F449267

General Info

Members Datasets Scaffolds Average Seq Length
464 193 928 313

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10001790|Ga0081455_1000179016
Length 327
Sequence MRYGLTLPGRGPLATPDNLASIAKRAEELGYYMVLFGDHIVVPRHIASTYPYTADGAFPGSASGEAMEQLTVLAFLAGQTHTIRLVTSVIIVPHRPPLVAAKALATLDVLSKGRLIVGIGVGWMREEFEALGLPPFAERGAVTDEYLHAFKELWTSDHPTFEGQYCRFANIDFLPKPVQQPHPPIWVGGESPRALRRTAALADGWYPIGSNPRFPMGTPAQLATGIERLAAYAREAGRNAAELDIVYRTHDYALHSDGHAVAGSSHHRHPFVGTAAEIALDIRQYEALGVGYLVLDFARMSRTLEEMLQHMEAMATQVWPRVEAGEE

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.29
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10001790 3300005937 Bacteria 25948
2 JGI25405J52794_10004095 3300003911 Unclassified 2586
3 Ga0065715_10091783 3300005293 Bacteria 5553
4 Ga0065707_10142246 3300005295 Bacteria 1757
5 Ga0070676_10001243 3300005328 Bacteria 12826
6 Ga0070676_10013697 3300005328 Bacteria 4445
7 Ga0070690_100135843 3300005330 Bacteria 1665
8 Ga0070670_100001622 3300005331 Bacteria 18193
9 Ga0068869_100000916 3300005334 Bacteria 16992
10 Ga0068869_100008223 3300005334 Bacteria 6715
11 Ga0068869_100024855 3300005334 Bacteria 4153
12 Ga0070680_100000611 3300005336 Bacteria 24734
13 Ga0070680_100033803 3300005336 Bacteria 4123
14 Ga0070682_100000395 3300005337 Bacteria 29105
15 Ga0068868_100416983 3300005338 Unclassified 1162
16 Ga0070660_100000167 3300005339 Bacteria 43059
17 Ga0070691_10004103 3300005341 Bacteria 6608
18 Ga0070691_10072767 3300005341 Bacteria 1670
19 Ga0070687_100013411 3300005343 Bacteria 3652
20 Ga0070661_100000190 3300005344 Bacteria 50874
21 Ga0070692_10000116 3300005345 Bacteria 18580
22 Ga0070668_100104013 3300005347 Bacteria 2253
23 Ga0070669_100011054 3300005353 Bacteria 6404
24 Ga0070669_100029332 3300005353 Bacteria 3965
25 Ga0070669_100074405 3300005353 Bacteria 2518
26 Ga0070703_10009069 3300005406 Bacteria 2806
27 Ga0070701_10046714 3300005438 Bacteria 2227
28 Ga0070711_100456423 3300005439 Bacteria 1047
29 Ga0070705_100000345 3300005440 Bacteria 27446
30 Ga0070705_100035293 3300005440 Bacteria 2802
31 Ga0070705_100086297 3300005440 Bacteria 1942
32 Ga0070705_100126346 3300005440 Bacteria 1661
33 Ga0070700_100020620 3300005441 Bacteria 3821
34 Ga0070694_100001040 3300005444 Bacteria 15832
35 Ga0070694_100001543 3300005444 Bacteria 13539
36 Ga0070694_100018844 3300005444 Bacteria 4385
37 Ga0070694_100020475 3300005444 Bacteria 4217
38 Ga0070694_100025942 3300005444 Bacteria 3795
39 Ga0070694_100067298 3300005444 Bacteria 2459
40 Ga0070708_100008319 3300005445 Bacteria 8330
41 Ga0070708_100043289 3300005445 Bacteria 3956
42 Ga0070708_100227828 3300005445 Bacteria 1749
43 Ga0070663_100001109 3300005455 Bacteria 14791
44 Ga0070662_100034780 3300005457 Bacteria 3555
45 Ga0070681_10002225 3300005458 Bacteria 17674
46 Ga0068867_100000544 3300005459 Bacteria 24792
47 Ga0070706_100059992 3300005467 Bacteria 3511
48 Ga0070706_100145569 3300005467 Bacteria 2212
49 Ga0070706_100221469 3300005467 Bacteria 1766
50 Ga0070707_100020729 3300005468 Bacteria 6204
51 Ga0070707_100031902 3300005468 Bacteria 5019
52 Ga0070707_100203003 3300005468 Bacteria 1932
53 Ga0070707_100385549 3300005468 Bacteria 1361
54 Ga0070698_100026647 3300005471 Bacteria 6014
55 Ga0070698_100408172 3300005471 Bacteria 1292
56 Ga0070699_100052015 3300005518 Bacteria 3546
57 Ga0070699_100066881 3300005518 Bacteria 3121
58 Ga0070679_100007235 3300005530 Bacteria 10358
59 Ga0070679_100440237 3300005530 Bacteria 1248
60 Ga0070684_100075352 3300005535 Bacteria 2976
61 Ga0070697_100006498 3300005536 Bacteria 9051
62 Ga0070697_100142542 3300005536 Bacteria 2016
63 Ga0068853_100000310 3300005539 Bacteria 34272
64 Ga0070672_100291477 3300005543 Bacteria 1382
65 Ga0070686_100048256 3300005544 Bacteria 2697
66 Ga0070695_100001758 3300005545 Bacteria 12183
67 Ga0070695_100003022 3300005545 Bacteria 9802
68 Ga0070695_100008771 3300005545 Bacteria 6008
69 Ga0070695_100179557 3300005545 Bacteria 1499
70 Ga0070696_100001082 3300005546 Bacteria 17576
71 Ga0070696_100035574 3300005546 Bacteria 3430
72 Ga0070696_100085058 3300005546 Bacteria 2245
73 Ga0070693_100000058 3300005547 Bacteria 43221
74 Ga0070704_100000355 3300005549 Bacteria 20791
75 Ga0070704_100013650 3300005549 Bacteria 5051
76 Ga0070704_100067614 3300005549 Bacteria 2581
77 Ga0070704_100227116 3300005549 Bacteria 1521
78 Ga0068855_100002540 3300005563 Bacteria 22481
79 Ga0068857_100030395 3300005577 Bacteria 4770
80 Ga0068854_100006531 3300005578 Bacteria 7422
81 Ga0068854_100096110 3300005578 Bacteria 2213
82 Ga0068856_100001786 3300005614 Bacteria 22477
83 Ga0070702_100075899 3300005615 Bacteria 1999
84 Ga0068859_100001779 3300005617 Bacteria 21926
85 Ga0068859_100013115 3300005617 Bacteria 8328
86 Ga0068859_100568194 3300005617 Bacteria 1228
87 Ga0068864_100001002 3300005618 Bacteria 23625
88 Ga0068870_10000538 3300005840 Bacteria 14309
89 Ga0068863_100003230 3300005841 Bacteria 16139
90 Ga0068863_100018688 3300005841 Bacteria 6632
91 Ga0068863_100146222 3300005841 Bacteria 2261
92 Ga0068858_100112392 3300005842 Unclassified 2544
93 Ga0068860_100028174 3300005843 Bacteria 5407
94 Ga0068860_100088092 3300005843 Bacteria 2955
95 Ga0068860_100585132 3300005843 Bacteria 1121
96 Ga0068862_100003646 3300005844 Bacteria 13174
97 Ga0068862_100003713 3300005844 Bacteria 13031
98 Ga0068862_100008244 3300005844 Bacteria 8621
99 Ga0068862_100124670 3300005844 Bacteria 2273
100 Ga0068862_100508932 3300005844 Bacteria 1144
101 Ga0081455_10001746 3300005937 Bacteria 26275
102 Ga0081455_10026150 3300005937 Bacteria 5376
103 Ga0081455_10036210 3300005937 Bacteria 4398
104 Ga0081455_10149177 3300005937 Bacteria 1805
105 Ga0081538_10000604 3300005981 Bacteria 39782
106 Ga0081538_10007749 3300005981 Bacteria 9235
107 Ga0081538_10014162 3300005981 Bacteria 6265
108 Ga0081538_10021671 3300005981 Bacteria 4679
109 Ga0081538_10021938 3300005981 Bacteria 4642
110 Ga0081538_10023548 3300005981 Bacteria 4422
111 Ga0081538_10070933 3300005981 Unclassified 1920
112 Ga0081540_1007934 3300005983 Bacteria 7492
113 Ga0081540_1019403 3300005983 Bacteria 4133
114 Ga0070715_10047509 3300006163 Bacteria 1830
115 Ga0070712_100001490 3300006175 Bacteria 14295
116 Ga0075428_100004619 3300006844 Bacteria 15233
117 Ga0075428_100013148 3300006844 Bacteria 9205
118 Ga0075428_100020526 3300006844 Bacteria 7315
119 Ga0075428_100041452 3300006844 Bacteria 5064
120 Ga0075428_100071063 3300006844 Bacteria 3804
121 Ga0075428_100110818 3300006844 Bacteria 2990
122 Ga0075428_100244344 3300006844 Bacteria 1936
123 Ga0075428_100570902 3300006844 Bacteria 1209
124 Ga0075430_100000047 3300006846 Bacteria 63972
125 Ga0075430_100004372 3300006846 Bacteria 11930
126 Ga0075430_100009978 3300006846 Bacteria 8034
127 Ga0075430_100037760 3300006846 Bacteria 4094
128 Ga0075430_100068578 3300006846 Bacteria 2975
129 Ga0075431_100000115 3300006847 Bacteria 51366
130 Ga0075431_100000424 3300006847 Bacteria 34431
131 Ga0075431_100003781 3300006847 Bacteria 14716
132 Ga0075431_100005244 3300006847 Bacteria 12761
133 Ga0075431_100050101 3300006847 Bacteria 4306
134 Ga0075431_100121231 3300006847 Bacteria 2698
135 Ga0075431_100229340 3300006847 Unclassified 1892
136 Ga0075431_100368017 3300006847 Bacteria 1443
137 Ga0075431_100386267 3300006847 Bacteria 1403
138 Ga0075433_10014926 3300006852 Bacteria 6358
139 Ga0075433_10017004 3300006852 Bacteria 6012
140 Ga0075433_10019890 3300006852 Bacteria 5604
141 Ga0075433_10029092 3300006852 Bacteria 4704
142 Ga0075433_10105066 3300006852 Bacteria 2502
143 Ga0075433_10195187 3300006852 Bacteria 1801
144 Ga0075434_100025554 3300006871 Bacteria 5778
145 Ga0075434_100026597 3300006871 Bacteria 5670
146 Ga0075434_100029590 3300006871 Bacteria 5389
147 Ga0075434_100047905 3300006871 Bacteria 4241
148 Ga0075434_100060453 3300006871 Bacteria 3768
149 Ga0075434_100068347 3300006871 Bacteria 3539
150 Ga0075429_100074093 3300006880 Unclassified 2965
151 Ga0075429_100363827 3300006880 Unclassified 1266
152 Ga0075429_100386342 3300006880 Bacteria 1225
153 Ga0068865_100024243 3300006881 Bacteria 3978
154 Ga0075436_100074017 3300006914 Bacteria 2358
155 Ga0075436_100085363 3300006914 Bacteria 2191
156 Ga0075436_100247590 3300006914 Bacteria 1269
157 Ga0097620_100001779 3300006931 Bacteria 21926
158 Ga0097620_100013115 3300006931 Bacteria 8328
159 Ga0097620_100568247 3300006931 Bacteria 1228
160 Ga0075435_100016930 3300007076 Bacteria 5504
161 Ga0075435_100039060 3300007076 Bacteria 3787
162 Ga0075435_100090910 3300007076 Bacteria 2518
163 Ga0075435_100097971 3300007076 Bacteria 2427
164 Ga0099794_10097479 3300007265 Unclassified 1465
165 Ga0105240_10239139 3300009093 Bacteria 2106
166 Ga0111539_10000633 3300009094 Bacteria 45453
167 Ga0111539_10045721 3300009094 Bacteria 5240
168 Ga0111539_10073353 3300009094 Bacteria 4036
169 Ga0111539_10271708 3300009094 Bacteria 1973
170 Ga0111539_10661373 3300009094 Bacteria 1216
171 Ga0114129_10000541 3300009147 Bacteria 46363
172 Ga0114129_10000579 3300009147 Bacteria 45143
173 Ga0114129_10041559 3300009147 Bacteria 6478
174 Ga0114129_10048942 3300009147 Bacteria 5941
175 Ga0114129_10059182 3300009147 Bacteria 5356
176 Ga0114129_10076835 3300009147 Bacteria 4647
177 Ga0114129_10089252 3300009147 Bacteria 4273
178 Ga0114129_10289193 3300009147 Bacteria 2187
179 Ga0114129_10351563 3300009147 Bacteria 1952
180 Ga0114129_10391806 3300009147 Bacteria 1832
181 Ga0114129_10518831 3300009147 Bacteria 1554
182 Ga0114129_11038508 3300009147 Bacteria 1030
183 Ga0105241_10000843 3300009174 Bacteria 23221
184 Ga0105241_10015873 3300009174 Bacteria 5517
185 Ga0105242_10049888 3300009176 Bacteria 3407
186 Ga0105242_10560363 3300009176 Bacteria 1097
187 Ga0105248_10254122 3300009177 Bacteria 1978
188 Ga0105249_10006151 3300009553 Bacteria 10411
189 Ga0105249_10081172 3300009553 Bacteria 3014
190 Ga0105249_10108367 3300009553 Bacteria 2622
191 Ga0105239_10750911 3300010375 Bacteria 1117
192 Ga0157373_10000229 3300013100 Bacteria 45851
193 Ga0157371_10067029 3300013102 Bacteria 2541
194 Ga0157369_10009407 3300013105 Bacteria 11174
195 Ga0157378_10174063 3300013297 Bacteria 2021
196 Ga0163162_10021501 3300013306 Bacteria 6355
197 Ga0163162_10508814 3300013306 Bacteria 1334
198 Ga0157372_10000144 3300013307 Bacteria 78166
199 Ga0157375_10031908 3300013308 Bacteria 4990
200 Ga0157375_10144767 3300013308 Bacteria 2506
201 Ga0157380_10565432 3300014326 Unclassified 1118
202 Ga0157379_10045921 3300014968 Unclassified 3899
203 Ga0207645_10000403 3300025907 Bacteria 35687
204 Ga0207645_10032858 3300025907 Bacteria 3335
205 Ga0207643_10000315 3300025908 Bacteria 33469
206 Ga0207684_10000425 3300025910 Bacteria 56051
207 Ga0207684_10150774 3300025910 Bacteria 2000
208 Ga0207654_10080718 3300025911 Bacteria 1957
209 Ga0207707_10000280 3300025912 Bacteria 54565
210 Ga0207693_10006110 3300025915 Bacteria 9981
211 Ga0207663_10050283 3300025916 Bacteria 2590
212 Ga0207660_10000076 3300025917 Bacteria 51418
213 Ga0207660_10211577 3300025917 Bacteria 1519
214 Ga0207662_10043403 3300025918 Bacteria 2652
215 Ga0207657_10000561 3300025919 Bacteria 39483
216 Ga0207649_10000454 3300025920 Bacteria 29523
217 Ga0207652_10003557 3300025921 Bacteria 12859
218 Ga0207646_10007629 3300025922 Bacteria 10952
219 Ga0207646_10220060 3300025922 Bacteria 1715
220 Ga0207646_10353396 3300025922 Bacteria 1328
221 Ga0207681_10009694 3300025923 Bacteria 5894
222 Ga0207681_10049160 3300025923 Bacteria 2849
223 Ga0207650_10004363 3300025925 Bacteria 9662
224 Ga0207706_10004049 3300025933 Bacteria 13864
225 Ga0207686_10035546 3300025934 Bacteria 2992
226 Ga0207686_10287229 3300025934 Bacteria 1217
227 Ga0207709_10005208 3300025935 Bacteria 7401
228 Ga0207691_10276157 3300025940 Bacteria 1446
229 Ga0207711_10188947 3300025941 Bacteria 1876
230 Ga0207689_10000127 3300025942 Bacteria 64217
231 Ga0207689_10075726 3300025942 Bacteria 2766
232 Ga0207679_10001763 3300025945 Bacteria 13478
233 Ga0207667_10002268 3300025949 Bacteria 24173
234 Ga0207651_10126501 3300025960 Bacteria 1948
235 Ga0207712_10010725 3300025961 Bacteria 5822
236 Ga0207640_10075325 3300025981 Bacteria 2287
237 Ga0207677_10237334 3300026023 Bacteria 1473
238 Ga0207703_10066758 3300026035 Bacteria 2960
239 Ga0207703_10296731 3300026035 Bacteria 1473
240 Ga0207639_10008824 3300026041 Bacteria 6930
241 Ga0207678_10004120 3300026067 Bacteria 13063
242 Ga0207678_10167658 3300026067 Bacteria 1875
243 Ga0207702_10001524 3300026078 Bacteria 22928
244 Ga0207641_10013322 3300026088 Bacteria 6744
245 Ga0207641_10159269 3300026088 Bacteria 2051
246 Ga0207648_10001136 3300026089 Bacteria 29916
247 Ga0207648_10209990 3300026089 Bacteria 1728
248 Ga0207676_10038475 3300026095 Bacteria 3651
249 Ga0207674_10000720 3300026116 Bacteria 43278
250 Ga0207674_10027557 3300026116 Bacteria 6008
251 Ga0207675_100004373 3300026118 Bacteria 13657
252 Ga0207675_100105359 3300026118 Bacteria 2658
253 Ga0207675_100181933 3300026118 Bacteria 2013
254 Ga0209998_10000020 3300027717 Bacteria 77474
255 Ga0207428_10000054 3300027907 Bacteria 175237
256 Ga0207428_10003997 3300027907 Bacteria 14155
257 Ga0207428_10019044 3300027907 Bacteria 5854
258 Ga0207428_10026019 3300027907 Bacteria 4889
259 Ga0268265_10005030 3300028380 Bacteria 9073
260 Ga0268265_10019923 3300028380 Bacteria 4672
261 Ga0268265_10100204 3300028380 Bacteria 2338
262 Ga0268265_10130132 3300028380 Bacteria 2090
263 Ga0268265_10216060 3300028380 Bacteria 1674
264 Ga0268265_10413115 3300028380 Bacteria 1251
265 Ga0268264_10038998 3300028381 Bacteria 3924
266 Ga0268264_10089736 3300028381 Bacteria 2647
267 Ga0268264_10511194 3300028381 Bacteria 1173
268 Ga0307408_100048218 3300031548 Bacteria 3054
269 Ga0307408_100055198 3300031548 Bacteria 2875
270 Ga0307408_100112060 3300031548 Bacteria 2097
271 Ga0307409_100141461 3300031995 Bacteria 2074
272 Ga0307416_100057904 3300032002 Bacteria 3138
273 Ga0307416_100187079 3300032002 Bacteria 1948
274 Ga0373929_0007377 3300035085 Bacteria 2007
275 Ga0373940_0043341 3300035088 Bacteria 1243
276 Ga0373931_0009634 3300035691 Archaea 4625
277 Ga0373925_0222523 3300037068 Bacteria 1507
278 Ga0242420_016501 3300038996 Bacteria 1287
279 Ga0439448_0000104 3300042005 Bacteria 15260
280 Ga0439459_0000699 3300042438 Bacteria 4569
281 Ga0439464_0001786 3300042439 Bacteria 5185
282 Ga0439460_0002039 3300042461 Bacteria 4842
283 Ga0451577_0005116 3300042876 Bacteria 13513
284 Ga0451577_0047737 3300042876 Bacteria 3828
285 Ga0451577_0052566 3300042876 Bacteria 3637
286 Ga0451577_0237663 3300042876 Bacteria 1648
287 Ga0453683_0004677 3300044673 Bacteria 9653
288 Ga0453683_0010605 3300044673 Bacteria 6101
289 Ga0453683_0070313 3300044673 Bacteria 2189
290 Ga0453684_0053477 3300044712 Bacteria 5270
291 Ga0451576_0015818 3300045051 Bacteria 8346
292 Ga0451576_0019609 3300045051 Bacteria 7379
293 Ga0451576_0036339 3300045051 Bacteria 5222
294 Ga0451576_0054060 3300045051 Bacteria 4204
295 Ga0451576_0100964 3300045051 Unclassified 3000
296 Ga0451576_0119780 3300045051 Bacteria 2740
297 Ga0495580_0119765 3300046472 Bacteria 1828
298 Ga0495594_0104785 3300046499 Bacteria 1592
299 Ga0495644_0139977 3300046523 Bacteria 924
300 Ga0495642_0018287 3300046528 Bacteria 2743
301 Ga0495656_0096291 3300046615 Bacteria 1362
302 Ga0495659_0010400 3300046664 Bacteria 2985
303 Ga0495670_0139820 3300046691 Bacteria 1266
304 Ga0495674_0149777 3300047319 Unclassified 1957
305 Ga0496102_0005305 3300048905 Bacteria 10942
306 Ga0496102_0015351 3300048905 Bacteria 6671
307 Ga0496103_0021014 3300048906 Bacteria 3926
308 Ga0496103_0039361 3300048906 Bacteria 2905
309 Ga0496111_0322713 3300048914 Unclassified 1144
310 Ga0496112_0023896 3300048915 Bacteria 5847
311 Ga0501033_0059395 3300049570 Bacteria 2824
312 Ga0501033_0085572 3300049570 Bacteria 2309
313 Ga0501033_0085599 3300049570 Bacteria 2309
314 Ga0501036_0120078 3300049572 Bacteria 2220
315 Ga0501038_0053808 3300049574 Bacteria 3464
316 Ga0501039_0012514 3300049575 Bacteria 6480
317 Ga0501039_0026104 3300049575 Bacteria 4489
318 Ga0501039_0243533 3300049575 Bacteria 1414
319 Ga0501040_0004097 3300049576 Bacteria 9477
320 Ga0501040_0071138 3300049576 Bacteria 2401
321 Ga0501040_0095774 3300049576 Bacteria 2066
322 Ga0501040_0310576 3300049576 Bacteria 1127
323 Ga0501040_0429017 3300049576 Bacteria 950
324 Ga0501041_0001371 3300049577 Bacteria 13454
325 Ga0501041_0066403 3300049577 Bacteria 2211
326 Ga0501041_0080745 3300049577 Bacteria 2002
327 Ga0501041_0083356 3300049577 Bacteria 1970
328 Ga0501041_0260506 3300049577 Bacteria 1090
329 Ga0501041_0366619 3300049577 Bacteria 911
330 Ga0501042_0029344 3300049578 Bacteria 3879
331 Ga0501042_0254178 3300049578 Bacteria 1268
332 Ga0501046_0000300 3300049580 Bacteria 49836
333 Ga0501047_0033086 3300049581 Bacteria 4992
334 Ga0501048_0044124 3300049582 Bacteria 3190
335 Ga0501048_0075916 3300049582 Bacteria 2372
336 Ga0501067_0006814 3300049583 Bacteria 6336
337 Ga0501068_0043028 3300049584 Bacteria 2716
338 Ga0501068_0120635 3300049584 Bacteria 1635
339 Ga0501068_0138265 3300049584 Bacteria 1526
340 Ga0501071_0106564 3300049587 Bacteria 2069
341 Ga0501071_0189628 3300049587 Bacteria 1542
342 Ga0501071_0394511 3300049587 Bacteria 1056
343 Ga0501072_0002085 3300049588 Bacteria 14890
344 Ga0501072_0008483 3300049588 Bacteria 7798
345 Ga0501072_0091242 3300049588 Bacteria 2419
346 Ga0501072_0145151 3300049588 Bacteria 1892
347 Ga0501072_0161894 3300049588 Bacteria 1785
348 Ga0501072_0259188 3300049588 Bacteria 1384
349 Ga0501074_0022188 3300049590 Bacteria 4612
350 Ga0501074_0088825 3300049590 Bacteria 2213
351 Ga0501074_0221071 3300049590 Bacteria 1348
352 Ga0501074_0296975 3300049590 Unclassified 1148
353 Ga0501074_0328971 3300049590 Bacteria 1085
354 Ga0501075_0012610 3300049591 Bacteria 6012
355 Ga0501075_0020783 3300049591 Bacteria 4778
356 Ga0501075_0021605 3300049591 Bacteria 4693
357 Ga0501075_0071416 3300049591 Bacteria 2624
358 Ga0501075_0106321 3300049591 Bacteria 2133
359 Ga0501075_0118867 3300049591 Bacteria 2010
360 Ga0501075_0199762 3300049591 Bacteria 1525
361 Ga0501076_0007754 3300049592 Bacteria 7825
362 Ga0501076_0010185 3300049592 Bacteria 6967
363 Ga0501076_0028267 3300049592 Bacteria 4353
364 Ga0501076_0081541 3300049592 Bacteria 2597
365 Ga0501076_0105151 3300049592 Bacteria 2278
366 Ga0501076_0109709 3300049592 Bacteria 2230
367 Ga0501076_0118742 3300049592 Bacteria 2141
368 Ga0501076_0227830 3300049592 Bacteria 1524
369 Ga0501077_0003221 3300049593 Bacteria 9826
370 Ga0501077_0008992 3300049593 Bacteria 6200
371 Ga0501077_0022588 3300049593 Bacteria 3985
372 Ga0501079_0004471 3300049741 Bacteria 10372
373 Ga0501079_0047279 3300049741 Bacteria 3319
374 Ga0501080_0051765 3300049742 Bacteria 3822
375 Ga0501080_0070309 3300049742 Bacteria 3255
376 Ga0501080_0095406 3300049742 Bacteria 2762
377 Ga0501080_0131397 3300049742 Bacteria 2318
378 Ga0501081_0001165 3300049743 Bacteria 15909
379 Ga0501081_0003933 3300049743 Bacteria 9523
380 Ga0501081_0009838 3300049743 Bacteria 6228
381 Ga0501081_0022961 3300049743 Bacteria 4177
382 Ga0501081_0042533 3300049743 Bacteria 3113
383 Ga0501081_0045194 3300049743 Bacteria 3024
384 Ga0501081_0110967 3300049743 Bacteria 1946
385 Ga0501083_0060453 3300049744 Bacteria 2531
386 Ga0501083_0072832 3300049744 Bacteria 2283
387 Ga0501083_0296856 3300049744 Bacteria 1051
388 Ga0501035_0073971 3300049822 Bacteria 3015
389 Ga0501045_0001644 3300049824 Bacteria 15009
390 Ga0501045_0035993 3300049824 Bacteria 3594
391 Ga0501045_0079703 3300049824 Bacteria 2414
392 nmdc:mga05p37_297376_c1 3300050507 Bacteria 1919
393 nmdc:mga05p37_3374_c1 3300050507 Bacteria 18642
394 nmdc:mga05p37_34488_c1 3300050507 Bacteria 6200
395 nmdc:mga05p37_4397_c1 3300050507 Bacteria 16468
396 nmdc:mga05p37_54345_c1 3300050507 Bacteria 4926
397 nmdc:mga05p37_74489_c1 3300050507 Bacteria 4178
398 nmdc:mga05p37_781371_c1 3300050507 Bacteria 1048
399 nmdc:mga05p37_79528_c1 3300050507 Bacteria 4037
400 nmdc:mga05p37_87857_c1 3300050507 Bacteria 3832
401 nmdc:mga05p37_90204_c1 3300050507 Bacteria 3778
402 nmdc:mga05p37_92531_c1 3300050507 Unclassified 3726
403 nmdc:mga09592_529_c1 3300050508 Bacteria 28853
404 nmdc:mga09592_58922_c1 3300050508 Bacteria 3247
405 nmdc:mga0qj67_203_c1 3300050509 Bacteria 40147
406 nmdc:mga0qj67_20664_c1 3300050509 Bacteria 5044
407 nmdc:mga06r32_295363_c1 3300050510 Bacteria 1607
408 nmdc:mga06r32_330494_c1 3300050510 Bacteria 1509
409 nmdc:mga06r32_362_c1 3300050510 Bacteria 38094
410 nmdc:mga06r32_366995_c1 3300050510 Bacteria 1423
411 nmdc:mga06r32_542259_c1 3300050510 Bacteria 1138
412 nmdc:mga06r32_673_c1 3300050510 Bacteria 29768
413 nmdc:mga08y16_140479_c1 3300050511 Bacteria 2511
414 nmdc:mga08y16_36304_c1 3300050511 Bacteria 5176
415 nmdc:mga08y16_419599_c1 3300050511 Unclassified 1367
416 nmdc:mga08y16_733840_c1 3300050511 Bacteria 985
417 nmdc:mga0n895_10432_c1 3300050512 Bacteria 8206
418 nmdc:mga0n895_189148_c1 3300050512 Bacteria 2090
419 nmdc:mga0n895_24191_c1 3300050512 Bacteria 5722
420 nmdc:mga0n895_32_c1 3300050512 Bacteria 81400
421 nmdc:mga0n895_433740_c1 3300050512 Bacteria 1328
422 nmdc:mga0n895_50762_c1 3300050512 Bacteria 4067
423 nmdc:mga0n895_61775_c1 3300050512 Bacteria 3700
424 nmdc:mga0n895_92593_c1 3300050512 Bacteria 3026
425 nmdc:mga0rr50_1117_c1 3300050513 Bacteria 14584
426 nmdc:mga0rr50_245829_c1 3300050513 Bacteria 1484
427 nmdc:mga0rr50_28092_c1 3300050513 Bacteria 3950
428 nmdc:mga0rr50_32888_c1 3300050513 Bacteria 3701
429 nmdc:mga0rr50_446_c1 3300050513 Bacteria 22057
430 nmdc:mga08x19_12877_c1 3300050514 Bacteria 5047
431 nmdc:mga08x19_3538_c1 3300050514 Bacteria 9289
432 nmdc:mga08x19_59055_c1 3300050514 Bacteria 2483
433 nmdc:mga08x19_64557_c1 3300050514 Bacteria 2377
434 nmdc:mga0a205_12037_c1 3300050515 Bacteria 7991
435 nmdc:mga0a205_1371_c1 3300050515 Bacteria 20576
436 nmdc:mga0a205_183006_c1 3300050515 Bacteria 1989
437 nmdc:mga0a205_36141_c2 3300050515 Bacteria 3744
438 nmdc:mga0a205_64274_c1 3300050515 Bacteria 3544
439 nmdc:mga0a205_77945_c1 3300050515 Bacteria 3201
440 nmdc:mga0a205_87525_c1 3300050515 Bacteria 3010
441 nmdc:mga0a205_9702_c1 3300050515 Bacteria 8814
442 Ga0501084_0016135 3300054114 Bacteria 6202
443 Ga0501084_0016207 3300054114 Bacteria 6188
444 Ga0501084_0055557 3300054114 Bacteria 3312
445 Ga0501084_0087509 3300054114 Bacteria 2615
446 Ga0501084_0143148 3300054114 Bacteria 2014
447 Ga0501084_0186003 3300054114 Bacteria 1753
448 Ga0501084_0340497 3300054114 Bacteria 1267
449 Ga0590074_005583 3300059423 Bacteria 2085
450 Ga0590077_005457 3300059426 Bacteria 2607
451 Ga0501082_0004791 3300060353 Bacteria 11799
452 Ga0501082_0009525 3300060353 Bacteria 8357
453 Ga0501082_0027831 3300060353 Bacteria 4868
454 Ga0501082_0029129 3300060353 Bacteria 4757
455 Ga0501082_0065247 3300060353 Bacteria 3135
456 Ga0501082_0145853 3300060353 Bacteria 2055
457 Ga0530510_0002336 3300061734 Bacteria 13018
458 Ga0530510_0028995 3300061734 Bacteria 3970
459 Ga0530510_0032185 3300061734 Bacteria 3771
460 Ga0530510_0038203 3300061734 Bacteria 3466
461 Ga0530510_0038798 3300061734 Bacteria 3440
462 Ga0530510_0043758 3300061734 Bacteria 3235
463 Ga0530510_0068406 3300061734 Bacteria 2576
464 Ga0530510_0112678 3300061734 Bacteria 1993
465 Ga0081455_10001790
466 JGI25405J52794_10004095
467 Ga0065715_10091783
468 Ga0065707_10142246
469 Ga0070676_10001243
470 Ga0070676_10013697
471 Ga0070690_100135843
472 Ga0070670_100001622
473 Ga0068869_100000916
474 Ga0068869_100008223
475 Ga0068869_100024855
476 Ga0070680_100000611
477 Ga0070680_100033803
478 Ga0070682_100000395
479 Ga0068868_100416983
480 Ga0070660_100000167
481 Ga0070691_10004103
482 Ga0070691_10072767
483 Ga0070687_100013411
484 Ga0070661_100000190
485 Ga0070692_10000116
486 Ga0070668_100104013
487 Ga0070669_100011054
488 Ga0070669_100029332
489 Ga0070669_100074405
490 Ga0070703_10009069
491 Ga0070701_10046714
492 Ga0070711_100456423
493 Ga0070705_100000345
494 Ga0070705_100035293
495 Ga0070705_100086297
496 Ga0070705_100126346
497 Ga0070700_100020620
498 Ga0070694_100001040
499 Ga0070694_100001543
500 Ga0070694_100018844
501 Ga0070694_100020475
502 Ga0070694_100025942
503 Ga0070694_100067298
504 Ga0070708_100008319
505 Ga0070708_100043289
506 Ga0070708_100227828
507 Ga0070663_100001109
508 Ga0070662_100034780
509 Ga0070681_10002225
510 Ga0068867_100000544
511 Ga0070706_100059992
512 Ga0070706_100145569
513 Ga0070706_100221469
514 Ga0070707_100020729
515 Ga0070707_100031902
516 Ga0070707_100203003
517 Ga0070707_100385549
518 Ga0070698_100026647
519 Ga0070698_100408172
520 Ga0070699_100052015
521 Ga0070699_100066881
522 Ga0070679_100007235
523 Ga0070679_100440237
524 Ga0070684_100075352
525 Ga0070697_100006498
526 Ga0070697_100142542
527 Ga0068853_100000310
528 Ga0070672_100291477
529 Ga0070686_100048256
530 Ga0070695_100001758
531 Ga0070695_100003022
532 Ga0070695_100008771
533 Ga0070695_100179557
534 Ga0070696_100001082
535 Ga0070696_100035574
536 Ga0070696_100085058
537 Ga0070693_100000058
538 Ga0070704_100000355
539 Ga0070704_100013650
540 Ga0070704_100067614
541 Ga0070704_100227116
542 Ga0068855_100002540
543 Ga0068857_100030395
544 Ga0068854_100006531
545 Ga0068854_100096110
546 Ga0068856_100001786
547 Ga0070702_100075899
548 Ga0068859_100001779
549 Ga0068859_100013115
550 Ga0068859_100568194
551 Ga0068864_100001002
552 Ga0068870_10000538
553 Ga0068863_100003230
554 Ga0068863_100018688
555 Ga0068863_100146222
556 Ga0068858_100112392
557 Ga0068860_100028174
558 Ga0068860_100088092
559 Ga0068860_100585132
560 Ga0068862_100003646
561 Ga0068862_100003713
562 Ga0068862_100008244
563 Ga0068862_100124670
564 Ga0068862_100508932
565 Ga0081455_10001746
566 Ga0081455_10026150
567 Ga0081455_10036210
568 Ga0081455_10149177
569 Ga0081538_10000604
570 Ga0081538_10007749
571 Ga0081538_10014162
572 Ga0081538_10021671
573 Ga0081538_10021938
574 Ga0081538_10023548
575 Ga0081538_10070933
576 Ga0081540_1007934
577 Ga0081540_1019403
578 Ga0070715_10047509
579 Ga0070712_100001490
580 Ga0075428_100004619
581 Ga0075428_100013148
582 Ga0075428_100020526
583 Ga0075428_100041452
584 Ga0075428_100071063
585 Ga0075428_100110818
586 Ga0075428_100244344
587 Ga0075428_100570902
588 Ga0075430_100000047
589 Ga0075430_100004372
590 Ga0075430_100009978
591 Ga0075430_100037760
592 Ga0075430_100068578
593 Ga0075431_100000115
594 Ga0075431_100000424
595 Ga0075431_100003781
596 Ga0075431_100005244
597 Ga0075431_100050101
598 Ga0075431_100121231
599 Ga0075431_100229340
600 Ga0075431_100368017
601 Ga0075431_100386267
602 Ga0075433_10014926
603 Ga0075433_10017004
604 Ga0075433_10019890
605 Ga0075433_10029092
606 Ga0075433_10105066
607 Ga0075433_10195187
608 Ga0075434_100025554
609 Ga0075434_100026597
610 Ga0075434_100029590
611 Ga0075434_100047905
612 Ga0075434_100060453
613 Ga0075434_100068347
614 Ga0075429_100074093
615 Ga0075429_100363827
616 Ga0075429_100386342
617 Ga0068865_100024243
618 Ga0075436_100074017
619 Ga0075436_100085363
620 Ga0075436_100247590
621 Ga0097620_100001779
622 Ga0097620_100013115
623 Ga0097620_100568247
624 Ga0075435_100016930
625 Ga0075435_100039060
626 Ga0075435_100090910
627 Ga0075435_100097971
628 Ga0099794_10097479
629 Ga0105240_10239139
630 Ga0111539_10000633
631 Ga0111539_10045721
632 Ga0111539_10073353
633 Ga0111539_10271708
634 Ga0111539_10661373
635 Ga0114129_10000541
636 Ga0114129_10000579
637 Ga0114129_10041559
638 Ga0114129_10048942
639 Ga0114129_10059182
640 Ga0114129_10076835
641 Ga0114129_10089252
642 Ga0114129_10289193
643 Ga0114129_10351563
644 Ga0114129_10391806
645 Ga0114129_10518831
646 Ga0114129_11038508
647 Ga0105241_10000843
648 Ga0105241_10015873
649 Ga0105242_10049888
650 Ga0105242_10560363
651 Ga0105248_10254122
652 Ga0105249_10006151
653 Ga0105249_10081172
654 Ga0105249_10108367
655 Ga0105239_10750911
656 Ga0157373_10000229
657 Ga0157371_10067029
658 Ga0157369_10009407
659 Ga0157378_10174063
660 Ga0163162_10021501
661 Ga0163162_10508814
662 Ga0157372_10000144
663 Ga0157375_10031908
664 Ga0157375_10144767
665 Ga0157380_10565432
666 Ga0157379_10045921
667 Ga0207645_10000403
668 Ga0207645_10032858
669 Ga0207643_10000315
670 Ga0207684_10000425
671 Ga0207684_10150774
672 Ga0207654_10080718
673 Ga0207707_10000280
674 Ga0207693_10006110
675 Ga0207663_10050283
676 Ga0207660_10000076
677 Ga0207660_10211577
678 Ga0207662_10043403
679 Ga0207657_10000561
680 Ga0207649_10000454
681 Ga0207652_10003557
682 Ga0207646_10007629
683 Ga0207646_10220060
684 Ga0207646_10353396
685 Ga0207681_10009694
686 Ga0207681_10049160
687 Ga0207650_10004363
688 Ga0207706_10004049
689 Ga0207686_10035546
690 Ga0207686_10287229
691 Ga0207709_10005208
692 Ga0207691_10276157
693 Ga0207711_10188947
694 Ga0207689_10000127
695 Ga0207689_10075726
696 Ga0207679_10001763
697 Ga0207667_10002268
698 Ga0207651_10126501
699 Ga0207712_10010725
700 Ga0207640_10075325
701 Ga0207677_10237334
702 Ga0207703_10066758
703 Ga0207703_10296731
704 Ga0207639_10008824
705 Ga0207678_10004120
706 Ga0207678_10167658
707 Ga0207702_10001524
708 Ga0207641_10013322
709 Ga0207641_10159269
710 Ga0207648_10001136
711 Ga0207648_10209990
712 Ga0207676_10038475
713 Ga0207674_10000720
714 Ga0207674_10027557
715 Ga0207675_100004373
716 Ga0207675_100105359
717 Ga0207675_100181933
718 Ga0209998_10000020
719 Ga0207428_10000054
720 Ga0207428_10003997
721 Ga0207428_10019044
722 Ga0207428_10026019
723 Ga0268265_10005030
724 Ga0268265_10019923
725 Ga0268265_10100204
726 Ga0268265_10130132
727 Ga0268265_10216060
728 Ga0268265_10413115
729 Ga0268264_10038998
730 Ga0268264_10089736
731 Ga0268264_10511194
732 Ga0307408_100048218
733 Ga0307408_100055198
734 Ga0307408_100112060
735 Ga0307409_100141461
736 Ga0307416_100057904
737 Ga0307416_100187079
738 Ga0373929_0007377
739 Ga0373940_0043341
740 Ga0373931_0009634
741 Ga0373925_0222523
742 Ga0242420_016501
743 Ga0439448_0000104
744 Ga0439459_0000699
745 Ga0439464_0001786
746 Ga0439460_0002039
747 Ga0451577_0005116
748 Ga0451577_0047737
749 Ga0451577_0052566
750 Ga0451577_0237663
751 Ga0453683_0004677
752 Ga0453683_0010605
753 Ga0453683_0070313
754 Ga0453684_0053477
755 Ga0451576_0015818
756 Ga0451576_0019609
757 Ga0451576_0036339
758 Ga0451576_0054060
759 Ga0451576_0100964
760 Ga0451576_0119780
761 Ga0495580_0119765
762 Ga0495594_0104785
763 Ga0495644_0139977
764 Ga0495642_0018287
765 Ga0495656_0096291
766 Ga0495659_0010400
767 Ga0495670_0139820
768 Ga0495674_0149777
769 Ga0496102_0005305
770 Ga0496102_0015351
771 Ga0496103_0021014
772 Ga0496103_0039361
773 Ga0496111_0322713
774 Ga0496112_0023896
775 Ga0501033_0059395
776 Ga0501033_0085572
777 Ga0501033_0085599
778 Ga0501036_0120078
779 Ga0501038_0053808
780 Ga0501039_0012514
781 Ga0501039_0026104
782 Ga0501039_0243533
783 Ga0501040_0004097
784 Ga0501040_0071138
785 Ga0501040_0095774
786 Ga0501040_0310576
787 Ga0501040_0429017
788 Ga0501041_0001371
789 Ga0501041_0066403
790 Ga0501041_0080745
791 Ga0501041_0083356
792 Ga0501041_0260506
793 Ga0501041_0366619
794 Ga0501042_0029344
795 Ga0501042_0254178
796 Ga0501046_0000300
797 Ga0501047_0033086
798 Ga0501048_0044124
799 Ga0501048_0075916
800 Ga0501067_0006814
801 Ga0501068_0043028
802 Ga0501068_0120635
803 Ga0501068_0138265
804 Ga0501071_0106564
805 Ga0501071_0189628
806 Ga0501071_0394511
807 Ga0501072_0002085
808 Ga0501072_0008483
809 Ga0501072_0091242
810 Ga0501072_0145151
811 Ga0501072_0161894
812 Ga0501072_0259188
813 Ga0501074_0022188
814 Ga0501074_0088825
815 Ga0501074_0221071
816 Ga0501074_0296975
817 Ga0501074_0328971
818 Ga0501075_0012610
819 Ga0501075_0020783
820 Ga0501075_0021605
821 Ga0501075_0071416
822 Ga0501075_0106321
823 Ga0501075_0118867
824 Ga0501075_0199762
825 Ga0501076_0007754
826 Ga0501076_0010185
827 Ga0501076_0028267
828 Ga0501076_0081541
829 Ga0501076_0105151
830 Ga0501076_0109709
831 Ga0501076_0118742
832 Ga0501076_0227830
833 Ga0501077_0003221
834 Ga0501077_0008992
835 Ga0501077_0022588
836 Ga0501079_0004471
837 Ga0501079_0047279
838 Ga0501080_0051765
839 Ga0501080_0070309
840 Ga0501080_0095406
841 Ga0501080_0131397
842 Ga0501081_0001165
843 Ga0501081_0003933
844 Ga0501081_0009838
845 Ga0501081_0022961
846 Ga0501081_0042533
847 Ga0501081_0045194
848 Ga0501081_0110967
849 Ga0501083_0060453
850 Ga0501083_0072832
851 Ga0501083_0296856
852 Ga0501035_0073971
853 Ga0501045_0001644
854 Ga0501045_0035993
855 Ga0501045_0079703
856 nmdc:mga05p37_297376_c1
857 nmdc:mga05p37_3374_c1
858 nmdc:mga05p37_34488_c1
859 nmdc:mga05p37_4397_c1
860 nmdc:mga05p37_54345_c1
861 nmdc:mga05p37_74489_c1
862 nmdc:mga05p37_781371_c1
863 nmdc:mga05p37_79528_c1
864 nmdc:mga05p37_87857_c1
865 nmdc:mga05p37_90204_c1
866 nmdc:mga05p37_92531_c1
867 nmdc:mga09592_529_c1
868 nmdc:mga09592_58922_c1
869 nmdc:mga0qj67_203_c1
870 nmdc:mga0qj67_20664_c1
871 nmdc:mga06r32_295363_c1
872 nmdc:mga06r32_330494_c1
873 nmdc:mga06r32_362_c1
874 nmdc:mga06r32_366995_c1
875 nmdc:mga06r32_542259_c1
876 nmdc:mga06r32_673_c1
877 nmdc:mga08y16_140479_c1
878 nmdc:mga08y16_36304_c1
879 nmdc:mga08y16_419599_c1
880 nmdc:mga08y16_733840_c1
881 nmdc:mga0n895_10432_c1
882 nmdc:mga0n895_189148_c1
883 nmdc:mga0n895_24191_c1
884 nmdc:mga0n895_32_c1
885 nmdc:mga0n895_433740_c1
886 nmdc:mga0n895_50762_c1
887 nmdc:mga0n895_61775_c1
888 nmdc:mga0n895_92593_c1
889 nmdc:mga0rr50_1117_c1
890 nmdc:mga0rr50_245829_c1
891 nmdc:mga0rr50_28092_c1
892 nmdc:mga0rr50_32888_c1
893 nmdc:mga0rr50_446_c1
894 nmdc:mga08x19_12877_c1
895 nmdc:mga08x19_3538_c1
896 nmdc:mga08x19_59055_c1
897 nmdc:mga08x19_64557_c1
898 nmdc:mga0a205_12037_c1
899 nmdc:mga0a205_1371_c1
900 nmdc:mga0a205_183006_c1
901 nmdc:mga0a205_36141_c2
902 nmdc:mga0a205_64274_c1
903 nmdc:mga0a205_77945_c1
904 nmdc:mga0a205_87525_c1
905 nmdc:mga0a205_9702_c1
906 Ga0501084_0016135
907 Ga0501084_0016207
908 Ga0501084_0055557
909 Ga0501084_0087509
910 Ga0501084_0143148
911 Ga0501084_0186003
912 Ga0501084_0340497
913 Ga0590074_005583
914 Ga0590077_005457
915 Ga0501082_0004791
916 Ga0501082_0009525
917 Ga0501082_0027831
918 Ga0501082_0029129
919 Ga0501082_0065247
920 Ga0501082_0145853
921 Ga0530510_0002336
922 Ga0530510_0028995
923 Ga0530510_0032185
924 Ga0530510_0038203
925 Ga0530510_0038798
926 Ga0530510_0043758
927 Ga0530510_0068406
928 Ga0530510_0112678

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

1

319

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b81-assembly2.cif.gz_C crystal structure of the luciferase-like monooxygenase from bacillus cereus 0.8507 1 313
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.8251 1 316
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.8126 1 316
3fgc-assembly1.cif.gz_A crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.8054 1 313
3rao-assembly2.cif.gz_A-2 crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.805 1 316
ID Description Score Start End Superfamily
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9052 20 308 3.20.20.30
af_I6XG43_1_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8897 1 313 3.20.20.30
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8886 20 308 3.20.20.30
af_I6XG43_1_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8839 1 313 3.20.20.30
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8809 2 313 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A2V7J309-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9606 68 189 GO:0008726
GO:0046306
AF-A0A2V6VE12-F1-model_v4 Luciferase-like domain-containing protein 0.957 1 189 GO:0008726
GO:0046306
AF-A0A382KAG6-F1-model_v4 Luciferase-like domain-containing protein 0.9529 1 182 GO:0008726
GO:0046306
AF-A0A381YWX9-F1-model_v4 Luciferase-like domain-containing protein 0.947 1 313 GO:0008726
GO:0046306
AF-A0A2E7PF21-F1-model_v4 LLM class F420-dependent oxidoreductase 0.945 1 159 GO:0016705

Map