F449362

General Info

Members Datasets Scaffolds Average Seq Length
464 215 431 319

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0000103|Ga0495633_0000103_78607_79680
Length 357
Sequence MTKTGMTDFLILSSQHLYLHANTVMKKNISVKPVSLLACLFFCTVGTTTLSANNSSVDTTIYADSNPIIKHKYTADPAALVYNGKVYLYSGHDEAIPPKEGYVMHEWLCFSSSDMTTWTEHPSPLNVKAFSWAKDDAWASQVIHRNNKFYWYVAVQHNSIPGKAIGVAVSDSPTGPFKDARGSALITNDMTLDTKISWDDIDPTVFIDDNGQAYLYWGNTICYYAKLKENMTELDGPIHTVPLKDFTEAPWIHKHKNWYYLSYASSFPEKIVYAMSRSIEGPWEYKGILNEVAGNSNTNHQAIIDFKGKSYFIYHNGSIPTAGGSYRRSVCIDYLYYNPDGTMKRVVMTTEGVKTVK

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
4 2643221684 Massilia sp. Root133 Isolate Unclassified
5 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
8 2738541297 Duganella sp. GV083 Isolate Unclassified
9 2738541357 Duganella sp. GV053 Isolate Unclassified
10 2738543003 Duganella sp. GV066 Isolate Unclassified
11 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
12 2738543023 Pedobacter sp. OK628 Isolate Unclassified
13 2738543026 Duganella sp. GV089 Isolate Unclassified
14 2738543029 Duganella sp. GV039 Isolate Unclassified
15 2739367656 Pedobacter sp. CF523 Isolate Unclassified
16 2739367663 Pedobacter sp. YR510 Isolate Unclassified
17 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
18 2842711865 Duganella sp. R-73148 Isolate Unclassified
19 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
20 2857553236 Duganella sp. R-74557 Isolate Unclassified
21 2857564685 Duganella sp. R-74599 Isolate Unclassified
22 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
23 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
24 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
25 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
26 2904424332 Duganella sp. 1411 Isolate Rhizosphere
27 2914759650 Rhizosphaericola mali Isolate Rhizosphere
28 2919476304 Duganella sp. 3397 Isolate Unclassified
29 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
30 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
31 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
32 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
33 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
34 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
58 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
109 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
120 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
204 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
207 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
214 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
215 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.89
Metatranscriptomes 0
Isolates 7.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.34
Nodule 0.65
Rhizoplane 2.37
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000123 3300002773 Bacteria 53207
2 JGI25150J39212_1000002 3300002774 Bacteria 537631
3 JGI25150J39212_1004020 3300002774 Bacteria 3338
4 JGI25151J46595_10000003 3300003187 Bacteria 715330
5 JGI25153J46596_10000003 3300003215 Bacteria 553253
6 JGI25153J46596_10044922 3300003215 Bacteria 1323
7 rootH1_10037490 3300003316 Bacteria 4070
8 rootH2_10070538 3300003320 Bacteria 2883
9 rootL2_10053663 3300003322 Bacteria 2134
10 rootH1_10012160 3300003323 Bacteria 5089
11 rootH1_10066160 3300003323 Bacteria 1182
12 rootH1_10372807 3300003323 Bacteria 1709
13 Ga0055525_1000006 3300003759 Bacteria 642912
14 Ga0055529_1000032 3300003763 Bacteria 255895
15 Ga0055526_1000018 3300003771 Bacteria 198838
16 Ga0055526_1000053 3300003771 Bacteria 114820
17 Ga0055524_1000117 3300003775 Bacteria 93643
18 Ga0055524_1010128 3300003775 Bacteria 3776
19 Ga0055531_10007937 3300003794 Bacteria 5691
20 Ga0065165_1001148 3300005262 Bacteria 30990
21 Ga0065714_10129780 3300005288 Bacteria 1261
22 Ga0070658_10194266 3300005327 Bacteria 1711
23 Ga0070658_10303088 3300005327 Bacteria 1362
24 Ga0070660_100021556 3300005339 Bacteria 4754
25 Ga0070660_100022811 3300005339 Bacteria 4635
26 Ga0070659_100000100 3300005366 Bacteria 63786
27 Ga0070659_100048416 3300005366 Bacteria 3339
28 Ga0068855_100046437 3300005563 Bacteria 5134
29 Ga0068855_100456097 3300005563 Bacteria 1394
30 Ga0068856_100039759 3300005614 Bacteria 4618
31 Ga0068852_100064530 3300005616 Bacteria 3192
32 Ga0097621_100011021 3300006237 Bacteria 6643
33 Ga0075370_10035845 3300006353 Bacteria 2786
34 Ga0068871_100061566 3300006358 Bacteria 3066
35 Ga0068865_100129450 3300006881 Bacteria 1889
36 Ga0099824_1042644 3300006942 Unclassified 1036
37 Ga0099823_1004640 3300006944 Bacteria 13498
38 Ga0079104_1012985 3300006946 Bacteria 2589
39 Ga0105244_10000054 3300009036 Bacteria 133715
40 Ga0105244_10002743 3300009036 Bacteria 13142
41 Ga0105244_10020002 3300009036 Bacteria 3722
42 Ga0105244_10032373 3300009036 Bacteria 2768
43 Ga0105243_10097085 3300009148 Bacteria 2439
44 Ga0105241_10045454 3300009174 Bacteria 3332
45 Ga0105242_10053440 3300009176 Bacteria 3298
46 Ga0105242_10093241 3300009176 Bacteria 2538
47 Ga0157319_1000026 3300012497 Bacteria 63349
48 Ga0157373_10002256 3300013100 Bacteria 14605
49 Ga0157371_10000014 3300013102 Bacteria 347490
50 Ga0157371_10182386 3300013102 Unclassified 1501
51 Ga0157370_10013430 3300013104 Bacteria 8436
52 Ga0157370_10014601 3300013104 Bacteria 8026
53 Ga0157369_10001134 3300013105 Bacteria 33314
54 Ga0157369_10206748 3300013105 Bacteria 2059
55 Ga0157378_10015102 3300013297 Bacteria 6760
56 Ga0163162_10396344 3300013306 Bacteria 1513
57 Ga0157372_10000099 3300013307 Bacteria 89946
58 Ga0157372_10082994 3300013307 Bacteria 3629
59 Ga0157372_10097316 3300013307 Bacteria 3356
60 Ga0182008_10015609 3300014497 Bacteria 3959
61 Ga0182006_1000007 3300015261 Bacteria 452190
62 Ga0182006_1000040 3300015261 Bacteria 209209
63 Ga0182006_1000080 3300015261 Bacteria 122163
64 Ga0182007_10000120 3300015262 Bacteria 54341
65 Ga0182005_1000010 3300015265 Bacteria 434103
66 Ga0182005_1000051 3300015265 Bacteria 114808
67 Ga0163161_10003856 3300017792 Bacteria 10514
68 Ga0163161_10009421 3300017792 Bacteria 6757
69 Ga0213872_10033396 3300021361 Bacteria 2357
70 Ga0209563_100022 3300025230 Bacteria 643318
71 Ga0209437_102557 3300025233 Bacteria 3502
72 Ga0207425_1000004 3300025245 Bacteria 1092421
73 Ga0207425_1000326 3300025245 Bacteria 33697
74 Ga0209646_1000051 3300025246 Bacteria 296525
75 Ga0209026_1000762 3300025250 Bacteria 18053
76 Ga0209677_107524 3300025253 Bacteria 2292
77 Ga0209148_1000678 3300025254 Bacteria 28482
78 Ga0209129_1000005 3300025258 Bacteria 777812
79 Ga0209455_1000043 3300025272 Bacteria 413928
80 Ga0209673_1003819 3300025273 Bacteria 8534
81 Ga0209673_1013141 3300025273 Bacteria 3288
82 Ga0209130_1000078 3300025284 Bacteria 169374
83 Ga0209025_1000009 3300025294 Bacteria 1092561
84 Ga0209025_1001273 3300025294 Bacteria 34682
85 Ga0209564_1000011 3300025295 Bacteria 822327
86 Ga0209564_1000068 3300025295 Bacteria 311171
87 Ga0209758_1000010 3300025297 Bacteria 1092782
88 Ga0209758_1000568 3300025297 Bacteria 57997
89 Ga0209256_1000075 3300025299 Bacteria 236149
90 Ga0209256_1000267 3300025299 Bacteria 92278
91 Ga0209256_1037285 3300025299 Bacteria 1268
92 Ga0209051_1004058 3300025303 Bacteria 9230
93 Ga0209257_1000244 3300025304 Bacteria 126098
94 Ga0209257_1003739 3300025304 Bacteria 12616
95 Ga0207655_1000003 3300025728 Bacteria 1081376
96 Ga0207655_1003729 3300025728 Bacteria 11186
97 Ga0207655_1018587 3300025728 Bacteria 3677
98 Ga0207655_1057721 3300025728 Bacteria 1522
99 Ga0207705_10005752 3300025909 Bacteria 9252
100 Ga0207705_10163296 3300025909 Bacteria 1674
101 Ga0207654_10118734 3300025911 Bacteria 1657
102 Ga0207657_10025414 3300025919 Bacteria 5462
103 Ga0207657_10029637 3300025919 Bacteria 4979
104 Ga0207657_10087231 3300025919 Bacteria 2611
105 Ga0207690_10000609 3300025932 Bacteria 23117
106 Ga0207690_10032662 3300025932 Bacteria 3341
107 Ga0207686_10086728 3300025934 Bacteria 2057
108 Ga0207709_10029114 3300025935 Bacteria 3199
109 Ga0207704_10109272 3300025938 Bacteria 1865
110 Ga0207689_10532341 3300025942 Bacteria 986
111 Ga0207667_10283647 3300025949 Bacteria 1692
112 Ga0207667_10413266 3300025949 Bacteria 1373
113 Ga0207648_10213590 3300026089 Bacteria 1713
114 Ga0207648_10368154 3300026089 Bacteria 1298
115 Ga0207698_10110500 3300026142 Bacteria 2303
116 Ga0307515_10000007 3300028794 Bacteria 719669
117 Ga0307515_10017272 3300028794 Bacteria 13154
118 Ga0316177_1157343 3300030731 Bacteria 6045
119 Ga0316182_1168160 3300030745 Bacteria 1617
120 Ga0307408_100001079 3300031548 Bacteria 20870
121 Ga0307414_10004089 3300032004 Bacteria 7870
122 Ga0307510_10006279 3300033180 Bacteria 14175
123 Ga0395899_0000001 3300037312 Bacteria 1750322
124 Ga0395899_0000245 3300037312 Bacteria 72304
125 Ga0395899_0000315 3300037312 Bacteria 61724
126 Ga0395900_0000202 3300037418 Bacteria 93773
127 Ga0395900_0001818 3300037418 Bacteria 24409
128 Ga0395900_0005977 3300037418 Bacteria 12708
129 Ga0395900_0090199 3300037418 Bacteria 3150
130 Ga0395900_0148981 3300037418 Bacteria 2391
131 Ga0395900_0149960 3300037418 Bacteria 2382
132 Ga0395900_0172989 3300037418 Bacteria 2197
133 Ga0395900_0293331 3300037418 Bacteria 1614
134 Ga0395898_0436524 3300037466 Bacteria 1247
135 Ga0395905_0014150 3300037471 Bacteria 7623
136 Ga0395905_0224537 3300037471 Bacteria 1757
137 Ga0395901_0000019 3300038443 Bacteria 317063
138 Ga0395901_0002353 3300038443 Bacteria 19225
139 Ga0395901_0350500 3300038443 Bacteria 1523
140 Ga0395901_0377931 3300038443 Bacteria 1459
141 Ga0395901_0508601 3300038443 Bacteria 1225
142 Ga0436361_0441859 3300039447 Bacteria 17533
143 Ga0439448_0003221 3300042005 Bacteria 4505
144 Ga0439450_022102 3300042008 Bacteria 1371
145 Ga0466969_0009972 3300044656 Bacteria 5037
146 Ga0466972_0000017 3300044658 Bacteria 199884
147 Ga0466965_0008650 3300044683 Bacteria 4710
148 Ga0466965_0054971 3300044683 Bacteria 1980
149 Ga0466965_0167181 3300044683 Bacteria 1155
150 Ga0466966_0026820 3300044684 Bacteria 3759
151 Ga0466966_0030013 3300044684 Bacteria 3534
152 Ga0466961_0006446 3300044693 Bacteria 7453
153 Ga0466961_0117053 3300044693 Bacteria 1674
154 Ga0466963_0012720 3300044694 Bacteria 5155
155 Ga0466964_0001250 3300044706 Bacteria 8632
156 Ga0466968_0000207 3300044735 Bacteria 18092
157 Ga0466957_0001749 3300044842 Bacteria 11419
158 Ga0466957_0073547 3300044842 Bacteria 2118
159 Ga0466959_0051216 3300045049 Bacteria 3029
160 Ga0466959_0162763 3300045049 Bacteria 1568
161 Ga0466959_0269149 3300045049 Bacteria 1171
162 Ga0466967_0147943 3300045976 Bacteria 2192
163 Ga0466967_0358367 3300045976 Bacteria 1413
164 Ga0495617_000003 3300046452 Bacteria 541914
165 Ga0495627_000008 3300046453 Bacteria 572150
166 Ga0495627_000011 3300046453 Bacteria 354522
167 Ga0495627_020416 3300046453 Bacteria 2208
168 Ga0495603_0033801 3300046455 Bacteria 3076
169 Ga0495590_0000001 3300046457 Bacteria 762984
170 Ga0495590_0000512 3300046457 Bacteria 18985
171 Ga0495590_0007095 3300046457 Bacteria 4337
172 Ga0495638_0000017 3300046460 Bacteria 391117
173 Ga0495638_0011980 3300046460 Bacteria 5961
174 Ga0495638_0038606 3300046460 Bacteria 3033
175 Ga0495638_0093266 3300046460 Bacteria 1811
176 Ga0495638_0119826 3300046460 Bacteria 1556
177 Ga0495653_0000002 3300046463 Bacteria 507262
178 Ga0495653_0054284 3300046463 Bacteria 3062
179 Ga0495650_0000001 3300046471 Bacteria 1085492
180 Ga0495650_0000072 3300046471 Bacteria 257886
181 Ga0495650_0000434 3300046471 Bacteria 67282
182 Ga0495650_0001400 3300046471 Bacteria 23592
183 Ga0495650_0005904 3300046471 Bacteria 7782
184 Ga0495650_0012300 3300046471 Bacteria 4611
185 Ga0495650_0014983 3300046471 Bacteria 4001
186 Ga0495605_0000065 3300046474 Bacteria 139441
187 Ga0495605_0000103 3300046474 Bacteria 105879
188 Ga0495605_0010428 3300046474 Bacteria 5198
189 Ga0495605_0014301 3300046474 Bacteria 4349
190 Ga0495605_0027683 3300046474 Bacteria 2935
191 Ga0495605_0053979 3300046474 Bacteria 1948
192 Ga0495584_0000182 3300046491 Bacteria 44393
193 Ga0495584_0000589 3300046491 Bacteria 24441
194 Ga0495584_0006047 3300046491 Bacteria 6375
195 Ga0495584_0007217 3300046491 Bacteria 5798
196 Ga0495584_0057690 3300046491 Bacteria 1953
197 Ga0495584_0102756 3300046491 Bacteria 1445
198 Ga0495585_0000154 3300046492 Bacteria 73681
199 Ga0495585_0001370 3300046492 Bacteria 19288
200 Ga0495585_0017794 3300046492 Bacteria 4102
201 Ga0495585_0037212 3300046492 Bacteria 2741
202 Ga0495585_0038580 3300046492 Bacteria 2688
203 Ga0495585_0039203 3300046492 Bacteria 2663
204 Ga0495585_0066781 3300046492 Bacteria 1968
205 Ga0495585_0111266 3300046492 Bacteria 1456
206 Ga0495585_0156806 3300046492 Bacteria 1183
207 Ga0495596_0005761 3300046500 Bacteria 5810
208 Ga0495596_0007923 3300046500 Bacteria 4755
209 Ga0495607_0001832 3300046501 Bacteria 18116
210 Ga0495607_0002956 3300046501 Bacteria 13357
211 Ga0495607_0008276 3300046501 Bacteria 7116
212 Ga0495607_0018840 3300046501 Bacteria 4391
213 Ga0495607_0020760 3300046501 Bacteria 4144
214 Ga0495607_0087426 3300046501 Bacteria 1696
215 Ga0495607_0129276 3300046501 Bacteria 1316
216 Ga0495583_0000050 3300046506 Bacteria 213627
217 Ga0495583_0000250 3300046506 Bacteria 88815
218 Ga0495583_0002249 3300046506 Bacteria 16985
219 Ga0495583_0033367 3300046506 Bacteria 2476
220 Ga0495606_0000001 3300046507 Bacteria 592123
221 Ga0495606_0000030 3300046507 Bacteria 249484
222 Ga0495606_0007668 3300046507 Bacteria 9570
223 Ga0495606_0028869 3300046507 Bacteria 3905
224 Ga0495610_0000003 3300046512 Bacteria 1203910
225 Ga0495610_0000275 3300046512 Bacteria 53769
226 Ga0495610_0003187 3300046512 Bacteria 13002
227 Ga0495610_0005970 3300046512 Bacteria 8521
228 Ga0495610_0012792 3300046512 Bacteria 5021
229 Ga0495616_0000012 3300046513 Bacteria 211342
230 Ga0495616_0004620 3300046513 Bacteria 8640
231 Ga0495616_0018003 3300046513 Bacteria 3889
232 Ga0495616_0038695 3300046513 Bacteria 2447
233 Ga0495631_0000214 3300046518 Bacteria 39867
234 Ga0495631_0002741 3300046518 Bacteria 9762
235 Ga0495632_0000117 3300046519 Bacteria 81479
236 Ga0495632_0000151 3300046519 Bacteria 71855
237 Ga0495632_0000367 3300046519 Bacteria 42974
238 Ga0495632_0009091 3300046519 Bacteria 6015
239 Ga0495632_0078743 3300046519 Bacteria 1574
240 Ga0495637_0000042 3300046520 Bacteria 114979
241 Ga0495637_0045364 3300046520 Bacteria 1865
242 Ga0495643_0000028 3300046522 Bacteria 262886
243 Ga0495643_0000285 3300046522 Bacteria 72233
244 Ga0495643_0002743 3300046522 Bacteria 13531
245 Ga0495643_0010394 3300046522 Bacteria 5730
246 Ga0495643_0016884 3300046522 Bacteria 4280
247 Ga0495643_0098007 3300046522 Bacteria 1505
248 Ga0495643_0172550 3300046522 Bacteria 1056
249 Ga0495644_0019399 3300046523 Bacteria 2597
250 Ga0495644_0023527 3300046523 Bacteria 2345
251 Ga0495644_0048011 3300046523 Bacteria 1603
252 Ga0495648_0000001 3300046524 Bacteria 696872
253 Ga0495648_0001299 3300046524 Bacteria 24837
254 Ga0495648_0002750 3300046524 Bacteria 15879
255 Ga0495648_0003706 3300046524 Bacteria 13353
256 Ga0495648_0004046 3300046524 Bacteria 12657
257 Ga0495648_0004835 3300046524 Bacteria 11367
258 Ga0495648_0008621 3300046524 Bacteria 7997
259 Ga0495648_0022743 3300046524 Bacteria 4308
260 Ga0495648_0050683 3300046524 Bacteria 2534
261 Ga0495648_0053956 3300046524 Bacteria 2431
262 Ga0495642_0000091 3300046528 Bacteria 53133
263 Ga0495642_0001217 3300046528 Bacteria 11835
264 Ga0495642_0024534 3300046528 Bacteria 2386
265 Ga0495642_0031965 3300046528 Bacteria 2110
266 Ga0495654_0000037 3300046530 Bacteria 188218
267 Ga0495654_0032959 3300046530 Bacteria 2624
268 Ga0495654_0033389 3300046530 Bacteria 2605
269 Ga0495587_0045810 3300046536 Bacteria 2598
270 Ga0495609_0000026 3300046538 Bacteria 251973
271 Ga0495609_0000979 3300046538 Bacteria 20452
272 Ga0495609_0001294 3300046538 Bacteria 17071
273 Ga0495609_0033585 3300046538 Bacteria 2329
274 Ga0495597_0000314 3300046542 Bacteria 43625
275 Ga0495597_0000785 3300046542 Bacteria 25063
276 Ga0495597_0002465 3300046542 Bacteria 11695
277 Ga0495597_0007122 3300046542 Bacteria 5721
278 Ga0495597_0020310 3300046542 Bacteria 3095
279 Ga0495597_0021450 3300046542 Bacteria 3003
280 Ga0495597_0077676 3300046542 Bacteria 1422
281 Ga0495645_0136787 3300046543 Bacteria 1713
282 Ga0495622_0000001 3300046557 Bacteria 365248
283 Ga0495622_0000131 3300046557 Bacteria 64280
284 Ga0495622_0017966 3300046557 Bacteria 3294
285 Ga0495633_0000103 3300046558 Bacteria 114769
286 Ga0495633_0000106 3300046558 Bacteria 113381
287 Ga0495633_0000675 3300046558 Bacteria 31481
288 Ga0495633_0022630 3300046558 Bacteria 3124
289 Ga0495633_0034438 3300046558 Bacteria 2436
290 Ga0495633_0054698 3300046558 Bacteria 1877
291 Ga0495656_0023597 3300046615 Bacteria 2422
292 Ga0495668_0000190 3300046616 Bacteria 91473
293 Ga0495668_0000666 3300046616 Bacteria 41285
294 Ga0495668_0000686 3300046616 Bacteria 40735
295 Ga0495668_0001174 3300046616 Bacteria 26668
296 Ga0495668_0001982 3300046616 Bacteria 17930
297 Ga0495668_0002092 3300046616 Bacteria 17268
298 Ga0495668_0002207 3300046616 Bacteria 16580
299 Ga0495668_0159284 3300046616 Bacteria 1236
300 Ga0495611_0000151 3300046648 Bacteria 49625
301 Ga0495625_0000035 3300046660 Bacteria 224323
302 Ga0495625_0000391 3300046660 Bacteria 66888
303 Ga0495625_0005884 3300046660 Bacteria 11043
304 Ga0495625_0032458 3300046660 Bacteria 3870
305 Ga0495625_0048352 3300046660 Bacteria 3063
306 Ga0495625_0153739 3300046660 Bacteria 1545
307 Ga0495661_0000408 3300046665 Bacteria 45688
308 Ga0495661_0003698 3300046665 Bacteria 11236
309 Ga0495661_0010298 3300046665 Bacteria 6385
310 Ga0495661_0012654 3300046665 Bacteria 5694
311 Ga0495661_0015295 3300046665 Bacteria 5122
312 Ga0495661_0025710 3300046665 Bacteria 3800
313 Ga0495661_0064420 3300046665 Bacteria 2162
314 Ga0495661_0138462 3300046665 Bacteria 1326
315 Ga0495661_0147323 3300046665 Bacteria 1274
316 Ga0495661_0172485 3300046665 Bacteria 1152
317 Ga0495661_0188850 3300046665 Bacteria 1086
318 Ga0495588_0000139 3300046674 Bacteria 109955
319 Ga0495669_0004286 3300046684 Bacteria 5884
320 Ga0495670_0020058 3300046691 Bacteria 3294
321 Ga0495671_0000010 3300046692 Bacteria 368641
322 Ga0495671_0004463 3300046692 Bacteria 8361
323 Ga0495671_0024354 3300046692 Bacteria 3152
324 Ga0495649_0002113 3300046694 Bacteria 14263
325 Ga0495649_0069162 3300046694 Bacteria 1894
326 Ga0495589_0000073 3300046794 Bacteria 94125
327 Ga0495589_0000100 3300046794 Bacteria 83307
328 Ga0495589_0012082 3300046794 Bacteria 4478
329 Ga0495660_0000027 3300046810 Bacteria 254331
330 Ga0495660_0000187 3300046810 Bacteria 66615
331 Ga0495660_0000335 3300046810 Bacteria 41632
332 Ga0495660_0000555 3300046810 Bacteria 30632
333 Ga0495660_0000752 3300046810 Bacteria 24444
334 Ga0495660_0004846 3300046810 Bacteria 8113
335 Ga0495660_0011293 3300046810 Bacteria 5186
336 Ga0495660_0016170 3300046810 Bacteria 4304
337 Ga0495660_0020359 3300046810 Bacteria 3802
338 Ga0495660_0021900 3300046810 Bacteria 3655
339 Ga0495660_0113468 3300046810 Bacteria 1380
340 Ga0495672_0000165 3300047320 Bacteria 96215
341 Ga0495672_0000400 3300047320 Bacteria 52696
342 Ga0495672_0045448 3300047320 Bacteria 2627
343 Ga0495680_0057298 3300047322 Bacteria 3014
344 Ga0495683_0014282 3300047323 Bacteria 4137
345 Ga0495683_0023605 3300047323 Bacteria 3160
346 Ga0495687_000012 3300047443 Bacteria 391586
347 Ga0495687_000037 3300047443 Bacteria 252363
348 Ga0495687_000122 3300047443 Bacteria 119372
349 Ga0495687_001008 3300047443 Bacteria 28121
350 Ga0495687_001859 3300047443 Bacteria 18393
351 Ga0495687_002318 3300047443 Bacteria 15517
352 Ga0495687_049876 3300047443 Bacteria 1787
353 Ga0495675_0048443 3300047444 Bacteria 2703
354 Ga0495677_0000014 3300047445 Bacteria 136236
355 Ga0495677_0002215 3300047445 Bacteria 7702
356 Ga0495677_0011273 3300047445 Bacteria 3272
357 Ga0495679_000603 3300047446 Bacteria 24373
358 Ga0495679_003356 3300047446 Bacteria 7730
359 Ga0495679_017325 3300047446 Bacteria 2582
360 Ga0495685_056855 3300047447 Bacteria 1322
361 Ga0495673_0000003 3300047469 Bacteria 1491337
362 Ga0495673_0000016 3300047469 Bacteria 580643
363 Ga0495673_0000035 3300047469 Bacteria 316861
364 Ga0495681_0000021 3300047470 Bacteria 166534
365 Ga0495681_0003295 3300047470 Bacteria 11254
366 Ga0495681_0003738 3300047470 Bacteria 10540
367 Ga0495681_0007118 3300047470 Bacteria 7210
368 Ga0495681_0054731 3300047470 Bacteria 1863
369 Ga0495686_0032283 3300047472 Bacteria 3390
370 Ga0495686_0213153 3300047472 Bacteria 1102
371 Ga0495626_0000222 3300048091 Bacteria 67304
372 Ga0495626_0003930 3300048091 Bacteria 9298
373 Ga0495626_0015346 3300048091 Bacteria 3925
374 Ga0495626_0023441 3300048091 Bacteria 3039
375 Ga0495626_0028683 3300048091 Bacteria 2696
376 Ga0495626_0030870 3300048091 Bacteria 2582
377 Ga0495626_0039987 3300048091 Bacteria 2216
378 Ga0495626_0066055 3300048091 Bacteria 1636
379 Ga0495626_0079461 3300048091 Bacteria 1459
380 Ga0496100_0321177 3300048903 Bacteria 1163
381 Ga0496103_0003052 3300048906 Bacteria 10295
382 Ga0496103_0072931 3300048906 Bacteria 2151
383 Ga0496105_0353669 3300048908 Bacteria 1173
384 Ga0496106_0007416 3300048909 Bacteria 8106
385 Ga0496107_0177834 3300048910 Bacteria 1580
386 Ga0496107_0185306 3300048910 Bacteria 1546
387 Ga0496109_0278338 3300048912 Bacteria 1577
388 Ga0496110_0000026 3300048913 Bacteria 71385
389 Ga0496113_0007190 3300048916 Bacteria 7135
390 Ga0496116_0026414 3300048919 Bacteria 4248
391 Ga0496117_0000005 3300048920 Bacteria 777468
392 Ga0496118_0000022 3300048921 Bacteria 438602
393 Ga0496119_0159158 3300048922 Bacteria 1203
394 Ga0496121_0011949 3300048924 Bacteria 9553
395 Ga0496121_0017125 3300048924 Bacteria 7425
396 Ga0496121_0083355 3300048924 Bacteria 2524
397 Ga0496122_0001081 3300048925 Bacteria 47312
398 Ga0496122_0016946 3300048925 Bacteria 6846
399 Ga0496122_0021359 3300048925 Bacteria 5798
400 Ga0496122_0042580 3300048925 Bacteria 3570
401 Ga0496123_0001385 3300048926 Bacteria 33978
402 Ga0496123_0003098 3300048926 Bacteria 19096
403 Ga0496123_0004351 3300048926 Bacteria 14974
404 Ga0496123_0041420 3300048926 Bacteria 3193
405 Ga0496124_0029154 3300048927 Bacteria 4923
406 Ga0496124_0038593 3300048927 Bacteria 4146
407 Ga0496124_0054723 3300048927 Bacteria 3376
408 Ga0496124_0112439 3300048927 Bacteria 2190
409 Ga0496124_0138455 3300048927 Bacteria 1924
410 Ga0496125_0070349 3300048928 Bacteria 2740
411 Ga0495678_000002 3300049459 Bacteria 999613
412 Ga0495678_000010 3300049459 Bacteria 357896
413 Ga0495678_000029 3300049459 Bacteria 219803
414 Ga0495678_000045 3300049459 Bacteria 171880
415 Ga0495678_001464 3300049459 Bacteria 18513
416 Ga0495678_008318 3300049459 Bacteria 5246
417 Ga0495682_0000082 3300049460 Bacteria 83453
418 Ga0495682_0002171 3300049460 Bacteria 9502
419 Ga0501249_000002 3300049679 Bacteria 262756
420 Ga0501249_001714 3300049679 Bacteria 4466
421 Ga0501269_000010 3300049766 Bacteria 70454
422 Ga0500644_0000021 3300053088 Bacteria 100777
423 Ga0500651_0026394 3300053093 Unclassified 3651
424 Ga0500641_0000142 3300053096 Bacteria 26342
425 Ga0500562_000033 3300053108 Bacteria 86295
426 Ga0500618_000068 3300053125 Bacteria 88668
427 Ga0500618_035483 3300053125 Bacteria 1158
428 Ga0500658_0000015 3300053134 Bacteria 151134
429 Ga0500586_000133 3300053145 Bacteria 13666
430 Ga0500586_053653 3300053145 Bacteria 1393
431 Ga0500584_017230 3300053726 Bacteria 3336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10037490 rootH1_100374903 277
2 3300013102 Ga0157371_10182386 Ga0157371_101823861 287
3 3300049459 Ga0495678_000010 Ga0495678_000010_114974_115939 289
4 3300044658 Ga0466972_0000017 Ga0466972_0000017_179148_180032 294
5 3300053096 Ga0500641_0000142 Ga0500641_0000142_17715_18617 297
6 3300003775 Ga0055524_1000117 Ga0055524_100011782 299
7 3300003794 Ga0055531_10007937 Ga0055531_100079372 299
8 3300006353 Ga0075370_10035845 Ga0075370_100358452 299
9 3300012497 Ga0157319_1000026 Ga0157319_100002632 299
10 3300025299 Ga0209256_1000075 Ga0209256_1000075118 299
11 3300025304 Ga0209257_1000244 Ga0209257_1000244109 299
12 3300046660 Ga0495625_0000035 Ga0495625_0000035_132139_133101 300
13 3300013297 Ga0157378_10015102 Ga0157378_100151022 301
14 3300025273 Ga0209673_1013141 Ga0209673_10131413 301
15 3300025299 Ga0209256_1037285 Ga0209256_10372852 301
16 3300046453 Ga0495627_000008 Ga0495627_000008_20952_21989 302
17 3300046523 Ga0495644_0023527 Ga0495644_0023527_346_1404 302
18 3300046538 Ga0495609_0001294 Ga0495609_0001294_12709_13767 302
19 3300046810 Ga0495660_0000555 Ga0495660_0000555_14284_15342 302
20 3300046471 Ga0495650_0014983 Ga0495650_0014983_1599_2531 303
21 iso_pu_bacteria 2738541297 2738829899 303
22 iso_pu_bacteria 2738541357 2739153695 303
23 iso_pu_bacteria 2738543003 2739195615 303
24 iso_pu_bacteria 2738543026 2739322091 303
25 iso_pu_bacteria 2738543029 2739340332 303
26 3300044694 Ga0466963_0012720 Ga0466963_0012720_2766_3755 304
27 3300046542 Ga0495597_0000785 Ga0495597_0000785_9145_10110 304
28 iso_pu_bacteria 2739367663 2739644649 304
29 3300002774 JGI25150J39212_1004020 JGI25150J39212_10040203 305
30 3300003215 JGI25153J46596_10044922 JGI25153J46596_100449222 305
31 3300003771 Ga0055526_1000053 Ga0055526_100005361 305
32 3300025295 Ga0209564_1000011 Ga0209564_100001163 305
33 3300038443 Ga0395901_0508601 Ga0395901_0508601_263_1204 305
34 3300046460 Ga0495638_0093266 Ga0495638_0093266_157_1098 305
35 3300046463 Ga0495653_0000002 Ga0495653_0000002_472643_473584 305
36 3300046471 Ga0495650_0005904 Ga0495650_0005904_5994_6935 305
37 3300046501 Ga0495607_0129276 Ga0495607_0129276_191_1132 305
38 3300046507 Ga0495606_0000001 Ga0495606_0000001_311959_312900 305
39 3300046507 Ga0495606_0000030 Ga0495606_0000030_22636_23577 305
40 3300046512 Ga0495610_0003187 Ga0495610_0003187_5284_6225 305
41 3300046520 Ga0495637_0000042 Ga0495637_0000042_32741_33682 305
42 3300046522 Ga0495643_0172550 Ga0495643_0172550_24_965 305
43 3300046524 Ga0495648_0001299 Ga0495648_0001299_9670_10611 305
44 3300046530 Ga0495654_0000037 Ga0495654_0000037_104580_105521 305
45 3300046538 Ga0495609_0000979 Ga0495609_0000979_19422_20369 305
46 3300046558 Ga0495633_0054698 Ga0495633_0054698_99_1040 305
47 3300046616 Ga0495668_0000190 Ga0495668_0000190_73388_74329 305
48 3300046660 Ga0495625_0000391 Ga0495625_0000391_13251_14192 305
49 3300046692 Ga0495671_0000010 Ga0495671_0000010_227678_228619 305
50 3300047469 Ga0495673_0000003 Ga0495673_0000003_937425_938366 305
51 3300047472 Ga0495686_0032283 Ga0495686_0032283_1074_2015 305
52 3300048909 Ga0496106_0007416 Ga0496106_0007416_4829_5770 305
53 3300048922 Ga0496119_0159158 Ga0496119_0159158_99_1040 305
54 3300048924 Ga0496121_0083355 Ga0496121_0083355_442_1383 305
55 iso_pu_bacteria 2643221556 2643801485 305
56 iso_pu_bacteria 2643221684 2644471453 305
57 iso_pu_bacteria 8047673197 8047677211 305
58 3300003323 rootH1_10012160 rootH1_100121605 306
59 3300003775 Ga0055524_1010128 Ga0055524_10101282 306
60 3300006942 Ga0099824_1042644 Ga0099824_10426441 306
61 3300006944 Ga0099823_1004640 Ga0099823_10046403 306
62 3300025273 Ga0209673_1003819 Ga0209673_10038195 306
63 3300025299 Ga0209256_1000267 Ga0209256_100026727 306
64 3300025303 Ga0209051_1004058 Ga0209051_10040586 306
65 3300025304 Ga0209257_1003739 Ga0209257_10037396 306
66 3300030745 Ga0316182_1168160 Ga0316182_11681602 306
67 3300031548 Ga0307408_100001079 Ga0307408_1000010799 306
68 3300046522 Ga0495643_0000285 Ga0495643_0000285_45509_46480 306
69 3300046542 Ga0495597_0002465 Ga0495597_0002465_6677_7648 306
70 iso_pu_bacteria 2857564685 2857566922 306
71 3300046452 Ga0495617_000003 Ga0495617_000003_283938_284891 307
72 3300046460 Ga0495638_0119826 Ga0495638_0119826_386_1339 307
73 3300046471 Ga0495650_0000434 Ga0495650_0000434_10534_11487 307
74 3300046492 Ga0495585_0001370 Ga0495585_0001370_12236_13189 307
75 3300046512 Ga0495610_0000003 Ga0495610_0000003_973454_974407 307
76 3300046524 Ga0495648_0003706 Ga0495648_0003706_4751_5704 307
77 3300046530 Ga0495654_0033389 Ga0495654_0033389_832_1785 307
78 3300046558 Ga0495633_0034438 Ga0495633_0034438_1043_1996 307
79 3300046616 Ga0495668_0002092 Ga0495668_0002092_950_1903 307
80 3300046660 Ga0495625_0153739 Ga0495625_0153739_163_1116 307
81 3300046665 Ga0495661_0010298 Ga0495661_0010298_1562_2515 307
82 3300046810 Ga0495660_0020359 Ga0495660_0020359_198_1151 307
83 3300047446 Ga0495679_017325 Ga0495679_017325_993_1946 307
84 3300047469 Ga0495673_0000016 Ga0495673_0000016_223938_224891 307
85 3300053145 Ga0500586_053653 Ga0500586_053653_129_1082 307
86 iso_pu_bacteria 2643221600 2644012070 307
87 iso_pu_bacteria 2738541279 2738733850 307
88 iso_pu_bacteria 2738541285 2738766193 307
89 iso_pu_bacteria 2738543007 2739215431 307
90 iso_pu_bacteria 2857553236 2857557819 307
91 iso_pu_bacteria 2881359912 2881361500 307
92 3300003323 rootH1_10066160 rootH1_100661601 308
93 3300005614 Ga0068856_100039759 Ga0068856_1000397594 308
94 3300013102 Ga0157371_10000014 Ga0157371_10000014246 308
95 3300013307 Ga0157372_10082994 Ga0157372_100829941 308
96 3300015261 Ga0182006_1000080 Ga0182006_100008089 308
97 3300021361 Ga0213872_10033396 Ga0213872_100333962 308
98 3300037471 Ga0395905_0014150 Ga0395905_0014150_1435_2391 308
99 3300039447 Ga0436361_0441859 Ga0436361_0441859_13457_14413 308
100 3300046457 Ga0495590_0000001 Ga0495590_0000001_181286_182257 308
101 3300046460 Ga0495638_0000017 Ga0495638_0000017_183289_184248 308
102 3300046463 Ga0495653_0054284 Ga0495653_0054284_831_1778 308
103 3300046471 Ga0495650_0001400 Ga0495650_0001400_5797_6756 308
104 3300046506 Ga0495583_0000050 Ga0495583_0000050_87382_88341 308
105 3300046524 Ga0495648_0000001 Ga0495648_0000001_670583_671542 308
106 3300046536 Ga0495587_0045810 Ga0495587_0045810_1618_2565 308
107 3300046557 Ga0495622_0000131 Ga0495622_0000131_25662_26621 308
108 3300046558 Ga0495633_0000106 Ga0495633_0000106_30968_31927 308
109 3300046616 Ga0495668_0000686 Ga0495668_0000686_26101_27072 308
110 3300046810 Ga0495660_0004846 Ga0495660_0004846_6952_7914 308
111 3300047322 Ga0495680_0057298 Ga0495680_0057298_1072_2019 308
112 3300047444 Ga0495675_0048443 Ga0495675_0048443_534_1481 308
113 3300049459 Ga0495678_001464 Ga0495678_001464_8670_9629 308
114 3300003322 rootL2_10053663 rootL2_100536632 309
115 3300003759 Ga0055525_1000006 Ga0055525_1000006552 309
116 3300003771 Ga0055526_1000018 Ga0055526_1000018150 309
117 3300005327 Ga0070658_10194266 Ga0070658_101942662 309
118 3300005327 Ga0070658_10303088 Ga0070658_103030882 309
119 3300005339 Ga0070660_100022811 Ga0070660_1000228113 309
120 3300005366 Ga0070659_100048416 Ga0070659_1000484162 309
121 3300005563 Ga0068855_100046437 Ga0068855_1000464374 309
122 3300005563 Ga0068855_100456097 Ga0068855_1004560972 309
123 3300005616 Ga0068852_100064530 Ga0068852_1000645303 309
124 3300006881 Ga0068865_100129450 Ga0068865_1001294502 309
125 3300009148 Ga0105243_10097085 Ga0105243_100970852 309
126 3300009174 Ga0105241_10045454 Ga0105241_100454542 309
127 3300009176 Ga0105242_10053440 Ga0105242_100534402 309
128 3300009176 Ga0105242_10093241 Ga0105242_100932411 309
129 3300013105 Ga0157369_10206748 Ga0157369_102067482 309
130 3300015261 Ga0182006_1000040 Ga0182006_100004013 309
131 3300015265 Ga0182005_1000051 Ga0182005_100005123 309
132 3300025230 Ga0209563_100022 Ga0209563_100022550 309
133 3300025233 Ga0209437_102557 Ga0209437_1025574 309
134 3300025246 Ga0209646_1000051 Ga0209646_100005128 309
135 3300025253 Ga0209677_107524 Ga0209677_1075242 309
136 3300025254 Ga0209148_1000678 Ga0209148_100067822 309
137 3300025295 Ga0209564_1000068 Ga0209564_1000068256 309
138 3300025909 Ga0207705_10005752 Ga0207705_100057523 309
139 3300025909 Ga0207705_10163296 Ga0207705_101632962 309
140 3300025911 Ga0207654_10118734 Ga0207654_101187342 309
141 3300025919 Ga0207657_10025414 Ga0207657_100254142 309
142 3300025919 Ga0207657_10087231 Ga0207657_100872312 309
143 3300025932 Ga0207690_10032662 Ga0207690_100326622 309
144 3300025934 Ga0207686_10086728 Ga0207686_100867282 309
145 3300025935 Ga0207709_10029114 Ga0207709_100291143 309
146 3300025938 Ga0207704_10109272 Ga0207704_101092722 309
147 3300025942 Ga0207689_10532341 Ga0207689_105323411 309
148 3300025949 Ga0207667_10283647 Ga0207667_102836472 309
149 3300025949 Ga0207667_10413266 Ga0207667_104132662 309
150 3300026089 Ga0207648_10368154 Ga0207648_103681542 309
151 3300026142 Ga0207698_10110500 Ga0207698_101105002 309
152 3300037312 Ga0395899_0000315 Ga0395899_0000315_53997_54947 309
153 3300037418 Ga0395900_0000202 Ga0395900_0000202_75154_76107 309
154 3300037418 Ga0395900_0001818 Ga0395900_0001818_18787_19770 309
155 3300037418 Ga0395900_0005977 Ga0395900_0005977_273_1226 309
156 3300037418 Ga0395900_0090199 Ga0395900_0090199_761_1714 309
157 3300037418 Ga0395900_0148981 Ga0395900_0148981_794_1744 309
158 3300037418 Ga0395900_0149960 Ga0395900_0149960_368_1318 309
159 3300037418 Ga0395900_0172989 Ga0395900_0172989_1149_2099 309
160 3300037418 Ga0395900_0293331 Ga0395900_0293331_149_1102 309
161 3300037466 Ga0395898_0436524 Ga0395898_0436524_92_1045 309
162 3300037471 Ga0395905_0224537 Ga0395905_0224537_542_1495 309
163 3300038443 Ga0395901_0000019 Ga0395901_0000019_232396_233349 309
164 3300038443 Ga0395901_0002353 Ga0395901_0002353_17378_18331 309
165 3300038443 Ga0395901_0350500 Ga0395901_0350500_121_1074 309
166 3300042005 Ga0439448_0003221 Ga0439448_0003221_706_1659 309
167 3300042008 Ga0439450_022102 Ga0439450_022102_237_1190 309
168 3300044683 Ga0466965_0008650 Ga0466965_0008650_585_1538 309
169 3300044683 Ga0466965_0054971 Ga0466965_0054971_577_1527 309
170 3300044683 Ga0466965_0167181 Ga0466965_0167181_139_1089 309
171 3300044684 Ga0466966_0026820 Ga0466966_0026820_1440_2390 309
172 3300044684 Ga0466966_0030013 Ga0466966_0030013_874_1824 309
173 3300044693 Ga0466961_0117053 Ga0466961_0117053_370_1320 309
174 3300044706 Ga0466964_0001250 Ga0466964_0001250_7123_8076 309
175 3300044735 Ga0466968_0000207 Ga0466968_0000207_15350_16303 309
176 3300044842 Ga0466957_0001749 Ga0466957_0001749_2336_3403 309
177 3300044842 Ga0466957_0073547 Ga0466957_0073547_284_1237 309
178 3300045049 Ga0466959_0051216 Ga0466959_0051216_1615_2565 309
179 3300045049 Ga0466959_0269149 Ga0466959_0269149_67_1017 309
180 3300045976 Ga0466967_0147943 Ga0466967_0147943_830_1783 309
181 3300045976 Ga0466967_0358367 Ga0466967_0358367_220_1173 309
182 3300046453 Ga0495627_020416 Ga0495627_020416_807_1757 309
183 3300046455 Ga0495603_0033801 Ga0495603_0033801_272_1222 309
184 3300046457 Ga0495590_0000512 Ga0495590_0000512_9709_10659 309
185 3300046457 Ga0495590_0007095 Ga0495590_0007095_3285_4235 309
186 3300046460 Ga0495638_0011980 Ga0495638_0011980_4387_5337 309
187 3300046471 Ga0495650_0000001 Ga0495650_0000001_496194_497144 309
188 3300046471 Ga0495650_0012300 Ga0495650_0012300_3645_4595 309
189 3300046474 Ga0495605_0000065 Ga0495605_0000065_55061_56014 309
190 3300046474 Ga0495605_0010428 Ga0495605_0010428_3151_4101 309
191 3300046474 Ga0495605_0014301 Ga0495605_0014301_429_1379 309
192 3300046474 Ga0495605_0027683 Ga0495605_0027683_1131_2081 309
193 3300046474 Ga0495605_0053979 Ga0495605_0053979_442_1392 309
194 3300046491 Ga0495584_0000182 Ga0495584_0000182_11029_11979 309
195 3300046491 Ga0495584_0000589 Ga0495584_0000589_18463_19416 309
196 3300046491 Ga0495584_0006047 Ga0495584_0006047_1538_2488 309
197 3300046491 Ga0495584_0057690 Ga0495584_0057690_308_1258 309
198 3300046492 Ga0495585_0000154 Ga0495585_0000154_42545_43495 309
199 3300046492 Ga0495585_0017794 Ga0495585_0017794_1521_2471 309
200 3300046492 Ga0495585_0037212 Ga0495585_0037212_1533_2483 309
201 3300046492 Ga0495585_0038580 Ga0495585_0038580_996_1946 309
202 3300046492 Ga0495585_0039203 Ga0495585_0039203_1466_2416 309
203 3300046492 Ga0495585_0066781 Ga0495585_0066781_80_1030 309
204 3300046492 Ga0495585_0111266 Ga0495585_0111266_383_1333 309
205 3300046492 Ga0495585_0156806 Ga0495585_0156806_21_971 309
206 3300046500 Ga0495596_0007923 Ga0495596_0007923_1401_2351 309
207 3300046501 Ga0495607_0001832 Ga0495607_0001832_15179_16132 309
208 3300046501 Ga0495607_0002956 Ga0495607_0002956_12273_13226 309
209 3300046501 Ga0495607_0008276 Ga0495607_0008276_4167_5144 309
210 3300046501 Ga0495607_0018840 Ga0495607_0018840_1592_2542 309
211 3300046501 Ga0495607_0020760 Ga0495607_0020760_983_1933 309
212 3300046501 Ga0495607_0087426 Ga0495607_0087426_451_1401 309
213 3300046506 Ga0495583_0002249 Ga0495583_0002249_2026_2976 309
214 3300046506 Ga0495583_0033367 Ga0495583_0033367_177_1127 309
215 3300046507 Ga0495606_0028869 Ga0495606_0028869_2873_3823 309
216 3300046513 Ga0495616_0000012 Ga0495616_0000012_51664_52614 309
217 3300046513 Ga0495616_0004620 Ga0495616_0004620_6954_7907 309
218 3300046513 Ga0495616_0018003 Ga0495616_0018003_1753_2730 309
219 3300046513 Ga0495616_0038695 Ga0495616_0038695_296_1246 309
220 3300046518 Ga0495631_0000214 Ga0495631_0000214_15862_16812 309
221 3300046518 Ga0495631_0002741 Ga0495631_0002741_8221_9171 309
222 3300046519 Ga0495632_0000117 Ga0495632_0000117_19302_20252 309
223 3300046519 Ga0495632_0000367 Ga0495632_0000367_19402_20352 309
224 3300046519 Ga0495632_0009091 Ga0495632_0009091_4549_5499 309
225 3300046519 Ga0495632_0078743 Ga0495632_0078743_428_1378 309
226 3300046520 Ga0495637_0045364 Ga0495637_0045364_233_1183 309
227 3300046522 Ga0495643_0016884 Ga0495643_0016884_974_1927 309
228 3300046522 Ga0495643_0098007 Ga0495643_0098007_190_1167 309
229 3300046523 Ga0495644_0048011 Ga0495644_0048011_271_1221 309
230 3300046524 Ga0495648_0002750 Ga0495648_0002750_410_1360 309
231 3300046524 Ga0495648_0004046 Ga0495648_0004046_1794_2747 309
232 3300046524 Ga0495648_0008621 Ga0495648_0008621_1599_2549 309
233 3300046524 Ga0495648_0022743 Ga0495648_0022743_232_1182 309
234 3300046524 Ga0495648_0050683 Ga0495648_0050683_410_1360 309
235 3300046528 Ga0495642_0000091 Ga0495642_0000091_48215_49165 309
236 3300046528 Ga0495642_0001217 Ga0495642_0001217_4629_5582 309
237 3300046528 Ga0495642_0024534 Ga0495642_0024534_269_1246 309
238 3300046528 Ga0495642_0031965 Ga0495642_0031965_336_1286 309
239 3300046530 Ga0495654_0032959 Ga0495654_0032959_1022_1972 309
240 3300046538 Ga0495609_0000026 Ga0495609_0000026_94804_95781 309
241 3300046538 Ga0495609_0033585 Ga0495609_0033585_571_1521 309
242 3300046542 Ga0495597_0000314 Ga0495597_0000314_4023_4973 309
243 3300046542 Ga0495597_0007122 Ga0495597_0007122_4619_5569 309
244 3300046542 Ga0495597_0020310 Ga0495597_0020310_895_1845 309
245 3300046542 Ga0495597_0021450 Ga0495597_0021450_1374_2324 309
246 3300046542 Ga0495597_0077676 Ga0495597_0077676_341_1291 309
247 3300046543 Ga0495645_0136787 Ga0495645_0136787_112_1062 309
248 3300046616 Ga0495668_0000666 Ga0495668_0000666_16970_17920 309
249 3300046616 Ga0495668_0001174 Ga0495668_0001174_23302_24252 309
250 3300046616 Ga0495668_0001982 Ga0495668_0001982_6103_7053 309
251 3300046648 Ga0495611_0000151 Ga0495611_0000151_34482_35432 309
252 3300046660 Ga0495625_0048352 Ga0495625_0048352_883_1833 309
253 3300046665 Ga0495661_0000408 Ga0495661_0000408_1175_2152 309
254 3300046665 Ga0495661_0003698 Ga0495661_0003698_9858_10808 309
255 3300046665 Ga0495661_0012654 Ga0495661_0012654_3768_4721 309
256 3300046665 Ga0495661_0015295 Ga0495661_0015295_1780_2730 309
257 3300046665 Ga0495661_0025710 Ga0495661_0025710_2744_3694 309
258 3300046665 Ga0495661_0064420 Ga0495661_0064420_416_1366 309
259 3300046665 Ga0495661_0138462 Ga0495661_0138462_121_1071 309
260 3300046665 Ga0495661_0147323 Ga0495661_0147323_211_1161 309
261 3300046665 Ga0495661_0188850 Ga0495661_0188850_35_985 309
262 3300046674 Ga0495588_0000139 Ga0495588_0000139_16254_17207 309
263 3300046684 Ga0495669_0004286 Ga0495669_0004286_3521_4471 309
264 3300046691 Ga0495670_0020058 Ga0495670_0020058_1191_2141 309
265 3300046692 Ga0495671_0024354 Ga0495671_0024354_96_1046 309
266 3300046794 Ga0495589_0000073 Ga0495589_0000073_80525_81502 309
267 3300046794 Ga0495589_0000100 Ga0495589_0000100_81381_82334 309
268 3300046794 Ga0495589_0012082 Ga0495589_0012082_975_1925 309
269 3300046810 Ga0495660_0000027 Ga0495660_0000027_209289_210242 309
270 3300046810 Ga0495660_0021900 Ga0495660_0021900_2390_3340 309
271 3300046810 Ga0495660_0113468 Ga0495660_0113468_236_1237 309
272 3300047320 Ga0495672_0045448 Ga0495672_0045448_356_1306 309
273 3300047323 Ga0495683_0014282 Ga0495683_0014282_2380_3333 309
274 3300047323 Ga0495683_0023605 Ga0495683_0023605_1571_2521 309
275 3300047443 Ga0495687_000012 Ga0495687_000012_213575_214525 309
276 3300047443 Ga0495687_000037 Ga0495687_000037_94804_95781 309
277 3300047443 Ga0495687_000122 Ga0495687_000122_17495_18448 309
278 3300047443 Ga0495687_002318 Ga0495687_002318_14424_15377 309
279 3300047443 Ga0495687_049876 Ga0495687_049876_83_1033 309
280 3300047445 Ga0495677_0000014 Ga0495677_0000014_40456_41433 309
281 3300047445 Ga0495677_0002215 Ga0495677_0002215_4969_5919 309
282 3300047445 Ga0495677_0011273 Ga0495677_0011273_2055_3008 309
283 3300047446 Ga0495679_000603 Ga0495679_000603_4385_5335 309
284 3300047446 Ga0495679_003356 Ga0495679_003356_1367_2317 309
285 3300047447 Ga0495685_056855 Ga0495685_056855_267_1217 309
286 3300047469 Ga0495673_0000035 Ga0495673_0000035_172387_173340 309
287 3300047470 Ga0495681_0000021 Ga0495681_0000021_133416_134366 309
288 3300047470 Ga0495681_0003295 Ga0495681_0003295_9846_10796 309
289 3300047470 Ga0495681_0007118 Ga0495681_0007118_202_1152 309
290 3300047470 Ga0495681_0054731 Ga0495681_0054731_532_1482 309
291 3300047472 Ga0495686_0213153 Ga0495686_0213153_25_975 309
292 3300048091 Ga0495626_0000222 Ga0495626_0000222_53926_54879 309
293 3300048091 Ga0495626_0003930 Ga0495626_0003930_899_1876 309
294 3300048091 Ga0495626_0015346 Ga0495626_0015346_2713_3663 309
295 3300048091 Ga0495626_0023441 Ga0495626_0023441_448_1398 309
296 3300048091 Ga0495626_0028683 Ga0495626_0028683_312_1262 309
297 3300048091 Ga0495626_0030870 Ga0495626_0030870_764_1714 309
298 3300048091 Ga0495626_0039987 Ga0495626_0039987_843_1793 309
299 3300048091 Ga0495626_0066055 Ga0495626_0066055_645_1595 309
300 3300048091 Ga0495626_0079461 Ga0495626_0079461_42_992 309
301 3300048903 Ga0496100_0321177 Ga0496100_0321177_134_1087 309
302 3300048906 Ga0496103_0072931 Ga0496103_0072931_583_1533 309
303 3300048908 Ga0496105_0353669 Ga0496105_0353669_21_974 309
304 3300048910 Ga0496107_0185306 Ga0496107_0185306_203_1153 309
305 3300048912 Ga0496109_0278338 Ga0496109_0278338_21_971 309
306 3300048913 Ga0496110_0000026 Ga0496110_0000026_54592_55542 309
307 3300048916 Ga0496113_0007190 Ga0496113_0007190_5930_6880 309
308 3300048925 Ga0496122_0001081 Ga0496122_0001081_38850_39800 309
309 3300048925 Ga0496122_0016946 Ga0496122_0016946_4516_5469 309
310 3300048925 Ga0496122_0042580 Ga0496122_0042580_464_1417 309
311 3300048926 Ga0496123_0003098 Ga0496123_0003098_12770_13723 309
312 3300048926 Ga0496123_0004351 Ga0496123_0004351_12885_13838 309
313 3300048926 Ga0496123_0041420 Ga0496123_0041420_21_971 309
314 3300048927 Ga0496124_0029154 Ga0496124_0029154_1697_2647 309
315 3300048927 Ga0496124_0054723 Ga0496124_0054723_823_1776 309
316 3300048927 Ga0496124_0112439 Ga0496124_0112439_404_1354 309
317 3300048927 Ga0496124_0138455 Ga0496124_0138455_216_1169 309
318 3300048928 Ga0496125_0070349 Ga0496125_0070349_1206_2156 309
319 3300049459 Ga0495678_000045 Ga0495678_000045_99432_100382 309
320 3300049459 Ga0495678_008318 Ga0495678_008318_3973_4923 309
321 3300049460 Ga0495682_0000082 Ga0495682_0000082_18538_19488 309
322 3300049679 Ga0501249_000002 Ga0501249_000002_91452_92426 309
323 3300003320 rootH2_10070538 rootH2_100705382 310
324 3300009036 Ga0105244_10000054 Ga0105244_1000005424 310
325 3300009036 Ga0105244_10020002 Ga0105244_100200022 310
326 3300025245 Ga0207425_1000326 Ga0207425_100032619 310
327 3300025294 Ga0209025_1001273 Ga0209025_100127318 310
328 3300025297 Ga0209758_1000568 Ga0209758_100056856 310
329 3300025728 Ga0207655_1000003 Ga0207655_1000003316 310
330 3300025728 Ga0207655_1018587 Ga0207655_10185876 310
331 3300030731 Ga0316177_1157343 Ga0316177_11573435 310
332 3300046460 Ga0495638_0038606 Ga0495638_0038606_880_1848 310
333 3300046471 Ga0495650_0000072 Ga0495650_0000072_164740_165696 310
334 3300046474 Ga0495605_0000103 Ga0495605_0000103_4183_5139 310
335 3300046491 Ga0495584_0007217 Ga0495584_0007217_4202_5155 310
336 3300046491 Ga0495584_0102756 Ga0495584_0102756_206_1168 310
337 3300046500 Ga0495596_0005761 Ga0495596_0005761_3663_4625 310
338 3300046506 Ga0495583_0000250 Ga0495583_0000250_17894_18856 310
339 3300046507 Ga0495606_0007668 Ga0495606_0007668_7234_8202 310
340 3300046512 Ga0495610_0012792 Ga0495610_0012792_463_1431 310
341 3300046519 Ga0495632_0000151 Ga0495632_0000151_57210_58172 310
342 3300046524 Ga0495648_0053956 Ga0495648_0053956_429_1397 310
343 3300046558 Ga0495633_0022630 Ga0495633_0022630_291_1277 310
344 3300046615 Ga0495656_0023597 Ga0495656_0023597_565_1527 310
345 3300046616 Ga0495668_0002207 Ga0495668_0002207_3851_4807 310
346 3300046616 Ga0495668_0159284 Ga0495668_0159284_114_1076 310
347 3300046660 Ga0495625_0005884 Ga0495625_0005884_43_1044 310
348 3300046665 Ga0495661_0172485 Ga0495661_0172485_99_1052 310
349 3300046692 Ga0495671_0004463 Ga0495671_0004463_4302_5264 310
350 3300046694 Ga0495649_0069162 Ga0495649_0069162_446_1414 310
351 3300046810 Ga0495660_0011293 Ga0495660_0011293_95_1057 310
352 3300047443 Ga0495687_001859 Ga0495687_001859_16393_17355 310
353 3300048910 Ga0496107_0177834 Ga0496107_0177834_354_1310 310
354 3300048927 Ga0496124_0038593 Ga0496124_0038593_2048_3004 310
355 3300053125 Ga0500618_000068 Ga0500618_000068_68312_69268 310
356 3300053145 Ga0500586_000133 Ga0500586_000133_3763_4749 310
357 iso_pu_bacteria 2600255292 2601671300 310
358 iso_pu_bacteria 2842711865 2842715533 310
359 iso_pu_bacteria 2857547612 2857548860 310
360 iso_pu_bacteria 2886848708 2886851939 310
361 iso_pu_bacteria 2932410948 2932415443 310
362 iso_pu_bacteria 2932416698 2932421396 310
363 3300003763 Ga0055529_1000032 Ga0055529_1000032216 311
364 3300025272 Ga0209455_1000043 Ga0209455_1000043308 311
365 3300046453 Ga0495627_000011 Ga0495627_000011_97954_98919 311
366 3300046522 Ga0495643_0010394 Ga0495643_0010394_4275_5240 311
367 3300046523 Ga0495644_0019399 Ga0495644_0019399_733_1698 311
368 3300046557 Ga0495622_0000001 Ga0495622_0000001_180923_181903 311
369 3300046660 Ga0495625_0032458 Ga0495625_0032458_2234_3193 311
370 3300046810 Ga0495660_0000187 Ga0495660_0000187_42455_43420 311
371 3300046810 Ga0495660_0000752 Ga0495660_0000752_3528_4502 311
372 3300047470 Ga0495681_0003738 Ga0495681_0003738_8340_9305 311
373 3300053125 Ga0500618_035483 Ga0500618_035483_56_1027 311
374 3300053726 Ga0500584_017230 Ga0500584_017230_198_1148 311
375 iso_pu_bacteria 2857618242 2857621450 311
376 iso_pu_bacteria 2885080285 2885080341 311
377 iso_pu_bacteria 2919476304 2919478244 311
378 iso_pu_bacteria 2958512119 2958512636 311
379 3300005262 Ga0065165_1001148 Ga0065165_100114823 312
380 3300025284 Ga0209130_1000078 Ga0209130_1000078141 312
381 3300025728 Ga0207655_1003729 Ga0207655_10037299 312
382 3300037312 Ga0395899_0000001 Ga0395899_0000001_432569_433540 312
383 3300046512 Ga0495610_0005970 Ga0495610_0005970_1058_2032 312
384 3300046522 Ga0495643_0000028 Ga0495643_0000028_48762_49736 312
385 3300046522 Ga0495643_0002743 Ga0495643_0002743_4291_5253 312
386 3300046524 Ga0495648_0004835 Ga0495648_0004835_9223_10197 312
387 3300046694 Ga0495649_0002113 Ga0495649_0002113_2101_3075 312
388 3300047320 Ga0495672_0000400 Ga0495672_0000400_1288_2262 312
389 3300048906 Ga0496103_0003052 Ga0496103_0003052_4278_5240 312
390 3300049459 Ga0495678_000029 Ga0495678_000029_187245_188219 312
391 3300049679 Ga0501249_001714 Ga0501249_001714_2573_3535 312
392 3300049766 Ga0501269_000010 Ga0501269_000010_5463_6425 312
393 iso_pu_bacteria 2833640130 2833641822 312
394 iso_pu_bacteria 2904424332 2904425705 312
395 3300006946 Ga0079104_1012985 Ga0079104_10129853 313
396 3300009036 Ga0105244_10002743 Ga0105244_100027434 313
397 3300046810 Ga0495660_0000335 Ga0495660_0000335_1067_2104 313
398 3300046810 Ga0495660_0016170 Ga0495660_0016170_1420_2481 313
399 3300047320 Ga0495672_0000165 Ga0495672_0000165_66924_67985 313
400 3300049459 Ga0495678_000002 Ga0495678_000002_941728_942717 313
401 3300053108 Ga0500562_000033 Ga0500562_000033_22322_23281 313
402 iso_pu_bacteria 2738541283 2738759337 313
403 iso_pu_bacteria 2857553236 2857555910 313
404 3300003323 rootH1_10372807 rootH1_103728072 314
405 3300005288 Ga0065714_10129780 Ga0065714_101297802 314
406 3300013306 Ga0163162_10396344 Ga0163162_103963442 314
407 3300014497 Ga0182008_10015609 Ga0182008_100156092 314
408 3300015261 Ga0182006_1000007 Ga0182006_1000007147 314
409 3300015262 Ga0182007_10000120 Ga0182007_1000012052 314
410 3300015265 Ga0182005_1000010 Ga0182005_1000010126 314
411 3300017792 Ga0163161_10009421 Ga0163161_100094216 314
412 3300046558 Ga0495633_0000675 Ga0495633_0000675_6241_7215 314
413 3300048919 Ga0496116_0026414 Ga0496116_0026414_478_1452 314
414 3300048920 Ga0496117_0000005 Ga0496117_0000005_297788_298762 314
415 3300048921 Ga0496118_0000022 Ga0496118_0000022_139841_140815 314
416 3300048924 Ga0496121_0011949 Ga0496121_0011949_4668_5642 314
417 3300048924 Ga0496121_0017125 Ga0496121_0017125_5943_6923 314
418 3300048925 Ga0496122_0021359 Ga0496122_0021359_3725_4699 314
419 3300048926 Ga0496123_0001385 Ga0496123_0001385_3857_4831 314
420 3300049460 Ga0495682_0002171 Ga0495682_0002171_4601_5575 314
421 3300009036 Ga0105244_10032373 Ga0105244_100323732 315
422 3300025728 Ga0207655_1057721 Ga0207655_10577211 315
423 3300046557 Ga0495622_0017966 Ga0495622_0017966_1905_2882 315
424 3300053134 Ga0500658_0000015 Ga0500658_0000015_43275_44243 315
425 iso_pu_bacteria 2914759650 2914761378 315
426 3300053088 Ga0500644_0000021 Ga0500644_0000021_37034_37987 316
427 3300006237 Ga0097621_100011021 Ga0097621_1000110215 317
428 3300006358 Ga0068871_100061566 Ga0068871_1000615662 317
429 3300025250 Ga0209026_1000762 Ga0209026_100076210 317
430 3300013100 Ga0157373_10002256 Ga0157373_100022565 318
431 3300017792 Ga0163161_10003856 Ga0163161_100038564 318
432 3300026089 Ga0207648_10213590 Ga0207648_102135901 318
433 3300028794 Ga0307515_10000007 Ga0307515_10000007419 318
434 3300033180 Ga0307510_10006279 Ga0307510_100062796 318
435 3300032004 Ga0307414_10004089 Ga0307414_100040895 319
436 3300013105 Ga0157369_10001134 Ga0157369_100011344 320
437 3300013307 Ga0157372_10000099 Ga0157372_1000009981 320
438 3300037312 Ga0395899_0000245 Ga0395899_0000245_4780_5766 320
439 3300038443 Ga0395901_0377931 Ga0395901_0377931_219_1205 320
440 3300044656 Ga0466969_0009972 Ga0466969_0009972_2518_3504 320
441 3300044693 Ga0466961_0006446 Ga0466961_0006446_5911_6897 320
442 3300045049 Ga0466959_0162763 Ga0466959_0162763_397_1383 320
443 iso_pu_bacteria 2739367656 2739617141 320
444 3300005339 Ga0070660_100021556 Ga0070660_1000215563 321
445 3300005366 Ga0070659_100000100 Ga0070659_10000010039 321
446 3300013307 Ga0157372_10097316 Ga0157372_100973162 321
447 3300025919 Ga0207657_10029637 Ga0207657_100296373 321
448 3300025932 Ga0207690_10000609 Ga0207690_1000060925 321
449 3300046512 Ga0495610_0000275 Ga0495610_0000275_30815_31780 321
450 3300047443 Ga0495687_001008 Ga0495687_001008_16953_17942 321
451 iso_pu_bacteria 2738543023 2739303194 321
452 3300002773 JGI25152J39213_1000123 JGI25152J39213_100012328 322
453 3300002774 JGI25150J39212_1000002 JGI25150J39212_1000002264 322
454 3300003187 JGI25151J46595_10000003 JGI25151J46595_10000003394 322
455 3300003215 JGI25153J46596_10000003 JGI25153J46596_10000003226 322
456 3300013104 Ga0157370_10013430 Ga0157370_100134304 322
457 3300013104 Ga0157370_10014601 Ga0157370_100146013 322
458 3300025245 Ga0207425_1000004 Ga0207425_1000004681 322
459 3300025258 Ga0209129_1000005 Ga0209129_1000005261 322
460 3300025294 Ga0209025_1000009 Ga0209025_1000009681 322
461 3300025297 Ga0209758_1000010 Ga0209758_1000010682 322
462 3300028794 Ga0307515_10017272 Ga0307515_100172722 322
463 3300046558 Ga0495633_0000103 Ga0495633_0000103_78607_79680 322
464 3300053093 Ga0500651_0026394 Ga0500651_0026394_1608_2681 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

65

343

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qee-assembly2.cif.gz_B the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.9761 30 322
3qef-assembly1.cif.gz_A the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.9737 31 322
3qef-assembly1.cif.gz_A the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.9576 31 322
3qee-assembly2.cif.gz_B the structure and function of an arabinan-specific alpha-1,2-arabinofuranosidase identified from screening the activities of bacterial gh43 glycoside hydrolases 0.9536 30 322
8hcj-assembly2.cif.gz_F structure of gh43 family enzyme, xylan 1, 4 beta- xylosidase from pseudopedobacter saltans 0.9116 31 320
ID Description Score Start End Superfamily
3qefB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9735 30 322 2.115.10.20
3qefB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9574 30 322 2.115.10.20
4novA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8704 23 320 2.115.10.20
4novA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.862 23 320 2.115.10.20
5glmA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8589 24 310 2.115.10.20
ID Description Score Start End GO Terms
AF-S0DDZ8-F1-model_v4 non-reducing end alpha-L-arabinofuranosidase (EC 3.2.1.55) 0.9839 22 318 GO:0046373
GO:0046556
AF-A0A1B9DYK2-F1-model_v4 Glycoside hydrolase 0.9836 31 319 GO:0004553
GO:0045493
AF-A0A4Q5QWV5-F1-model_v4 Glycoside hydrolase 0.9827 31 261 GO:0004553
GO:0045493
AF-A0A7K1SZ81-F1-model_v4 Family 43 glycosylhydrolase 0.9822 23 322 GO:0004553
GO:0045493
AF-A0A4Q5YTP3-F1-model_v4 Glycoside hydrolase 0.9821 54 322 GO:0004553
GO:0045493

Feature Viewer

pLDDT pTM Quality
90.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map