3300048928 Ga0496125_0086881 Ga0496125_0086881_474_1670 369
56 3300048929 Ga0496126_0012075 Ga0496126_0012075_2688_3884 369
57 3300048929 Ga0496126_0072707 Ga0496126_0072707_1538_2734 369
58 3300046501 Ga0495607_0025568 Ga0495607_0025568_230_1393 370
59 3300046794 Ga0495589_0054810 Ga0495589_0054810_337_1500 370
60 iso_pu_bacteria 2643221569 2643863249 370
61 3300005617 Ga0068859_100127990 Ga0068859_1001279902 371
62 3300005841 Ga0068863_100014419 Ga0068863_1000144196 371
63 3300006931 Ga0097620_100127984 Ga0097620_1001279842 371
64 3300009551 Ga0105238_10004531 Ga0105238_100045314 371
65 3300025924 Ga0207694_10012769 Ga0207694_100127696 371
66 3300026088 Ga0207641_10014774 Ga0207641_100147745 371
67 3300031344 Ga0265316_10000151 Ga0265316_1000015116 371
68 3300037471 Ga0395905_0030564 Ga0395905_0030564_2639_3787 371
69 3300039062 Ga0400483_169233 Ga0400483_169233_4723_5850 371
70 3300050491 nmdc:mga00v17_2553_c1 nmdc:mga00v17_2553_c1_6168_7364 371
71 3300003187 JGI25151J46595_10001410 JGI25151J46595_100014104 372
72 3300005289 Ga0065704_10072566 Ga0065704_100725667 372
73 3300025294 Ga0209025_1000018 Ga0209025_1000018480 372
74 3300031251 Ga0265327_10000184 Ga0265327_1000018439 372
75 3300037418 Ga0395900_0010617 Ga0395900_0010617_3162_4343 372
76 3300048925 Ga0496122_0038722 Ga0496122_0038722_1745_2878 372
77 3300048926 Ga0496123_0050028 Ga0496123_0050028_515_1648 372
78 3300048928 Ga0496125_0002556 Ga0496125_0002556_20554_21687 372
79 3300048929 Ga0496126_0023381 Ga0496126_0023381_589_1722 372
80 3300049763 Ga0501266_000744 Ga0501266_000744_1340_2473 372
81 3300013104 Ga0157370_10001690 Ga0157370_1000169020 373
82 3300013104 Ga0157370_10071507 Ga0157370_100715073 373
83 3300046460 Ga0495638_0051514 Ga0495638_0051514_431_1636 373
84 3300046507 Ga0495606_0000441 Ga0495606_0000441_64294_65427 373
85 3300046522 Ga0495643_0009395 Ga0495643_0009395_734_1867 373
86 3300046522 Ga0495643_0035525 Ga0495643_0035525_862_1995 373
87 3300046542 Ga0495597_0001860 Ga0495597_0001860_10151_11287 373
88 3300046692 Ga0495671_0012029 Ga0495671_0012029_80_1213 373
89 3300046694 Ga0495649_0016951 Ga0495649_0016951_2528_3661 373
90 3300046694 Ga0495649_0072597 Ga0495649_0072597_311_1444 373
91 3300047470 Ga0495681_0067655 Ga0495681_0067655_79_1212 373
92 iso_pu_bacteria 2738543020 2739286650 373
93 iso_pu_bacteria 2738543021 2739291963 373
94 iso_pu_bacteria 2808606379 2808939456 373
95 iso_pu_bacteria 2842805378 2842809370 373
96 3300046674 Ga0495588_0014865 Ga0495588_0014865_225_1406 374
97 3300047321 Ga0495676_0002063 Ga0495676_0002063_4003_5139 374
98 3300048913 Ga0496110_0000059 Ga0496110_0000059_5838_6962 374
99 3300009148 Ga0105243_10000729 Ga0105243_100007295 375
100 3300045051 Ga0451576_0000250 Ga0451576_0000250_80497_81624 375
101 3300045051 Ga0451576_0288964 Ga0451576_0288964_254_1381 375
102 3300046506 Ga0495583_0013050 Ga0495583_0013050_2213_3352 375
103 iso_pu_bacteria 2565956521 2566035584 375
104 iso_pu_bacteria 8048746797 8048749288 375
105 3300003763 Ga0055529_1001764 Ga0055529_10017646 376
106 3300005355 Ga0070671_100054196 Ga0070671_1000541964 376
107 3300005548 Ga0070665_100036086 Ga0070665_1000360864 376
108 3300005617 Ga0068859_100015273 Ga0068859_1000152735 376
109 3300005618 Ga0068864_100050299 Ga0068864_1000502992 376
110 3300005843 Ga0068860_100086822 Ga0068860_1000868223 376
111 3300006931 Ga0097620_100015274 Ga0097620_1000152746 376
112 3300009098 Ga0105245_10226541 Ga0105245_102265412 376
113 3300011119 Ga0105246_10310909 Ga0105246_103109091 376
114 3300014968 Ga0157379_10184401 Ga0157379_101844012 376
115 3300025272 Ga0209455_1000515 Ga0209455_10005151 376
116 3300025927 Ga0207687_10032718 Ga0207687_100327182 376
117 3300026095 Ga0207676_10203639 Ga0207676_102036392 376
118 3300028379 Ga0268266_10013874 Ga0268266_100138747 376
119 3300028381 Ga0268264_10101444 Ga0268264_101014443 376
120 3300031235 Ga0265330_10000793 Ga0265330_1000079316 376
121 3300031238 Ga0265332_10000064 Ga0265332_1000006464 376
122 3300031241 Ga0265325_10035970 Ga0265325_100359704 376
123 3300031711 Ga0265314_10000177 Ga0265314_1000017724 376
124 3300035695 Ga0373927_0177106 Ga0373927_0177106_223_1368 376
125 3300037068 Ga0373925_0001241 Ga0373925_0001241_20688_21833 376
126 3300046474 Ga0495605_0011534 Ga0495605_0011534_1512_2702 376
127 3300048091 Ga0495626_0019587 Ga0495626_0019587_138_1328 376
128 3300049580 Ga0501046_0055464 Ga0501046_0055464_1730_2872 376
129 iso_pu_bacteria 2599185292 2599907045 376
130 iso_pu_bacteria 2643221594 2643978655 376
131 iso_pu_bacteria 2643221621 2644121801 376
132 iso_pu_bacteria 2808606395 2809036588 376
133 iso_pu_bacteria 2857537821 2857541225 376
134 iso_pu_bacteria 2857542790 2857545917 376
135 iso_pu_bacteria 2857576091 2857576870 376
136 iso_pu_bacteria 2858950400 2858953870 376
137 iso_pu_bacteria 2895511927 2895515087 376
138 iso_pu_bacteria 2941479691 2941481098 376
139 iso_pu_bacteria 8055225921 8055228136 376
140 3300021361 Ga0213872_10000004 Ga0213872_1000000436 377
141 3300031239 Ga0265328_10013082 Ga0265328_100130822 377
142 3300039447 Ga0436361_0583521 Ga0436361_0583521_14528_15661 377
143 3300046457 Ga0495590_0000717 Ga0495590_0000717_13009_14214 377
144 3300046471 Ga0495650_0026937 Ga0495650_0026937_1367_2500 377
145 3300046501 Ga0495607_0026631 Ga0495607_0026631_886_2091 377
146 3300046506 Ga0495583_0007617 Ga0495583_0007617_1269_2474 377
147 3300046506 Ga0495583_0011992 Ga0495583_0011992_1449_2594 377
148 3300046513 Ga0495616_0034413 Ga0495616_0034413_523_1728 377
149 3300046518 Ga0495631_0000136 Ga0495631_0000136_38607_39812 377
150 3300046522 Ga0495643_0018503 Ga0495643_0018503_1830_3035 377
151 3300046530 Ga0495654_0022608 Ga0495654_0022608_476_1681 377
152 3300046616 Ga0495668_0006958 Ga0495668_0006958_4151_5356 377
153 3300047446 Ga0495679_003071 Ga0495679_003071_2439_3644 377
154 3300047447 Ga0495685_000846 Ga0495685_000846_570_1775 377
155 3300048905 Ga0496102_0280203 Ga0496102_0280203_236_1369 377
156 3300048906 Ga0496103_0090246 Ga0496103_0090246_389_1522 377
157 3300048912 Ga0496109_0326534 Ga0496109_0326534_122_1255 377
158 iso_pu_bacteria 2739367655 2739612652 377
159 iso_pu_bacteria 2881927736 2881928351 377
160 iso_pu_bacteria 2887375801 2887379446 377
161 3300005563 Ga0068855_100116641 Ga0068855_1001166412 378
162 3300025949 Ga0207667_10324065 Ga0207667_103240652 378
163 3300031548 Ga0307408_100000068 Ga0307408_10000006895 378
164 3300031901 Ga0307406_10001487 Ga0307406_1000148711 378
165 3300036401 Ga0373937_0170668 Ga0373937_0170668_665_1804 378
166 3300037418 Ga0395900_0001322 Ga0395900_0001322_16680_17897 378
167 3300048924 Ga0496121_0019886 Ga0496121_0019886_337_1527 378
168 3300053161 Ga0500634_0027712 Ga0500634_0027712_1687_2934 378
169 iso_pu_bacteria 2547132374 2548496923 378
170 iso_pu_bacteria 2643221570 2643864969 378
171 iso_pu_bacteria 2643221596 2643990368 378
172 iso_pu_bacteria 2643221652 2644296010 378
173 iso_pu_bacteria 2643221717 2644645573 378
174 iso_pu_bacteria 2990710928 2990711890 378
175 3300006051 Ga0075364_10003737 Ga0075364_100037374 379
176 3300027876 Ga0209974_10001586 Ga0209974_100015863 379
177 3300042876 Ga0451577_0026518 Ga0451577_0026518_1733_2875 379
178 3300044673 Ga0453683_0049342 Ga0453683_0049342_565_1707 379
179 3300045051 Ga0451576_0024661 Ga0451576_0024661_2086_3252 379
180 3300045051 Ga0451576_0195018 Ga0451576_0195018_43_1185 379
181 3300046452 Ga0495617_000001 Ga0495617_000001_732471_733622 379
182 3300046453 Ga0495627_000300 Ga0495627_000300_42219_43370 379
183 3300046474 Ga0495605_0000004 Ga0495605_0000004_382343_383494 379
184 3300046474 Ga0495605_0004522 Ga0495605_0004522_2267_3430 379
185 3300046492 Ga0495585_0004840 Ga0495585_0004840_5619_6758 379
186 3300046492 Ga0495585_0065149 Ga0495585_0065149_86_1249 379
187 3300046501 Ga0495607_0008715 Ga0495607_0008715_4957_6108 379
188 3300046506 Ga0495583_0010644 Ga0495583_0010644_2132_3295 379
189 3300046513 Ga0495616_0008203 Ga0495616_0008203_466_1629 379
190 3300046513 Ga0495616_0014824 Ga0495616_0014824_961_2112 379
191 3300046518 Ga0495631_0016391 Ga0495631_0016391_1766_2917 379
192 3300046518 Ga0495631_0018949 Ga0495631_0018949_281_1444 379
193 3300046519 Ga0495632_0000033 Ga0495632_0000033_150705_151856 379
194 3300046520 Ga0495637_0046844 Ga0495637_0046844_235_1398 379
195 3300046524 Ga0495648_0004684 Ga0495648_0004684_5057_6208 379
196 3300046528 Ga0495642_0000544 Ga0495642_0000544_5459_6610 379
197 3300046616 Ga0495668_0002081 Ga0495668_0002081_11610_12761 379
198 3300046648 Ga0495611_0002824 Ga0495611_0002824_3268_4407 379
199 3300046665 Ga0495661_0002561 Ga0495661_0002561_529_1680 379
200 3300046665 Ga0495661_0004038 Ga0495661_0004038_4914_6065 379
201 3300046665 Ga0495661_0015740 Ga0495661_0015740_3620_4771 379
202 3300046665 Ga0495661_0077931 Ga0495661_0077931_281_1444 379
203 3300046684 Ga0495669_0003143 Ga0495669_0003143_3364_4515 379
204 3300046684 Ga0495669_0017631 Ga0495669_0017631_990_2129 379
205 3300046684 Ga0495669_0018064 Ga0495669_0018064_1257_2402 379
206 3300046691 Ga0495670_0012660 Ga0495670_0012660_320_1468 379
207 3300046794 Ga0495589_0001542 Ga0495589_0001542_364_1515 379
208 3300046810 Ga0495660_0032139 Ga0495660_0032139_143_1306 379
209 3300047445 Ga0495677_0004366 Ga0495677_0004366_1358_2509 379
210 3300047446 Ga0495679_033723 Ga0495679_033723_295_1446 379
211 3300047447 Ga0495685_001657 Ga0495685_001657_1967_3130 379
212 3300047470 Ga0495681_0004436 Ga0495681_0004436_5119_6270 379
213 3300047472 Ga0495686_0085645 Ga0495686_0085645_371_1522 379
214 3300048091 Ga0495626_0007191 Ga0495626_0007191_636_1775 379
215 3300048091 Ga0495626_0025396 Ga0495626_0025396_541_1698 379
216 3300048091 Ga0495626_0048744 Ga0495626_0048744_177_1340 379
217 3300048903 Ga0496100_0087031 Ga0496100_0087031_470_1621 379
218 3300048904 Ga0496101_0196200 Ga0496101_0196200_250_1401 379
219 3300048912 Ga0496109_0012888 Ga0496109_0012888_4633_5784 379
220 3300048913 Ga0496110_0076228 Ga0496110_0076228_187_1338 379
221 3300048915 Ga0496112_0088432 Ga0496112_0088432_1758_2909 379
222 3300048916 Ga0496113_0006969 Ga0496113_0006969_3222_4373 379
223 3300048916 Ga0496113_0170855 Ga0496113_0170855_431_1576 379
224 3300048925 Ga0496122_0000727 Ga0496122_0000727_57790_58941 379
225 3300048926 Ga0496123_0003588 Ga0496123_0003588_10437_11588 379
226 3300048928 Ga0496125_0004074 Ga0496125_0004074_5402_6553 379
227 3300049460 Ga0495682_0032467 Ga0495682_0032467_273_1436 379
228 3300049569 Ga0501032_0036022 Ga0501032_0036022_521_1738 379
229 3300049571 Ga0501034_0063189 Ga0501034_0063189_1857_3074 379
230 3300049573 Ga0501037_0079897 Ga0501037_0079897_340_1560 379
231 3300049575 Ga0501039_0149059 Ga0501039_0149059_122_1339 379
232 3300049581 Ga0501047_0009830 Ga0501047_0009830_3719_4936 379
233 3300049581 Ga0501047_0207590 Ga0501047_0207590_244_1464 379
234 3300049822 Ga0501035_0005235 Ga0501035_0005235_6605_7822 379
235 3300049822 Ga0501035_0005243 Ga0501035_0005243_9067_10287 379
236 3300049823 Ga0501044_0000308 Ga0501044_0000308_53454_54671 379
237 3300049823 Ga0501044_0043509 Ga0501044_0043509_1347_2567 379
238 iso_pu_bacteria 2643221556 2643799837 379
239 iso_pu_bacteria 2643221684 2644474837 379
240 iso_pu_bacteria 2738543012 2739245421 379
241 iso_pu_bacteria 2816332133 2816474784 379
242 iso_pu_bacteria 2894023352 2894026468 379
243 3300003791 Ga0055530_10017926 Ga0055530_100179262 380
244 3300006051 Ga0075364_10003778 Ga0075364_100037787 380
245 3300025292 Ga0209676_1006346 Ga0209676_10063466 380
246 3300025298 Ga0209050_1001037 Ga0209050_100103718 380
247 3300025303 Ga0209051_1019502 Ga0209051_10195023 380
248 3300044712 Ga0453684_0000280 Ga0453684_0000280_178376_179524 380
249 3300046473 Ga0495582_0006240 Ga0495582_0006240_3687_4874 380
250 3300046492 Ga0495585_0012772 Ga0495585_0012772_1602_2744 380
251 3300046501 Ga0495607_0000021 Ga0495607_0000021_14764_15924 380
252 3300046501 Ga0495607_0002037 Ga0495607_0002037_10715_11902 380
253 3300046524 Ga0495648_0057406 Ga0495648_0057406_878_2020 380
254 3300046674 Ga0495588_0051882 Ga0495588_0051882_442_1584 380
255 3300047320 Ga0495672_0000254 Ga0495672_0000254_11962_13116 380
256 3300047443 Ga0495687_000002 Ga0495687_000002_531615_532757 380
257 3300048927 Ga0496124_0000004 Ga0496124_0000004_397692_398888 380
258 3300049579 Ga0501043_0117970 Ga0501043_0117970_833_2068 380
259 3300049823 Ga0501044_0000183 Ga0501044_0000183_66761_67996 380
260 3300050491 nmdc:mga00v17_41347_c1 nmdc:mga00v17_41347_c1_1078_2274 380
261 iso_pu_bacteria 2643221609 2644062494 380
262 iso_pu_bacteria 2643221611 2644076475 380
263 3300046457 Ga0495590_0000373 Ga0495590_0000373_15523_16674 381
264 3300046459 Ga0495629_0067946 Ga0495629_0067946_10_1200 381
265 3300046694 Ga0495649_0012391 Ga0495649_0012391_1292_2449 381
266 3300048088 Ga0495602_0024394 Ga0495602_0024394_3222_4385 381
267 3300048929 Ga0496126_0015600 Ga0496126_0015600_4099_5259 381
268 3300049568 Ga0501031_0001496 Ga0501031_0001496_12588_13811 381
269 3300049570 Ga0501033_0003793 Ga0501033_0003793_10506_11729 381
270 3300049572 Ga0501036_0000231 Ga0501036_0000231_17175_18398 381
271 3300049573 Ga0501037_0004843 Ga0501037_0004843_4556_5779 381
272 3300049574 Ga0501038_0000866 Ga0501038_0000866_21506_22729 381
273 3300049580 Ga0501046_0020323 Ga0501046_0020323_256_1479 381
274 3300049581 Ga0501047_0006252 Ga0501047_0006252_2915_4138 381
275 3300049822 Ga0501035_0206419 Ga0501035_0206419_61_1242 381
276 3300049823 Ga0501044_0001271 Ga0501044_0001271_5069_6292 381
277 3300050491 nmdc:mga00v17_1483_c1 nmdc:mga00v17_1483_c1_4297_5457 381
278 iso_pu_bacteria 2574179768 2574432055 381
279 iso_pu_bacteria 2721755523 2722882568 381
280 iso_pu_bacteria 2839138175 2839141170 381
281 3300006881 Ga0068865_100001521 Ga0068865_1000015212 382
282 3300009176 Ga0105242_10001773 Ga0105242_100017735 382
283 3300013306 Ga0163162_10004723 Ga0163162_100047235 382
284 3300013308 Ga0157375_10000202 Ga0157375_1000020221 382
285 3300014969 Ga0157376_10020363 Ga0157376_100203632 382
286 3300025916 Ga0207663_10127258 Ga0207663_101272582 382
287 3300025934 Ga0207686_10011196 Ga0207686_100111964 382
288 3300037418 Ga0395900_0000402 Ga0395900_0000402_45119_46279 382
289 3300038443 Ga0395901_0001370 Ga0395901_0001370_7757_8917 382
290 3300048907 Ga0496104_0000016 Ga0496104_0000016_232357_233550 382
291 3300048908 Ga0496105_0000035 Ga0496105_0000035_101123_102316 382
292 iso_pu_bacteria 8002392321 8002394441 382
293 3300006946 Ga0079104_1000025 Ga0079104_100002519 383
294 3300025935 Ga0207709_10000170 Ga0207709_1000017060 383
295 3300027111 Ga0209281_1000007 Ga0209281_1000007201 383
296 3300046471 Ga0495650_0000631 Ga0495650_0000631_5263_6414 383
297 3300046474 Ga0495605_0034511 Ga0495605_0034511_447_1598 383
298 3300046500 Ga0495596_0000302 Ga0495596_0000302_19861_21012 383
299 3300046524 Ga0495648_0018298 Ga0495648_0018298_2397_3548 383
300 3300046538 Ga0495609_0003818 Ga0495609_0003818_5272_6423 383
301 3300047320 Ga0495672_0012507 Ga0495672_0012507_4603_5754 383
302 3300049570 Ga0501033_0023226 Ga0501033_0023226_1031_2194 383
303 3300049571 Ga0501034_0104214 Ga0501034_0104214_1298_2527 383
304 3300039110 Ga0400487_47620 Ga0400487_47620_2505_3680 384
305 3300046452 Ga0495617_000143 Ga0495617_000143_13661_14815 384
306 3300046492 Ga0495585_0000059 Ga0495585_0000059_97807_98961 384
307 3300046513 Ga0495616_0003194 Ga0495616_0003194_1150_2304 384
308 3300046524 Ga0495648_0000057 Ga0495648_0000057_103116_104270 384
309 3300046536 Ga0495587_0027552 Ga0495587_0027552_414_1568 384
310 3300046679 Ga0495623_0014663 Ga0495623_0014663_3260_4414 384
311 3300046689 Ga0495613_0041471 Ga0495613_0041471_1389_2543 384
312 3300046809 Ga0495600_0047965 Ga0495600_0047965_915_2069 384
313 iso_pu_bacteria 2648501241 2649121630 384
314 iso_pu_bacteria 2651869818 2652973985 384
315 iso_pu_bacteria 2855730933 2855731471 384
316 iso_pu_bacteria 2855767633 2855768177 384
317 iso_pu_bacteria 2881412998 2881413653 384
318 3300005564 Ga0070664_100137360 Ga0070664_1001373602 385
319 3300046452 Ga0495617_007802 Ga0495617_007802_519_1688 385
320 3300046455 Ga0495603_0004406 Ga0495603_0004406_2172_3341 385
321 3300046455 Ga0495603_0056701 Ga0495603_0056701_623_1804 385
322 3300046457 Ga0495590_0000024 Ga0495590_0000024_12593_13762 385
323 3300046458 Ga0495591_003683 Ga0495591_003683_5587_6756 385
324 3300046463 Ga0495653_0030379 Ga0495653_0030379_852_2033 385
325 3300046472 Ga0495580_0037115 Ga0495580_0037115_944_2125 385
326 3300046473 Ga0495582_0001762 Ga0495582_0001762_963_2144 385
327 3300046474 Ga0495605_0022613 Ga0495605_0022613_1989_3158 385
328 3300046491 Ga0495584_0001952 Ga0495584_0001952_5217_6386 385
329 3300046492 Ga0495585_0004312 Ga0495585_0004312_3385_4578 385
330 3300046499 Ga0495594_0005237 Ga0495594_0005237_328_1509 385
331 3300046500 Ga0495596_0007199 Ga0495596_0007199_720_1901 385
332 3300046506 Ga0495583_0005267 Ga0495583_0005267_3073_4242 385
333 3300046506 Ga0495583_0007000 Ga0495583_0007000_2895_4076 385
334 3300046512 Ga0495610_0000345 Ga0495610_0000345_22894_24063 385
335 3300046513 Ga0495616_0000404 Ga0495616_0000404_2231_3400 385
336 3300046513 Ga0495616_0045114 Ga0495616_0045114_769_1938 385
337 3300046518 Ga0495631_0004984 Ga0495631_0004984_604_1773 385
338 3300046518 Ga0495631_0065417 Ga0495631_0065417_122_1291 385
339 3300046519 Ga0495632_0005116 Ga0495632_0005116_4965_6134 385
340 3300046519 Ga0495632_0005860 Ga0495632_0005860_2328_3497 385
341 3300046520 Ga0495637_0000008 Ga0495637_0000008_347858_349027 385
342 3300046522 Ga0495643_0002405 Ga0495643_0002405_7145_8329 385
343 3300046522 Ga0495643_0023294 Ga0495643_0023294_2120_3289 385
344 3300046523 Ga0495644_0028213 Ga0495644_0028213_342_1511 385
345 3300046524 Ga0495648_0018490 Ga0495648_0018490_609_1802 385
346 3300046524 Ga0495648_0024042 Ga0495648_0024042_2201_3382 385
347 3300046528 Ga0495642_0003398 Ga0495642_0003398_595_1764 385
348 3300046529 Ga0495652_0013032 Ga0495652_0013032_4411_5592 385
349 3300046530 Ga0495654_0021630 Ga0495654_0021630_1484_2653 385
350 3300046535 Ga0495586_0004323 Ga0495586_0004323_2426_3607 385
351 3300046542 Ga0495597_0001945 Ga0495597_0001945_512_1705 385
352 3300046542 Ga0495597_0057332 Ga0495597_0057332_300_1493 385
353 3300046542 Ga0495597_0059301 Ga0495597_0059301_26_1207 385
354 3300046558 Ga0495633_0005033 Ga0495633_0005033_2655_3824 385
355 3300046558 Ga0495633_0010552 Ga0495633_0010552_1292_2485 385
356 3300046616 Ga0495668_0001948 Ga0495668_0001948_10588_11757 385
357 3300046642 Ga0495634_0043190 Ga0495634_0043190_452_1633 385
358 3300046648 Ga0495611_0001540 Ga0495611_0001540_4961_6130 385
359 3300046694 Ga0495649_0000216 Ga0495649_0000216_7497_8666 385
360 3300047320 Ga0495672_0000163 Ga0495672_0000163_82779_83948 385
361 3300047323 Ga0495683_0003342 Ga0495683_0003342_4961_6130 385
362 3300047443 Ga0495687_000007 Ga0495687_000007_477337_478530 385
363 3300047443 Ga0495687_006244 Ga0495687_006244_4836_6017 385
364 3300047444 Ga0495675_0004466 Ga0495675_0004466_4592_5773 385
365 3300047445 Ga0495677_0002190 Ga0495677_0002190_3497_4666 385
366 3300048091 Ga0495626_0025395 Ga0495626_0025395_1201_2385 385
367 3300048091 Ga0495626_0027244 Ga0495626_0027244_811_1980 385
368 3300048091 Ga0495626_0058255 Ga0495626_0058255_467_1660 385
369 3300048091 Ga0495626_0073493 Ga0495626_0073493_202_1383 385
370 3300048905 Ga0496102_0000514 Ga0496102_0000514_13820_14989 385
371 3300048906 Ga0496103_0100837 Ga0496103_0100837_359_1528 385
372 3300049459 Ga0495678_000157 Ga0495678_000157_51952_53121 385
373 3300049459 Ga0495678_001426 Ga0495678_001426_17195_18376 385
374 3300049460 Ga0495682_0030766 Ga0495682_0030766_453_1622 385
375 3300005262 Ga0065165_1005223 Ga0065165_10052237 386
376 3300006846 Ga0075430_100066755 Ga0075430_1000667553 386
377 3300006847 Ga0075431_100003069 Ga0075431_1000030694 386
378 3300031731 Ga0307405_10082658 Ga0307405_100826582 386
379 3300032002 Ga0307416_100089899 Ga0307416_1000898992 386
380 3300037312 Ga0395899_0000139 Ga0395899_0000139_91293_92453 386
381 3300038443 Ga0395901_0127918 Ga0395901_0127918_1368_2552 386
382 3300046453 Ga0495627_008508 Ga0495627_008508_261_1445 386
383 3300046455 Ga0495603_0008826 Ga0495603_0008826_486_1646 386
384 3300046459 Ga0495629_0032534 Ga0495629_0032534_1722_2882 386
385 3300046460 Ga0495638_0110556 Ga0495638_0110556_73_1233 386
386 3300046491 Ga0495584_0000064 Ga0495584_0000064_12493_13653 386
387 3300046491 Ga0495584_0004397 Ga0495584_0004397_4697_5857 386
388 3300046491 Ga0495584_0006813 Ga0495584_0006813_157_1353 386
389 3300046491 Ga0495584_0023158 Ga0495584_0023158_850_2010 386
390 3300046492 Ga0495585_0000032 Ga0495585_0000032_141268_142428 386
391 3300046492 Ga0495585_0005840 Ga0495585_0005840_4979_6139 386
392 3300046492 Ga0495585_0031410 Ga0495585_0031410_1314_2474 386
393 3300046492 Ga0495585_0031711 Ga0495585_0031711_932_2092 386
394 3300046499 Ga0495594_0007270 Ga0495594_0007270_4463_5623 386
395 3300046500 Ga0495596_0003907 Ga0495596_0003907_5131_6291 386
396 3300046500 Ga0495596_0008947 Ga0495596_0008947_23_1219 386
397 3300046501 Ga0495607_0021093 Ga0495607_0021093_2470_3630 386
398 3300046506 Ga0495583_0003237 Ga0495583_0003237_4908_6068 386
399 3300046506 Ga0495583_0047149 Ga0495583_0047149_246_1406 386
400 3300046506 Ga0495583_0071720 Ga0495583_0071720_50_1246 386
401 3300046507 Ga0495606_0011752 Ga0495606_0011752_5241_6401 386
402 3300046507 Ga0495606_0013367 Ga0495606_0013367_955_2115 386
403 3300046507 Ga0495606_0099111 Ga0495606_0099111_183_1343 386
404 3300046513 Ga0495616_0010769 Ga0495616_0010769_1391_2551 386
405 3300046515 Ga0495620_0008072 Ga0495620_0008072_68_1228 386
406 3300046518 Ga0495631_0012084 Ga0495631_0012084_1436_2608 386
407 3300046518 Ga0495631_0014207 Ga0495631_0014207_347_1507 386
408 3300046518 Ga0495631_0016740 Ga0495631_0016740_1990_3150 386
409 3300046519 Ga0495632_0004300 Ga0495632_0004300_5444_6631 386
410 3300046519 Ga0495632_0004414 Ga0495632_0004414_3031_4215 386
411 3300046523 Ga0495644_0046587 Ga0495644_0046587_251_1435 386
412 3300046523 Ga0495644_0047448 Ga0495644_0047448_142_1302 386
413 3300046526 Ga0495666_0000637 Ga0495666_0000637_4130_5302 386
414 3300046528 Ga0495642_0002285 Ga0495642_0002285_6251_7435 386
415 3300046528 Ga0495642_0010736 Ga0495642_0010736_82_1242 386
416 3300046542 Ga0495597_0006969 Ga0495597_0006969_257_1453 386
417 3300046542 Ga0495597_0007933 Ga0495597_0007933_1142_2302 386
418 3300046557 Ga0495622_0058020 Ga0495622_0058020_273_1433 386
419 3300046558 Ga0495633_0010329 Ga0495633_0010329_3591_4751 386
420 3300046558 Ga0495633_0023271 Ga0495633_0023271_1519_2679 386
421 3300046558 Ga0495633_0061507 Ga0495633_0061507_297_1457 386
422 3300046616 Ga0495668_0018772 Ga0495668_0018772_2516_3676 386
423 3300046648 Ga0495611_0006577 Ga0495611_0006577_476_1636 386
424 3300046665 Ga0495661_0043883 Ga0495661_0043883_1167_2327 386
425 3300046684 Ga0495669_0022981 Ga0495669_0022981_367_1527 386
426 3300046691 Ga0495670_0003329 Ga0495670_0003329_5783_6943 386
427 3300046691 Ga0495670_0033261 Ga0495670_0033261_984_2144 386
428 3300046810 Ga0495660_0077906 Ga0495660_0077906_342_1526 386
429 3300047318 Ga0495636_0006798 Ga0495636_0006798_236_1396 386
430 3300047319 Ga0495674_0064488 Ga0495674_0064488_35_1195 386
431 3300047321 Ga0495676_0071186 Ga0495676_0071186_864_2024 386
432 3300047323 Ga0495683_0001099 Ga0495683_0001099_4895_6055 386
433 3300047323 Ga0495683_0013322 Ga0495683_0013322_1886_3058 386
434 3300047323 Ga0495683_0083643 Ga0495683_0083643_360_1520 386
435 3300047444 Ga0495675_0121739 Ga0495675_0121739_115_1275 386
436 3300047445 Ga0495677_0003298 Ga0495677_0003298_220_1380 386
437 3300047470 Ga0495681_0007449 Ga0495681_0007449_5478_6650 386
438 3300047470 Ga0495681_0013625 Ga0495681_0013625_3180_4364 386
439 3300048091 Ga0495626_0045453 Ga0495626_0045453_510_1685 386
440 3300048091 Ga0495626_0065382 Ga0495626_0065382_33_1193 386
441 3300048918 Ga0496115_0027215 Ga0496115_0027215_945_2105 386
442 3300048918 Ga0496115_0069325 Ga0496115_0069325_557_1717 386
443 3300048927 Ga0496124_0085732 Ga0496124_0085732_1078_2250 386
444 3300049459 Ga0495678_003661 Ga0495678_003661_5085_6269 386
445 3300049460 Ga0495682_0001021 Ga0495682_0001021_5064_6236 386
446 3300050509 nmdc:mga0qj67_43551_c1 nmdc:mga0qj67_43551_c1_976_2148 386
447 3300050510 nmdc:mga06r32_13458_c1 nmdc:mga06r32_13458_c1_3340_4512 386
448 iso_pu_bacteria 2891633521 2891634591 386
449 iso_pu_bacteria 2904434214 2904438558 386
450 iso_pu_bacteria 639633007 639787044 386
451 3300046536 Ga0495587_0089196 Ga0495587_0089196_156_1331 387
452 3300046542 Ga0495597_0003396 Ga0495597_0003396_2685_3884 387
453 3300046692 Ga0495671_0003414 Ga0495671_0003414_4668_5855 387
454 3300046794 Ga0495589_0002416 Ga0495589_0002416_6230_7429 387
455 3300039062 Ga0400483_089249 Ga0400483_089249_12981_14204 388
456 3300039062 Ga0400483_241723 Ga0400483_241723_326_1549 388
457 3300046506 Ga0495583_0000494 Ga0495583_0000494_47903_49069 388
458 3300046506 Ga0495583_0009281 Ga0495583_0009281_3888_5054 388
459 3300047318 Ga0495636_0046599 Ga0495636_0046599_629_1795 388
460 3300050493 nmdc:mga0k408_85089_c1 nmdc:mga0k408_85089_c1_317_1510 388
461 3300048927 Ga0496124_0030423 Ga0496124_0030423_2496_3665 389
462 3300031507 Ga0307509_10000815 Ga0307509_1000081514 392
463 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001387 395
464 3300025228 Ga0209672_104853 Ga0209672_1048532 395

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02684

LpxB

Lipid-A-disaccharide synthetase

18

272

0.97

PF02684

LpxB

Lipid-A-disaccharide synthetase

302

426

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w8n-assembly1.cif.gz_A-2 lipid a disaccharide synthase (lpxb)-6 solubilizing mutations 0.7681 8 382
5w8s-assembly1.cif.gz_A-2 lipid a disaccharide synthase (lpxb)-7 solubilizing mutations 0.7672 8 382
5w8x-assembly1.cif.gz_A-2 lipid a disaccharide synthase (lpxb)-7 solubilizing mutations-bound to udp 0.7657 8 382
5w8x-assembly1.cif.gz_A-2 lipid a disaccharide synthase (lpxb)-7 solubilizing mutations-bound to udp 0.7575 8 382
5w8s-assembly1.cif.gz_A-2 lipid a disaccharide synthase (lpxb)-7 solubilizing mutations 0.7571 8 382
ID Description Score Start End Superfamily
af_P10441_9_377_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9794 11 378 3.40.50.2000
af_P10441_9_377_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9716 11 378 3.40.50.2000
2iv7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7415 167 365 3.40.50.2000
3c4vA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.731 175 362 3.40.50.2000
af_A0A131MBU2_246_418_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7133 193 363 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2R7S3E9-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9824 178 384 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-Q7N8N4-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9808 8 384 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A6I2IPP4-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9806 8 383 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A7D5V867-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9804 8 389 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-B8AZS0-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9804 47 368 GO:0003723
GO:0004523
GO:0005543
GO:0008915
GO:0009245
GO:0016020

Feature Viewer

pLDDT pTM Quality
90.03 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map