F449294

General Info

Members Datasets Scaffolds Average Seq Length
464 168 928 255

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10055600|Ga0157380_100556004
Length 288
Sequence MTIEAVSKVAPSRPASTPPARVTSAASVAFKASFERGAGAFALPLVGIGAVLLLWSLASATFADSLPSPLKTWEVSRPYVLEPFEKRGELDQGILRFTWYSLQRVAKGYSLAILIGAPLGFLLGMSKLFRGSFDPIIQILRPVSPLAWLPLGLVIFQKPEPAGIFTIAMCSMWPTVLNTALGVRAVPQDYLNVARVLKLSKQKTLLKIMLPAALPYMFTGFRLSLGIAWLVIVAAEMLTGAPGVGGFLWQEYNALIYEHIILCILTIGLVGFGLDRLMGMVEKRLRAA

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
121 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
124 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
127 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
128 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
131 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
166 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
167 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.51
Rhizosphere 95.69
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10055600 3300014326 Bacteria 3144
2 JGI25406J46586_10003476 3300003203 Bacteria 7403
3 rootH2_10295625 3300003320 Bacteria 1001
4 rootH1_10237734 3300003323 Bacteria 2401
5 Ga0065707_10110908 3300005295 Bacteria 2402
6 Ga0065707_10144657 3300005295 Bacteria 1729
7 Ga0070690_100012489 3300005330 Bacteria 4998
8 Ga0070677_10051816 3300005333 Bacteria 1663
9 Ga0070677_10146068 3300005333 Bacteria 1096
10 Ga0070689_100120396 3300005340 Bacteria 2096
11 Ga0070668_100036690 3300005347 Bacteria 3741
12 Ga0070669_100130250 3300005353 Bacteria 1929
13 Ga0070675_100101554 3300005354 Bacteria 2423
14 Ga0070675_100121087 3300005354 Bacteria 2223
15 Ga0070674_100000181 3300005356 Bacteria 29542
16 Ga0070673_100290187 3300005364 Bacteria 1437
17 Ga0070688_100115781 3300005365 Bacteria 1789
18 Ga0070667_100267503 3300005367 Bacteria 1532
19 Ga0070667_100298954 3300005367 Bacteria 1449
20 Ga0070703_10055638 3300005406 Bacteria 1279
21 Ga0070701_10002518 3300005438 Bacteria 7080
22 Ga0070711_100024477 3300005439 Bacteria 3938
23 Ga0070705_100431688 3300005440 Bacteria 984
24 Ga0070700_100156867 3300005441 Bacteria 1563
25 Ga0070700_100268139 3300005441 Unclassified 1232
26 Ga0070694_100115718 3300005444 Bacteria 1917
27 Ga0070708_100007943 3300005445 Bacteria 8496
28 Ga0070708_100008572 3300005445 Bacteria 8216
29 Ga0070708_100012802 3300005445 Bacteria 6853
30 Ga0070708_100015900 3300005445 Bacteria 6227
31 Ga0070708_100028957 3300005445 Bacteria 4771
32 Ga0070708_100100622 3300005445 Bacteria 2646
33 Ga0070708_100303303 3300005445 Bacteria 1504
34 Ga0070678_100024365 3300005456 Bacteria 4051
35 Ga0068867_100099566 3300005459 Bacteria 2218
36 Ga0068867_100735608 3300005459 Unclassified 874
37 Ga0070685_10226760 3300005466 Bacteria 1227
38 Ga0070706_100009250 3300005467 Bacteria 9177
39 Ga0070706_100009519 3300005467 Bacteria 9036
40 Ga0070706_100018374 3300005467 Bacteria 6450
41 Ga0070706_100019283 3300005467 Bacteria 6291
42 Ga0070706_100046328 3300005467 Bacteria 4014
43 Ga0070706_100057479 3300005467 Bacteria 3590
44 Ga0070706_100060892 3300005467 Bacteria 3485
45 Ga0070706_100141232 3300005467 Bacteria 2248
46 Ga0070706_100231013 3300005467 Bacteria 1727
47 Ga0070707_100010735 3300005468 Bacteria 8531
48 Ga0070707_100016135 3300005468 Bacteria 7009
49 Ga0070707_100028457 3300005468 Bacteria 5319
50 Ga0070707_100045895 3300005468 Bacteria 4181
51 Ga0070707_100588782 3300005468 Bacteria 1075
52 Ga0070698_100037407 3300005471 Bacteria 5004
53 Ga0070698_100088935 3300005471 Bacteria 3072
54 Ga0070698_100135912 3300005471 Bacteria 2412
55 Ga0070698_100195818 3300005471 Bacteria 1958
56 Ga0070698_100210138 3300005471 Bacteria 1881
57 Ga0070698_100304343 3300005471 Bacteria 1525
58 Ga0070699_100023641 3300005518 Bacteria 5294
59 Ga0070699_100036957 3300005518 Bacteria 4225
60 Ga0070699_100050357 3300005518 Bacteria 3606
61 Ga0070699_100071215 3300005518 Bacteria 3023
62 Ga0070699_100074424 3300005518 Bacteria 2955
63 Ga0070699_100096313 3300005518 Bacteria 2592
64 Ga0070699_100222087 3300005518 Bacteria 1684
65 Ga0070699_100642663 3300005518 Bacteria 968
66 Ga0070697_100006270 3300005536 Bacteria 9208
67 Ga0070697_100006761 3300005536 Bacteria 8894
68 Ga0070697_100144792 3300005536 Bacteria 2000
69 Ga0070697_100367267 3300005536 Bacteria 1245
70 Ga0070672_100024120 3300005543 Bacteria 4489
71 Ga0070696_100196187 3300005546 Bacteria 1505
72 Ga0068855_100000076 3300005563 Bacteria 118910
73 Ga0068855_100008769 3300005563 Bacteria 12223
74 Ga0068856_100163541 3300005614 Bacteria 2237
75 Ga0070702_100363041 3300005615 Bacteria 1024
76 Ga0068859_100043662 3300005617 Bacteria 4506
77 Ga0068859_100298947 3300005617 Bacteria 1703
78 Ga0068859_100393312 3300005617 Bacteria 1482
79 Ga0068859_100666424 3300005617 Bacteria 1132
80 Ga0068864_100760569 3300005618 Bacteria 950
81 Ga0068861_100118458 3300005719 Bacteria 2133
82 Ga0068851_10003382 3300005834 Bacteria 7099
83 Ga0068870_10119625 3300005840 Bacteria 1515
84 Ga0068870_10137379 3300005840 Bacteria 1427
85 Ga0068863_100032276 3300005841 Bacteria 4991
86 Ga0068863_100142627 3300005841 Bacteria 2290
87 Ga0068863_100299114 3300005841 Bacteria 1561
88 Ga0068863_100326204 3300005841 Bacteria 1492
89 Ga0068863_100484472 3300005841 Bacteria 1217
90 Ga0068858_100093153 3300005842 Bacteria 2805
91 Ga0068860_100048838 3300005843 Bacteria 4032
92 Ga0068860_100104224 3300005843 Bacteria 2708
93 Ga0068860_100386684 3300005843 Bacteria 1382
94 Ga0068862_100061603 3300005844 Bacteria 3225
95 Ga0068862_100411605 3300005844 Bacteria 1267
96 Ga0081455_10002879 3300005937 Bacteria 20250
97 Ga0081455_10004694 3300005937 Bacteria 15203
98 Ga0081455_10013946 3300005937 Bacteria 7899
99 Ga0081455_10084411 3300005937 Bacteria 2592
100 Ga0081455_10231528 3300005937 Bacteria 1363
101 Ga0081538_10000900 3300005981 Bacteria 32171
102 Ga0081538_10009209 3300005981 Bacteria 8272
103 Ga0081539_10000009 3300005985 Bacteria 509286
104 Ga0075432_10045945 3300006058 Bacteria 1533
105 Ga0070715_10125369 3300006163 Bacteria 1229
106 Ga0070715_10255976 3300006163 Bacteria 917
107 Ga0070712_100002314 3300006175 Bacteria 11737
108 Ga0097621_100061379 3300006237 Bacteria 3083
109 Ga0068871_100128284 3300006358 Bacteria 2148
110 Ga0068871_100251605 3300006358 Bacteria 1539
111 Ga0068871_100475519 3300006358 Unclassified 1123
112 Ga0075428_100060403 3300006844 Bacteria 4151
113 Ga0075428_100114678 3300006844 Bacteria 2935
114 Ga0075428_100166413 3300006844 Bacteria 2391
115 Ga0075428_100175777 3300006844 Bacteria 2319
116 Ga0075428_100191398 3300006844 Bacteria 2212
117 Ga0075428_100338936 3300006844 Bacteria 1615
118 Ga0075428_100738268 3300006844 Bacteria 1048
119 Ga0075430_100004180 3300006846 Bacteria 12182
120 Ga0075430_100036518 3300006846 Bacteria 4166
121 Ga0075430_100332844 3300006846 Bacteria 1254
122 Ga0075431_100000189 3300006847 Bacteria 44725
123 Ga0075431_100000450 3300006847 Bacteria 33776
124 Ga0075431_100007185 3300006847 Bacteria 11074
125 Ga0075431_100052999 3300006847 Bacteria 4183
126 Ga0075431_100096206 3300006847 Bacteria 3057
127 Ga0075431_100144756 3300006847 Bacteria 2449
128 Ga0075431_100227271 3300006847 Bacteria 1902
129 Ga0075431_100390822 3300006847 Bacteria 1393
130 Ga0075431_100519112 3300006847 Bacteria 1181
131 Ga0075431_100610974 3300006847 Unclassified 1073
132 Ga0075433_10000090 3300006852 Bacteria 42150
133 Ga0075433_10002841 3300006852 Bacteria 13259
134 Ga0075433_10042209 3300006852 Bacteria 3956
135 Ga0075433_10143779 3300006852 Bacteria 2120
136 Ga0075433_10181622 3300006852 Bacteria 1872
137 Ga0075433_10186700 3300006852 Bacteria 1844
138 Ga0075433_10191237 3300006852 Bacteria 1821
139 Ga0075433_10277552 3300006852 Bacteria 1485
140 Ga0075433_10365327 3300006852 Unclassified 1275
141 Ga0075434_100003450 3300006871 Bacteria 14134
142 Ga0075434_100004866 3300006871 Bacteria 12167
143 Ga0075434_100007740 3300006871 Bacteria 9948
144 Ga0075434_100032079 3300006871 Bacteria 5179
145 Ga0075434_100038571 3300006871 Bacteria 4731
146 Ga0075434_100047984 3300006871 Bacteria 4238
147 Ga0075434_100056974 3300006871 Bacteria 3883
148 Ga0075434_100073844 3300006871 Bacteria 3404
149 Ga0075434_100195652 3300006871 Bacteria 2042
150 Ga0075434_100277159 3300006871 Bacteria 1696
151 Ga0075434_100284639 3300006871 Bacteria 1673
152 Ga0075434_100293551 3300006871 Bacteria 1646
153 Ga0075429_100002937 3300006880 Bacteria 14455
154 Ga0075429_100005910 3300006880 Bacteria 10566
155 Ga0075429_100013516 3300006880 Bacteria 7083
156 Ga0075429_100017932 3300006880 Bacteria 6121
157 Ga0075429_100041933 3300006880 Bacteria 3984
158 Ga0075429_100054538 3300006880 Bacteria 3477
159 Ga0075429_100082952 3300006880 Bacteria 2794
160 Ga0075429_100135331 3300006880 Bacteria 2157
161 Ga0075429_100181298 3300006880 Bacteria 1845
162 Ga0075429_100275521 3300006880 Bacteria 1473
163 Ga0075429_100389126 3300006880 Bacteria 1221
164 Ga0075429_100680087 3300006880 Bacteria 902
165 Ga0075436_100000168 3300006914 Bacteria 41115
166 Ga0075436_100011370 3300006914 Bacteria 6111
167 Ga0075436_100019181 3300006914 Bacteria 4686
168 Ga0075436_100019829 3300006914 Bacteria 4611
169 Ga0075436_100022872 3300006914 Bacteria 4293
170 Ga0075436_100139728 3300006914 Bacteria 1702
171 Ga0075436_100251904 3300006914 Bacteria 1257
172 Ga0097620_100043663 3300006931 Bacteria 4506
173 Ga0097620_100298901 3300006931 Bacteria 1703
174 Ga0097620_100393292 3300006931 Bacteria 1482
175 Ga0097620_100666512 3300006931 Bacteria 1132
176 Ga0075435_100004843 3300007076 Bacteria 9314
177 Ga0075435_100015673 3300007076 Bacteria 5702
178 Ga0075435_100019301 3300007076 Bacteria 5204
179 Ga0075435_100054272 3300007076 Bacteria 3234
180 Ga0075435_100084014 3300007076 Bacteria 2619
181 Ga0075435_100090367 3300007076 Bacteria 2526
182 Ga0075435_100174084 3300007076 Bacteria 1817
183 Ga0075435_100184995 3300007076 Bacteria 1762
184 Ga0075435_100296799 3300007076 Bacteria 1382
185 Ga0075435_100680378 3300007076 Unclassified 894
186 Ga0099794_10014195 3300007265 Bacteria 3485
187 Ga0099794_10095599 3300007265 Bacteria 1478
188 Ga0099794_10099650 3300007265 Bacteria 1449
189 Ga0111539_10012244 3300009094 Bacteria 10757
190 Ga0111539_10015484 3300009094 Bacteria 9480
191 Ga0111539_10017496 3300009094 Bacteria 8875
192 Ga0111539_10099644 3300009094 Bacteria 3412
193 Ga0111539_10183495 3300009094 Bacteria 2444
194 Ga0111539_10217523 3300009094 Bacteria 2225
195 Ga0111539_10392202 3300009094 Bacteria 1617
196 Ga0105245_10335132 3300009098 Bacteria 1494
197 Ga0114129_10000881 3300009147 Bacteria 39092
198 Ga0114129_10001425 3300009147 Bacteria 32283
199 Ga0114129_10002331 3300009147 Bacteria 26353
200 Ga0114129_10004869 3300009147 Bacteria 18952
201 Ga0114129_10012612 3300009147 Bacteria 12035
202 Ga0114129_10021744 3300009147 Bacteria 9104
203 Ga0114129_10031063 3300009147 Bacteria 7555
204 Ga0114129_10046275 3300009147 Bacteria 6115
205 Ga0114129_10056649 3300009147 Bacteria 5488
206 Ga0114129_10111038 3300009147 Bacteria 3784
207 Ga0114129_10129763 3300009147 Bacteria 3463
208 Ga0114129_10137613 3300009147 Bacteria 3350
209 Ga0114129_10169522 3300009147 Bacteria 2977
210 Ga0114129_10431894 3300009147 Bacteria 1730
211 Ga0114129_10482078 3300009147 Bacteria 1622
212 Ga0114129_10500011 3300009147 Bacteria 1588
213 Ga0114129_10571247 3300009147 Bacteria 1468
214 Ga0114129_10745785 3300009147 Bacteria 1254
215 Ga0114129_10784085 3300009147 Bacteria 1217
216 Ga0114129_11189648 3300009147 Bacteria 950
217 Ga0105243_10165957 3300009148 Bacteria 1908
218 Ga0105243_10272695 3300009148 Bacteria 1520
219 Ga0105242_10264949 3300009176 Bacteria 1554
220 Ga0105238_10003023 3300009551 Bacteria 16786
221 Ga0105249_10117355 3300009553 Bacteria 2524
222 Ga0105249_10186316 3300009553 Bacteria 2022
223 Ga0105249_10264999 3300009553 Bacteria 1709
224 Ga0105249_10358829 3300009553 Bacteria 1478
225 Ga0157378_10001288 3300013297 Bacteria 22567
226 Ga0157378_10230456 3300013297 Bacteria 1765
227 Ga0157378_10325911 3300013297 Bacteria 1493
228 Ga0163162_10060337 3300013306 Bacteria 3828
229 Ga0163162_10066393 3300013306 Bacteria 3656
230 Ga0163162_10104647 3300013306 Bacteria 2925
231 Ga0157375_10237790 3300013308 Bacteria 1981
232 Ga0163163_10010798 3300014325 Bacteria 8244
233 Ga0163163_10048310 3300014325 Bacteria 4184
234 Ga0157380_10007711 3300014326 Bacteria 7659
235 Ga0157380_10084490 3300014326 Bacteria 2603
236 Ga0157380_10110256 3300014326 Bacteria 2311
237 Ga0157380_10158459 3300014326 Bacteria 1964
238 Ga0157380_10374010 3300014326 Bacteria 1342
239 Ga0157379_10044147 3300014968 Bacteria 3979
240 Ga0157379_10178951 3300014968 Bacteria 1916
241 Ga0157379_10204253 3300014968 Bacteria 1787
242 Ga0157376_10330546 3300014969 Bacteria 1452
243 Ga0163161_10076464 3300017792 Bacteria 2457
244 Ga0207656_10062815 3300025321 Bacteria 1633
245 Ga0207682_10004178 3300025893 Bacteria 6105
246 Ga0207682_10034460 3300025893 Bacteria 2041
247 Ga0207643_10020694 3300025908 Bacteria 3612
248 Ga0207643_10133580 3300025908 Unclassified 1478
249 Ga0207684_10000290 3300025910 Bacteria 72057
250 Ga0207684_10005945 3300025910 Bacteria 11170
251 Ga0207684_10017889 3300025910 Bacteria 6075
252 Ga0207684_10023307 3300025910 Bacteria 5285
253 Ga0207684_10030955 3300025910 Bacteria 4554
254 Ga0207684_10135212 3300025910 Bacteria 2117
255 Ga0207684_10231668 3300025910 Bacteria 1594
256 Ga0207684_10440468 3300025910 Bacteria 1119
257 Ga0207654_10346215 3300025911 Bacteria 1022
258 Ga0207693_10007999 3300025915 Bacteria 8682
259 Ga0207663_10125142 3300025916 Bacteria 1767
260 Ga0207646_10000203 3300025922 Bacteria 80626
261 Ga0207646_10000361 3300025922 Bacteria 61092
262 Ga0207646_10000561 3300025922 Bacteria 48912
263 Ga0207646_10022877 3300025922 Bacteria 5746
264 Ga0207646_10032567 3300025922 Bacteria 4716
265 Ga0207646_10043144 3300025922 Bacteria 4051
266 Ga0207646_10283963 3300025922 Bacteria 1496
267 Ga0207646_10658863 3300025922 Bacteria 937
268 Ga0207681_10074940 3300025923 Bacteria 2372
269 Ga0207681_10272050 3300025923 Bacteria 1330
270 Ga0207694_10016937 3300025924 Bacteria 5506
271 Ga0207644_10295582 3300025931 Unclassified 1304
272 Ga0207644_10315056 3300025931 Bacteria 1264
273 Ga0207686_10400299 3300025934 Bacteria 1046
274 Ga0207670_10221885 3300025936 Bacteria 1447
275 Ga0207669_10013958 3300025937 Bacteria 4011
276 Ga0207669_10066890 3300025937 Bacteria 2237
277 Ga0207691_10001716 3300025940 Bacteria 21578
278 Ga0207711_10079606 3300025941 Bacteria 2860
279 Ga0207689_10288026 3300025942 Bacteria 1360
280 Ga0207689_10303869 3300025942 Bacteria 1322
281 Ga0207661_10142629 3300025944 Bacteria 2063
282 Ga0207667_10008809 3300025949 Bacteria 11946
283 Ga0207667_10008814 3300025949 Bacteria 11944
284 Ga0207651_10251527 3300025960 Bacteria 1446
285 Ga0207651_10261650 3300025960 Bacteria 1421
286 Ga0207668_10162263 3300025972 Bacteria 1743
287 Ga0207658_10130829 3300025986 Bacteria 2016
288 Ga0207703_10005429 3300026035 Bacteria 10257
289 Ga0207703_10124391 3300026035 Bacteria 2218
290 Ga0207708_10133503 3300026075 Bacteria 1942
291 Ga0207708_10289316 3300026075 Bacteria 1330
292 Ga0207702_10229213 3300026078 Bacteria 1735
293 Ga0207641_10007562 3300026088 Bacteria 9036
294 Ga0207641_10237452 3300026088 Bacteria 1697
295 Ga0207641_10447094 3300026088 Bacteria 1248
296 Ga0207641_10607374 3300026088 Bacteria 1071
297 Ga0207641_10712206 3300026088 Bacteria 989
298 Ga0207648_10048694 3300026089 Bacteria 3710
299 Ga0207674_10058913 3300026116 Bacteria 3888
300 Ga0207674_10106241 3300026116 Bacteria 2785
301 Ga0207675_100056960 3300026118 Bacteria 3646
302 Ga0207675_100077913 3300026118 Bacteria 3105
303 Ga0207683_10034574 3300026121 Bacteria 4392
304 Ga0207683_10059853 3300026121 Bacteria 3346
305 Ga0209588_1018545 3300027671 Bacteria 2166
306 Ga0207428_10025020 3300027907 Bacteria 5003
307 Ga0207428_10076979 3300027907 Bacteria 2612
308 Ga0268266_10262895 3300028379 Bacteria 1600
309 Ga0268265_10010060 3300028380 Bacteria 6385
310 Ga0268265_10368935 3300028380 Bacteria 1317
311 Ga0268264_10301042 3300028381 Bacteria 1510
312 Ga0307511_10045470 3300030521 Bacteria 3627
313 Ga0307415_100354977 3300032126 Bacteria 1236
314 Ga0373941_0139642 3300035115 Bacteria 880
315 Ga0373935_0025934 3300035692 Bacteria 3613
316 Ga0373937_0117502 3300036401 Bacteria 2477
317 Ga0395905_0161999 3300037471 Bacteria 2102
318 Ga0395901_0210953 3300038443 Bacteria 2033
319 Ga0451793_0307854 3300041452 Bacteria 1217
320 Ga0451802_1927662 3300041460 Bacteria 1646
321 Ga0451804_0884220 3300041463 Bacteria 879
322 Ga0451807_0603042 3300041486 Bacteria 5399
323 Ga0451807_1720140 3300041486 Bacteria 1543
324 Ga0451807_2353656 3300041486 Bacteria 1409
325 Ga0451833_0433004 3300041491 Bacteria 1066
326 Ga0451835_0202919 3300041492 Bacteria 1847
327 Ga0451837_0958535 3300041494 Bacteria 1067
328 Ga0451841_0125908 3300041498 Bacteria 1050
329 Ga0451845_0236601 3300041501 Bacteria 990
330 Ga0451843_0220894 3300041509 Bacteria 1894
331 Ga0451853_2856535 3300041512 Bacteria 5692
332 Ga0439445_0010271 3300042004 Bacteria 2214
333 Ga0450916_002639 3300042530 Bacteria 1921
334 Ga0451577_0045525 3300042876 Bacteria 3927
335 Ga0453683_0026209 3300044673 Bacteria 3702
336 Ga0453683_0046238 3300044673 Bacteria 2729
337 Ga0453683_0061236 3300044673 Bacteria 2353
338 Ga0453684_0352393 3300044712 Bacteria 1659
339 Ga0466960_0064110 3300044901 Bacteria 1811
340 Ga0451576_0053639 3300045051 Bacteria 4222
341 Ga0451576_0246087 3300045051 Bacteria 1869
342 Ga0451576_0403563 3300045051 Bacteria 1433
343 Ga0495580_0000199 3300046472 Bacteria 46030
344 Ga0495580_0176279 3300046472 Bacteria 1477
345 Ga0495642_0025236 3300046528 Bacteria 2355
346 Ga0495621_0065933 3300046539 Bacteria 1324
347 Ga0495633_0131325 3300046558 Bacteria 1159
348 Ga0495659_0140387 3300046664 Bacteria 964
349 Ga0495658_0004067 3300046683 Bacteria 7204
350 Ga0495669_0017848 3300046684 Bacteria 3047
351 Ga0496112_0185804 3300048915 Bacteria 2042
352 Ga0501041_0092263 3300049577 Bacteria 1870
353 Ga0501047_0105816 3300049581 Bacteria 2694
354 Ga0501048_0111835 3300049582 Bacteria 1929
355 Ga0501068_0093595 3300049584 Bacteria 1857
356 Ga0501068_0132633 3300049584 Bacteria 1558
357 Ga0501069_0204399 3300049585 Bacteria 1145
358 Ga0501072_0260804 3300049588 Bacteria 1379
359 Ga0501073_0060423 3300049589 Bacteria 2645
360 Ga0501076_0338405 3300049592 Bacteria 1235
361 Ga0501077_0009639 3300049593 Bacteria 6005
362 Ga0501077_0025148 3300049593 Bacteria 3782
363 Ga0501045_0104186 3300049824 Bacteria 2102
364 nmdc:mga05p37_11797_c1 3300050507 Bacteria 10416
365 nmdc:mga05p37_1204_c1 3300050507 Bacteria 29952
366 nmdc:mga05p37_136095_c1 3300050507 Bacteria 3013
367 nmdc:mga05p37_14656_c1 3300050507 Bacteria 9419
368 nmdc:mga05p37_147369_c1 3300050507 Bacteria 2880
369 nmdc:mga05p37_15266_c1 3300050507 Bacteria 9226
370 nmdc:mga05p37_160555_c1 3300050507 Bacteria 2746
371 nmdc:mga05p37_23408_c1 3300050507 Bacteria 7494
372 nmdc:mga05p37_26814_c1 3300050507 Bacteria 7009
373 nmdc:mga05p37_274688_c1 3300050507 Bacteria 2012
374 nmdc:mga05p37_284920_c1 3300050507 Bacteria 1969
375 nmdc:mga05p37_31187_c1 3300050507 Bacteria 6511
376 nmdc:mga05p37_34851_c1 3300050507 Bacteria 6167
377 nmdc:mga05p37_476879_c1 3300050507 Bacteria 1438
378 nmdc:mga05p37_487155_c1 3300050507 Bacteria 1419
379 nmdc:mga05p37_521035_c1 3300050507 Bacteria 1360
380 nmdc:mga05p37_526560_c1 3300050507 Bacteria 1351
381 nmdc:mga05p37_542518_c1 3300050507 Bacteria 1326
382 nmdc:mga05p37_54504_c1 3300050507 Bacteria 4920
383 nmdc:mga05p37_6179_c1 3300050507 Bacteria 14100
384 nmdc:mga05p37_630266_c1 3300050507 Bacteria 1205
385 nmdc:mga05p37_749474_c1 3300050507 Unclassified 1077
386 nmdc:mga05p37_882992_c1 3300050507 Bacteria 966
387 nmdc:mga05p37_92958_c1 3300050507 Bacteria 3717
388 nmdc:mga05p37_96222_c1 3300050507 Bacteria 3648
389 nmdc:mga09592_131440_c1 3300050508 Bacteria 2154
390 nmdc:mga09592_135688_c1 3300050508 Bacteria 2120
391 nmdc:mga09592_17605_c1 3300050508 Bacteria 5855
392 nmdc:mga09592_2066_c1 3300050508 Bacteria 16189
393 nmdc:mga09592_305072_c1 3300050508 Bacteria 1380
394 nmdc:mga09592_3646_c1 3300050508 Bacteria 12411
395 nmdc:mga09592_5674_c1 3300050508 Bacteria 10179
396 nmdc:mga09592_8184_c1 3300050508 Bacteria 8500
397 nmdc:mga0qj67_251671_c1 3300050509 Bacteria 1433
398 nmdc:mga0qj67_3139_c1 3300050509 Bacteria 11898
399 nmdc:mga0qj67_413597_c1 3300050509 Bacteria 1088
400 nmdc:mga0qj67_53180_c1 3300050509 Bacteria 3206
401 nmdc:mga0qj67_76503_c1 3300050509 Bacteria 2677
402 nmdc:mga06r32_101_c1 3300050510 Bacteria 59342
403 nmdc:mga06r32_15339_c1 3300050510 Bacteria 6961
404 nmdc:mga06r32_171108_c1 3300050510 Bacteria 2156
405 nmdc:mga06r32_18865_c1 3300050510 Bacteria 6323
406 nmdc:mga06r32_19672_c1 3300050510 Bacteria 6202
407 nmdc:mga06r32_282376_c1 3300050510 Bacteria 1647
408 nmdc:mga06r32_391028_c1 3300050510 Unclassified 1373
409 nmdc:mga06r32_45093_c1 3300050510 Bacteria 4201
410 nmdc:mga06r32_465927_c1 3300050510 Bacteria 1242
411 nmdc:mga06r32_7594_c1 3300050510 Bacteria 9747
412 nmdc:mga06r32_78732_c1 3300050510 Bacteria 3204
413 nmdc:mga08y16_113027_c1 3300050511 Bacteria 2827
414 nmdc:mga08y16_119110_c1 3300050511 Bacteria 2748
415 nmdc:mga08y16_142388_c1 3300050511 Bacteria 2493
416 nmdc:mga08y16_165958_c1 3300050511 Bacteria 2294
417 nmdc:mga08y16_3654_c1 3300050511 Bacteria 15998
418 nmdc:mga08y16_412468_c1 3300050511 Bacteria 1381
419 nmdc:mga08y16_57432_c1 3300050511 Bacteria 4067
420 nmdc:mga0n895_1038_c1 3300050512 Bacteria 20206
421 nmdc:mga0n895_136458_c1 3300050512 Bacteria 2480
422 nmdc:mga0n895_17417_c1 3300050512 Bacteria 6620
423 nmdc:mga0n895_261450_c1 3300050512 Unclassified 1756
424 nmdc:mga0n895_329271_c1 3300050512 Unclassified 1548
425 nmdc:mga0n895_33634_c1 3300050512 Bacteria 4929
426 nmdc:mga0n895_397618_c1 3300050512 Bacteria 1394
427 nmdc:mga0n895_41124_c1 3300050512 Bacteria 4493
428 nmdc:mga0n895_531429_c1 3300050512 Bacteria 1183
429 nmdc:mga0n895_545463_c1 3300050512 Bacteria 1166
430 nmdc:mga0n895_62921_c1 3300050512 Bacteria 3669
431 nmdc:mga0n895_72253_c1 3300050512 Bacteria 3422
432 nmdc:mga0n895_80622_c1 3300050512 Bacteria 3243
433 nmdc:mga0n895_92999_c1 3300050512 Bacteria 3019
434 nmdc:mga0rr50_153259_c1 3300050513 Bacteria 1865
435 nmdc:mga0rr50_317947_c1 3300050513 Bacteria 1305
436 nmdc:mga0rr50_35384_c1 3300050513 Bacteria 3586
437 nmdc:mga0rr50_5085_c1 3300050513 Bacteria 7801
438 nmdc:mga0rr50_51377_c1 3300050513 Bacteria 3058
439 nmdc:mga0rr50_60027_c1 3300050513 Bacteria 2859
440 nmdc:mga0rr50_70346_c1 3300050513 Bacteria 2666
441 nmdc:mga0rr50_9714_c1 3300050513 Bacteria 6068
442 nmdc:mga08x19_12779_c1 3300050514 Bacteria 5065
443 nmdc:mga08x19_157637_c1 3300050514 Bacteria 1540
444 nmdc:mga08x19_164173_c1 3300050514 Bacteria 1509
445 nmdc:mga08x19_20834_c1 3300050514 Bacteria 4041
446 nmdc:mga08x19_23683_c1 3300050514 Bacteria 3810
447 nmdc:mga08x19_309984_c1 3300050514 Bacteria 1097
448 nmdc:mga08x19_33062_c1 3300050514 Bacteria 3263
449 nmdc:mga08x19_431785_c1 3300050514 Bacteria 926
450 nmdc:mga0a205_13052_c1 3300050515 Bacteria 7232
451 nmdc:mga0a205_158687_c1 3300050515 Bacteria 2159
452 nmdc:mga0a205_19571_c1 3300050515 Bacteria 6385
453 nmdc:mga0a205_35085_c1 3300050515 Bacteria 3963
454 nmdc:mga0a205_410484_c1 3300050515 Bacteria 1217
455 nmdc:mga0a205_594534_c1 3300050515 Bacteria 960
456 nmdc:mga0a205_63066_c1 3300050515 Bacteria 3581
457 nmdc:mga0a205_7127_c2 3300050515 Bacteria 6501
458 nmdc:mga0a205_73914_c1 3300050515 Bacteria 3293
459 nmdc:mga0a205_8433_c1 3300050515 Bacteria 9378
460 Ga0500644_0085484 3300053088 Bacteria 1169
461 Ga0500555_017872 3300053103 Bacteria 2043
462 Ga0500588_0012377 3300053146 Bacteria 2114
463 Ga0590075_003669 3300059424 Bacteria 3641
464 Ga0501082_0642450 3300060353 Bacteria 929
465 Ga0157380_10055600
466 JGI25406J46586_10003476
467 rootH2_10295625
468 rootH1_10237734
469 Ga0065707_10110908
470 Ga0065707_10144657
471 Ga0070690_100012489
472 Ga0070677_10051816
473 Ga0070677_10146068
474 Ga0070689_100120396
475 Ga0070668_100036690
476 Ga0070669_100130250
477 Ga0070675_100101554
478 Ga0070675_100121087
479 Ga0070674_100000181
480 Ga0070673_100290187
481 Ga0070688_100115781
482 Ga0070667_100267503
483 Ga0070667_100298954
484 Ga0070703_10055638
485 Ga0070701_10002518
486 Ga0070711_100024477
487 Ga0070705_100431688
488 Ga0070700_100156867
489 Ga0070700_100268139
490 Ga0070694_100115718
491 Ga0070708_100007943
492 Ga0070708_100008572
493 Ga0070708_100012802
494 Ga0070708_100015900
495 Ga0070708_100028957
496 Ga0070708_100100622
497 Ga0070708_100303303
498 Ga0070678_100024365
499 Ga0068867_100099566
500 Ga0068867_100735608
501 Ga0070685_10226760
502 Ga0070706_100009250
503 Ga0070706_100009519
504 Ga0070706_100018374
505 Ga0070706_100019283
506 Ga0070706_100046328
507 Ga0070706_100057479
508 Ga0070706_100060892
509 Ga0070706_100141232
510 Ga0070706_100231013
511 Ga0070707_100010735
512 Ga0070707_100016135
513 Ga0070707_100028457
514 Ga0070707_100045895
515 Ga0070707_100588782
516 Ga0070698_100037407
517 Ga0070698_100088935
518 Ga0070698_100135912
519 Ga0070698_100195818
520 Ga0070698_100210138
521 Ga0070698_100304343
522 Ga0070699_100023641
523 Ga0070699_100036957
524 Ga0070699_100050357
525 Ga0070699_100071215
526 Ga0070699_100074424
527 Ga0070699_100096313
528 Ga0070699_100222087
529 Ga0070699_100642663
530 Ga0070697_100006270
531 Ga0070697_100006761
532 Ga0070697_100144792
533 Ga0070697_100367267
534 Ga0070672_100024120
535 Ga0070696_100196187
536 Ga0068855_100000076
537 Ga0068855_100008769
538 Ga0068856_100163541
539 Ga0070702_100363041
540 Ga0068859_100043662
541 Ga0068859_100298947
542 Ga0068859_100393312
543 Ga0068859_100666424
544 Ga0068864_100760569
545 Ga0068861_100118458
546 Ga0068851_10003382
547 Ga0068870_10119625
548 Ga0068870_10137379
549 Ga0068863_100032276
550 Ga0068863_100142627
551 Ga0068863_100299114
552 Ga0068863_100326204
553 Ga0068863_100484472
554 Ga0068858_100093153
555 Ga0068860_100048838
556 Ga0068860_100104224
557 Ga0068860_100386684
558 Ga0068862_100061603
559 Ga0068862_100411605
560 Ga0081455_10002879
561 Ga0081455_10004694
562 Ga0081455_10013946
563 Ga0081455_10084411
564 Ga0081455_10231528
565 Ga0081538_10000900
566 Ga0081538_10009209
567 Ga0081539_10000009
568 Ga0075432_10045945
569 Ga0070715_10125369
570 Ga0070715_10255976
571 Ga0070712_100002314
572 Ga0097621_100061379
573 Ga0068871_100128284
574 Ga0068871_100251605
575 Ga0068871_100475519
576 Ga0075428_100060403
577 Ga0075428_100114678
578 Ga0075428_100166413
579 Ga0075428_100175777
580 Ga0075428_100191398
581 Ga0075428_100338936
582 Ga0075428_100738268
583 Ga0075430_100004180
584 Ga0075430_100036518
585 Ga0075430_100332844
586 Ga0075431_100000189
587 Ga0075431_100000450
588 Ga0075431_100007185
589 Ga0075431_100052999
590 Ga0075431_100096206
591 Ga0075431_100144756
592 Ga0075431_100227271
593 Ga0075431_100390822
594 Ga0075431_100519112
595 Ga0075431_100610974
596 Ga0075433_10000090
597 Ga0075433_10002841
598 Ga0075433_10042209
599 Ga0075433_10143779
600 Ga0075433_10181622
601 Ga0075433_10186700
602 Ga0075433_10191237
603 Ga0075433_10277552
604 Ga0075433_10365327
605 Ga0075434_100003450
606 Ga0075434_100004866
607 Ga0075434_100007740
608 Ga0075434_100032079
609 Ga0075434_100038571
610 Ga0075434_100047984
611 Ga0075434_100056974
612 Ga0075434_100073844
613 Ga0075434_100195652
614 Ga0075434_100277159
615 Ga0075434_100284639
616 Ga0075434_100293551
617 Ga0075429_100002937
618 Ga0075429_100005910
619 Ga0075429_100013516
620 Ga0075429_100017932
621 Ga0075429_100041933
622 Ga0075429_100054538
623 Ga0075429_100082952
624 Ga0075429_100135331
625 Ga0075429_100181298
626 Ga0075429_100275521
627 Ga0075429_100389126
628 Ga0075429_100680087
629 Ga0075436_100000168
630 Ga0075436_100011370
631 Ga0075436_100019181
632 Ga0075436_100019829
633 Ga0075436_100022872
634 Ga0075436_100139728
635 Ga0075436_100251904
636 Ga0097620_100043663
637 Ga0097620_100298901
638 Ga0097620_100393292
639 Ga0097620_100666512
640 Ga0075435_100004843
641 Ga0075435_100015673
642 Ga0075435_100019301
643 Ga0075435_100054272
644 Ga0075435_100084014
645 Ga0075435_100090367
646 Ga0075435_100174084
647 Ga0075435_100184995
648 Ga0075435_100296799
649 Ga0075435_100680378
650 Ga0099794_10014195
651 Ga0099794_10095599
652 Ga0099794_10099650
653 Ga0111539_10012244
654 Ga0111539_10015484
655 Ga0111539_10017496
656 Ga0111539_10099644
657 Ga0111539_10183495
658 Ga0111539_10217523
659 Ga0111539_10392202
660 Ga0105245_10335132
661 Ga0114129_10000881
662 Ga0114129_10001425
663 Ga0114129_10002331
664 Ga0114129_10004869
665 Ga0114129_10012612
666 Ga0114129_10021744
667 Ga0114129_10031063
668 Ga0114129_10046275
669 Ga0114129_10056649
670 Ga0114129_10111038
671 Ga0114129_10129763
672 Ga0114129_10137613
673 Ga0114129_10169522
674 Ga0114129_10431894
675 Ga0114129_10482078
676 Ga0114129_10500011
677 Ga0114129_10571247
678 Ga0114129_10745785
679 Ga0114129_10784085
680 Ga0114129_11189648
681 Ga0105243_10165957
682 Ga0105243_10272695
683 Ga0105242_10264949
684 Ga0105238_10003023
685 Ga0105249_10117355
686 Ga0105249_10186316
687 Ga0105249_10264999
688 Ga0105249_10358829
689 Ga0157378_10001288
690 Ga0157378_10230456
691 Ga0157378_10325911
692 Ga0163162_10060337
693 Ga0163162_10066393
694 Ga0163162_10104647
695 Ga0157375_10237790
696 Ga0163163_10010798
697 Ga0163163_10048310
698 Ga0157380_10007711
699 Ga0157380_10084490
700 Ga0157380_10110256
701 Ga0157380_10158459
702 Ga0157380_10374010
703 Ga0157379_10044147
704 Ga0157379_10178951
705 Ga0157379_10204253
706 Ga0157376_10330546
707 Ga0163161_10076464
708 Ga0207656_10062815
709 Ga0207682_10004178
710 Ga0207682_10034460
711 Ga0207643_10020694
712 Ga0207643_10133580
713 Ga0207684_10000290
714 Ga0207684_10005945
715 Ga0207684_10017889
716 Ga0207684_10023307
717 Ga0207684_10030955
718 Ga0207684_10135212
719 Ga0207684_10231668
720 Ga0207684_10440468
721 Ga0207654_10346215
722 Ga0207693_10007999
723 Ga0207663_10125142
724 Ga0207646_10000203
725 Ga0207646_10000361
726 Ga0207646_10000561
727 Ga0207646_10022877
728 Ga0207646_10032567
729 Ga0207646_10043144
730 Ga0207646_10283963
731 Ga0207646_10658863
732 Ga0207681_10074940
733 Ga0207681_10272050
734 Ga0207694_10016937
735 Ga0207644_10295582
736 Ga0207644_10315056
737 Ga0207686_10400299
738 Ga0207670_10221885
739 Ga0207669_10013958
740 Ga0207669_10066890
741 Ga0207691_10001716
742 Ga0207711_10079606
743 Ga0207689_10288026
744 Ga0207689_10303869
745 Ga0207661_10142629
746 Ga0207667_10008809
747 Ga0207667_10008814
748 Ga0207651_10251527
749 Ga0207651_10261650
750 Ga0207668_10162263
751 Ga0207658_10130829
752 Ga0207703_10005429
753 Ga0207703_10124391
754 Ga0207708_10133503
755 Ga0207708_10289316
756 Ga0207702_10229213
757 Ga0207641_10007562
758 Ga0207641_10237452
759 Ga0207641_10447094
760 Ga0207641_10607374
761 Ga0207641_10712206
762 Ga0207648_10048694
763 Ga0207674_10058913
764 Ga0207674_10106241
765 Ga0207675_100056960
766 Ga0207675_100077913
767 Ga0207683_10034574
768 Ga0207683_10059853
769 Ga0209588_1018545
770 Ga0207428_10025020
771 Ga0207428_10076979
772 Ga0268266_10262895
773 Ga0268265_10010060
774 Ga0268265_10368935
775 Ga0268264_10301042
776 Ga0307511_10045470
777 Ga0307415_100354977
778 Ga0373941_0139642
779 Ga0373935_0025934
780 Ga0373937_0117502
781 Ga0395905_0161999
782 Ga0395901_0210953
783 Ga0451793_0307854
784 Ga0451802_1927662
785 Ga0451804_0884220
786 Ga0451807_0603042
787 Ga0451807_1720140
788 Ga0451807_2353656
789 Ga0451833_0433004
790 Ga0451835_0202919
791 Ga0451837_0958535
792 Ga0451841_0125908
793 Ga0451845_0236601
794 Ga0451843_0220894
795 Ga0451853_2856535
796 Ga0439445_0010271
797 Ga0450916_002639
798 Ga0451577_0045525
799 Ga0453683_0026209
800 Ga0453683_0046238
801 Ga0453683_0061236
802 Ga0453684_0352393
803 Ga0466960_0064110
804 Ga0451576_0053639
805 Ga0451576_0246087
806 Ga0451576_0403563
807 Ga0495580_0000199
808 Ga0495580_0176279
809 Ga0495642_0025236
810 Ga0495621_0065933
811 Ga0495633_0131325
812 Ga0495659_0140387
813 Ga0495658_0004067
814 Ga0495669_0017848
815 Ga0496112_0185804
816 Ga0501041_0092263
817 Ga0501047_0105816
818 Ga0501048_0111835
819 Ga0501068_0093595
820 Ga0501068_0132633
821 Ga0501069_0204399
822 Ga0501072_0260804
823 Ga0501073_0060423
824 Ga0501076_0338405
825 Ga0501077_0009639
826 Ga0501077_0025148
827 Ga0501045_0104186
828 nmdc:mga05p37_11797_c1
829 nmdc:mga05p37_1204_c1
830 nmdc:mga05p37_136095_c1
831 nmdc:mga05p37_14656_c1
832 nmdc:mga05p37_147369_c1
833 nmdc:mga05p37_15266_c1
834 nmdc:mga05p37_160555_c1
835 nmdc:mga05p37_23408_c1
836 nmdc:mga05p37_26814_c1
837 nmdc:mga05p37_274688_c1
838 nmdc:mga05p37_284920_c1
839 nmdc:mga05p37_31187_c1
840 nmdc:mga05p37_34851_c1
841 nmdc:mga05p37_476879_c1
842 nmdc:mga05p37_487155_c1
843 nmdc:mga05p37_521035_c1
844 nmdc:mga05p37_526560_c1
845 nmdc:mga05p37_542518_c1
846 nmdc:mga05p37_54504_c1
847 nmdc:mga05p37_6179_c1
848 nmdc:mga05p37_630266_c1
849 nmdc:mga05p37_749474_c1
850 nmdc:mga05p37_882992_c1
851 nmdc:mga05p37_92958_c1
852 nmdc:mga05p37_96222_c1
853 nmdc:mga09592_131440_c1
854 nmdc:mga09592_135688_c1
855 nmdc:mga09592_17605_c1
856 nmdc:mga09592_2066_c1
857 nmdc:mga09592_305072_c1
858 nmdc:mga09592_3646_c1
859 nmdc:mga09592_5674_c1
860 nmdc:mga09592_8184_c1
861 nmdc:mga0qj67_251671_c1
862 nmdc:mga0qj67_3139_c1
863 nmdc:mga0qj67_413597_c1
864 nmdc:mga0qj67_53180_c1
865 nmdc:mga0qj67_76503_c1
866 nmdc:mga06r32_101_c1
867 nmdc:mga06r32_15339_c1
868 nmdc:mga06r32_171108_c1
869 nmdc:mga06r32_18865_c1
870 nmdc:mga06r32_19672_c1
871 nmdc:mga06r32_282376_c1
872 nmdc:mga06r32_391028_c1
873 nmdc:mga06r32_45093_c1
874 nmdc:mga06r32_465927_c1
875 nmdc:mga06r32_7594_c1
876 nmdc:mga06r32_78732_c1
877 nmdc:mga08y16_113027_c1
878 nmdc:mga08y16_119110_c1
879 nmdc:mga08y16_142388_c1
880 nmdc:mga08y16_165958_c1
881 nmdc:mga08y16_3654_c1
882 nmdc:mga08y16_412468_c1
883 nmdc:mga08y16_57432_c1
884 nmdc:mga0n895_1038_c1
885 nmdc:mga0n895_136458_c1
886 nmdc:mga0n895_17417_c1
887 nmdc:mga0n895_261450_c1
888 nmdc:mga0n895_329271_c1
889 nmdc:mga0n895_33634_c1
890 nmdc:mga0n895_397618_c1
891 nmdc:mga0n895_41124_c1
892 nmdc:mga0n895_531429_c1
893 nmdc:mga0n895_545463_c1
894 nmdc:mga0n895_62921_c1
895 nmdc:mga0n895_72253_c1
896 nmdc:mga0n895_80622_c1
897 nmdc:mga0n895_92999_c1
898 nmdc:mga0rr50_153259_c1
899 nmdc:mga0rr50_317947_c1
900 nmdc:mga0rr50_35384_c1
901 nmdc:mga0rr50_5085_c1
902 nmdc:mga0rr50_51377_c1
903 nmdc:mga0rr50_60027_c1
904 nmdc:mga0rr50_70346_c1
905 nmdc:mga0rr50_9714_c1
906 nmdc:mga08x19_12779_c1
907 nmdc:mga08x19_157637_c1
908 nmdc:mga08x19_164173_c1
909 nmdc:mga08x19_20834_c1
910 nmdc:mga08x19_23683_c1
911 nmdc:mga08x19_309984_c1
912 nmdc:mga08x19_33062_c1
913 nmdc:mga08x19_431785_c1
914 nmdc:mga0a205_13052_c1
915 nmdc:mga0a205_158687_c1
916 nmdc:mga0a205_19571_c1
917 nmdc:mga0a205_35085_c1
918 nmdc:mga0a205_410484_c1
919 nmdc:mga0a205_594534_c1
920 nmdc:mga0a205_63066_c1
921 nmdc:mga0a205_7127_c2
922 nmdc:mga0a205_73914_c1
923 nmdc:mga0a205_8433_c1
924 Ga0500644_0085484
925 Ga0500555_017872
926 Ga0500588_0012377
927 Ga0590075_003669
928 Ga0501082_0642450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

112

287

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.9035 67 250
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.801 17 250
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7802 62 246
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.7744 18 250
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.7732 9 250
ID Description Score Start End Superfamily
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9659 65 253 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9585 59 251 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9462 61 250 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9443 59 251 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9439 61 250 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2V6TWC8-F1-model_v4 Nitrate ABC transporter, permease protein 0.9797 1 256 GO:0005886
GO:0006811
GO:0015112
AF-A0A5A5RFQ0-F1-model_v4 Bicarbonate transport system permease protein CmpB 0.9748 10 255 GO:0005886
GO:0006811
GO:0015112
AF-A0A2V8DR92-F1-model_v4 Nitrate ABC transporter, permease protein 0.9721 1 256 GO:0005886
GO:0006811
GO:0015112
AF-A0A0P7ZRN3-F1-model_v4 ABC-type nitrate/nitrite uptake system permease component NrtB 0.972 12 251 GO:0005886
GO:0006811
GO:0015112
AF-A0A1V3BUH3-F1-model_v4 deleted 0.9702 3 255

Map