F449236

General Info

Members Datasets Scaffolds Average Seq Length
464 261 928 131

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10007458|Ga0065715_100074582
Length 145
Sequence VAAHWILKTEPSTYSFDRLVEERKTVWDGVSNPVALRHLREMAVGDQVMIYHTGDVKAVVGLARITRAAYPDPKDPKLVVVELEAGNRLPRSVTLASIKADPAFADLALVRMGRLSVVPVKPEQWNRLMGMGQAETTGKGGAGKR

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
175 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.54
Rhizosphere 90.3
Stem 0
Stem Tuber 0
Unclassified 23.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10007458 3300005293 Bacteria 3350
2 MBSR1b_contig_3548509 2162886012 Bacteria 853
3 Ga0065704_10475819 3300005289 Unclassified 685
4 Ga0065712_10518478 3300005290 Bacteria 637
5 Ga0070683_100005070 3300005329 Bacteria 10940
6 Ga0070690_100007958 3300005330 Bacteria 6084
7 Ga0070690_100049831 3300005330 Bacteria 2671
8 Ga0068869_100040634 3300005334 Bacteria 3327
9 Ga0068869_100137455 3300005334 Unclassified 1884
10 Ga0068869_100822919 3300005334 Bacteria 799
11 Ga0070666_10130282 3300005335 Bacteria 1747
12 Ga0070666_10993763 3300005335 Bacteria 622
13 Ga0070680_100159592 3300005336 Bacteria 1894
14 Ga0070682_100087484 3300005337 Bacteria 2031
15 Ga0068868_100017386 3300005338 Bacteria 5358
16 Ga0068868_100536126 3300005338 Unclassified 1030
17 Ga0070660_100009078 3300005339 Bacteria 6980
18 Ga0070689_100156651 3300005340 Bacteria 1839
19 Ga0070689_100264814 3300005340 Bacteria 1421
20 Ga0070691_10553937 3300005341 Bacteria 672
21 Ga0070687_101318523 3300005343 Unclassified 537
22 Ga0070692_11274110 3300005345 Unclassified 526
23 Ga0070668_100003748 3300005347 Bacteria 11216
24 Ga0070675_100082833 3300005354 Bacteria 2677
25 Ga0070674_100106620 3300005356 Bacteria 2051
26 Ga0070673_100043255 3300005364 Bacteria 3479
27 Ga0070673_101388626 3300005364 Unclassified 661
28 Ga0070688_100083397 3300005365 Bacteria 2074
29 Ga0070659_100040955 3300005366 Bacteria 3620
30 Ga0070667_100018064 3300005367 Bacteria 5846
31 Ga0070667_100709094 3300005367 Unclassified 931
32 Ga0070709_10080740 3300005434 Bacteria 2121
33 Ga0070709_10508523 3300005434 Bacteria 916
34 Ga0070709_10715599 3300005434 Bacteria 780
35 Ga0070709_10726879 3300005434 Unclassified 774
36 Ga0070714_100906292 3300005435 Unclassified 856
37 Ga0070714_102422373 3300005435 Unclassified 510
38 Ga0070713_100027601 3300005436 Unclassified 4471
39 Ga0070713_100083755 3300005436 Bacteria 2727
40 Ga0070713_100132809 3300005436 Unclassified 2197
41 Ga0070713_100274139 3300005436 Unclassified 1546
42 Ga0070713_100897608 3300005436 Bacteria 852
43 Ga0070710_10008077 3300005437 Bacteria 5117
44 Ga0070710_10839347 3300005437 Bacteria 659
45 Ga0070701_10078229 3300005438 Bacteria 1784
46 Ga0070701_10240182 3300005438 Bacteria 1089
47 Ga0070711_100004286 3300005439 Bacteria 8396
48 Ga0070711_100023680 3300005439 Bacteria 3997
49 Ga0070705_100592989 3300005440 Bacteria 856
50 Ga0070700_100075818 3300005441 Bacteria 2158
51 Ga0070700_100108783 3300005441 Bacteria 1839
52 Ga0070708_100007809 3300005445 Bacteria 8573
53 Ga0070708_100009233 3300005445 Bacteria 7951
54 Ga0070708_100017595 3300005445 Bacteria 5967
55 Ga0070708_100044771 3300005445 Bacteria 3894
56 Ga0070708_100124402 3300005445 Bacteria 2382
57 Ga0070708_100269958 3300005445 Unclassified 1600
58 Ga0070708_100319889 3300005445 Unclassified 1461
59 Ga0070708_101092692 3300005445 Bacteria 747
60 Ga0070663_100020616 3300005455 Bacteria 4366
61 Ga0070663_100478969 3300005455 Unclassified 1030
62 Ga0070663_101069064 3300005455 Bacteria 704
63 Ga0070678_100928571 3300005456 Bacteria 797
64 Ga0070662_100001509 3300005457 Bacteria 14305
65 Ga0070681_10302371 3300005458 Unclassified 1509
66 Ga0070681_10354405 3300005458 Unclassified 1378
67 Ga0070681_10698045 3300005458 Bacteria 930
68 Ga0068867_100105707 3300005459 Bacteria 2155
69 Ga0068867_100404291 3300005459 Bacteria 1152
70 Ga0068867_102231991 3300005459 Bacteria 520
71 Ga0070706_100000454 3300005467 Bacteria 48917
72 Ga0070706_100006873 3300005467 Bacteria 10739
73 Ga0070707_100059118 3300005468 Bacteria 3677
74 Ga0070707_100105897 3300005468 Bacteria 2727
75 Ga0070707_100115369 3300005468 Bacteria 2606
76 Ga0070707_100140876 3300005468 Bacteria 2347
77 Ga0070707_100709016 3300005468 Bacteria 969
78 Ga0070707_100795052 3300005468 Unclassified 910
79 Ga0070698_100259533 3300005471 Bacteria 1670
80 Ga0070698_101616214 3300005471 Bacteria 600
81 Ga0070699_100006134 3300005518 Bacteria 10511
82 Ga0070699_100007475 3300005518 Bacteria 9508
83 Ga0070699_100083968 3300005518 Bacteria 2778
84 Ga0070699_100200958 3300005518 Bacteria 1772
85 Ga0070699_100367844 3300005518 Bacteria 1297
86 Ga0070699_100751607 3300005518 Bacteria 892
87 Ga0070699_100777234 3300005518 Bacteria 876
88 Ga0070679_100595804 3300005530 Bacteria 1048
89 Ga0070679_100821745 3300005530 Bacteria 872
90 Ga0070684_100009203 3300005535 Bacteria 7771
91 Ga0070697_100000411 3300005536 Bacteria 32999
92 Ga0070697_100005073 3300005536 Bacteria 10114
93 Ga0070697_100057250 3300005536 Bacteria 3172
94 Ga0070697_100309750 3300005536 Bacteria 1358
95 Ga0070697_100757696 3300005536 Unclassified 858
96 Ga0070697_101185299 3300005536 Unclassified 680
97 Ga0070697_101523692 3300005536 Bacteria 598
98 Ga0068853_100277159 3300005539 Bacteria 1545
99 Ga0070672_100243332 3300005543 Bacteria 1514
100 Ga0070672_100459146 3300005543 Bacteria 1098
101 Ga0070695_100072218 3300005545 Bacteria 2262
102 Ga0070696_100004251 3300005546 Bacteria 9551
103 Ga0070696_100181557 3300005546 Bacteria 1561
104 Ga0070696_100876306 3300005546 Bacteria 743
105 Ga0070696_101140570 3300005546 Bacteria 657
106 Ga0070693_100134586 3300005547 Bacteria 1549
107 Ga0070693_100178797 3300005547 Bacteria 1364
108 Ga0070665_100017004 3300005548 Bacteria 7292
109 Ga0070665_101495319 3300005548 Unclassified 684
110 Ga0070704_100033984 3300005549 Bacteria 3453
111 Ga0070704_100073589 3300005549 Bacteria 2490
112 Ga0070704_100106352 3300005549 Bacteria 2126
113 Ga0068855_100041603 3300005563 Bacteria 5446
114 Ga0070664_100056939 3300005564 Bacteria 3322
115 Ga0068857_100102462 3300005577 Bacteria 2569
116 Ga0068857_101963855 3300005577 Bacteria 573
117 Ga0068854_100014267 3300005578 Bacteria 5234
118 Ga0068856_100026690 3300005614 Bacteria 5632
119 Ga0068856_100604404 3300005614 Bacteria 1118
120 Ga0070702_100272995 3300005615 Bacteria 1157
121 Ga0068852_100129769 3300005616 Bacteria 2320
122 Ga0068859_100011364 3300005617 Bacteria 8956
123 Ga0068859_100084557 3300005617 Bacteria 3218
124 Ga0068864_100422891 3300005618 Bacteria 1270
125 Ga0068864_100994205 3300005618 Unclassified 832
126 Ga0068866_10603014 3300005718 Bacteria 742
127 Ga0068861_100054890 3300005719 Bacteria 3037
128 Ga0068861_100059717 3300005719 Bacteria 2921
129 Ga0068863_100054521 3300005841 Bacteria 3788
130 Ga0068863_100281249 3300005841 Bacteria 1612
131 Ga0068863_100647697 3300005841 Bacteria 1048
132 Ga0068858_100373633 3300005842 Bacteria 1367
133 Ga0068858_101117953 3300005842 Unclassified 774
134 Ga0068858_101459258 3300005842 Bacteria 674
135 Ga0068860_100063221 3300005843 Bacteria 3516
136 Ga0068860_102081067 3300005843 Bacteria 589
137 Ga0068862_100232424 3300005844 Bacteria 1673
138 Ga0068862_100399578 3300005844 Unclassified 1285
139 Ga0070717_10239912 3300006028 Bacteria 1598
140 Ga0070717_10555080 3300006028 Bacteria 1040
141 Ga0070717_10724845 3300006028 Unclassified 904
142 Ga0070716_100044660 3300006173 Bacteria 2483
143 Ga0070716_100167228 3300006173 Bacteria 1431
144 Ga0070716_100181324 3300006173 Bacteria 1383
145 Ga0070712_100001686 3300006175 Bacteria 13529
146 Ga0070712_100220227 3300006175 Bacteria 1502
147 Ga0097621_100082090 3300006237 Bacteria 2683
148 Ga0097621_100869534 3300006237 Unclassified 838
149 Ga0097621_101019060 3300006237 Unclassified 775
150 Ga0097621_101226238 3300006237 Bacteria 707
151 Ga0068871_100179388 3300006358 Bacteria 1819
152 Ga0075428_100026434 3300006844 Bacteria 6425
153 Ga0075428_100951607 3300006844 Bacteria 910
154 Ga0075431_100380418 3300006847 Bacteria 1416
155 Ga0075434_100055819 3300006871 Bacteria 3925
156 Ga0075434_100154569 3300006871 Bacteria 2314
157 Ga0075429_100189356 3300006880 Bacteria 1803
158 Ga0068865_100046769 3300006881 Bacteria 2970
159 Ga0068865_100094578 3300006881 Unclassified 2175
160 Ga0075436_100466943 3300006914 Bacteria 920
161 Ga0097620_100011364 3300006931 Bacteria 8956
162 Ga0097620_100084559 3300006931 Bacteria 3218
163 Ga0075435_100122551 3300007076 Unclassified 2170
164 Ga0075435_100772403 3300007076 Unclassified 836
165 Ga0099794_10008233 3300007265 Bacteria 4322
166 Ga0099794_10040515 3300007265 Unclassified 2215
167 Ga0099794_10220933 3300007265 Bacteria 973
168 Ga0099795_10577642 3300007788 Unclassified 533
169 Ga0105250_10128447 3300009092 Unclassified 1045
170 Ga0105250_10254663 3300009092 Bacteria 751
171 Ga0105240_10140971 3300009093 Bacteria 2882
172 Ga0105240_10833669 3300009093 Unclassified 997
173 Ga0105245_10012140 3300009098 Bacteria 7491
174 Ga0105245_10063191 3300009098 Bacteria 3342
175 Ga0105245_10283813 3300009098 Bacteria 1619
176 Ga0105245_10374714 3300009098 Unclassified 1416
177 Ga0105245_10945390 3300009098 Bacteria 905
178 Ga0105247_10380979 3300009101 Bacteria 1000
179 Ga0114129_10000442 3300009147 Bacteria 49250
180 Ga0114129_10377255 3300009147 Bacteria 1874
181 Ga0105243_10086729 3300009148 Bacteria 2568
182 Ga0105241_10058399 3300009174 Unclassified 2963
183 Ga0105241_10240394 3300009174 Bacteria 1530
184 Ga0105241_10384601 3300009174 Bacteria 1227
185 Ga0105242_10201194 3300009176 Bacteria 1769
186 Ga0105242_10336936 3300009176 Bacteria 1389
187 Ga0105242_10628194 3300009176 Bacteria 1041
188 Ga0105248_10028183 3300009177 Bacteria 6255
189 Ga0105248_10665801 3300009177 Bacteria 1174
190 Ga0105237_10206672 3300009545 Bacteria 1964
191 Ga0105237_10338639 3300009545 Unclassified 1509
192 Ga0105237_11094461 3300009545 Bacteria 804
193 Ga0105238_10223771 3300009551 Bacteria 1858
194 Ga0105249_10040299 3300009553 Bacteria 4242
195 Ga0105249_10229354 3300009553 Unclassified 1831
196 Ga0105249_10291377 3300009553 Bacteria 1634
197 Ga0105249_13300263 3300009553 Unclassified 519
198 Ga0099796_10067135 3300010159 Bacteria 1286
199 Ga0105239_10949900 3300010375 Bacteria 987
200 Ga0105239_11448205 3300010375 Bacteria 793
201 Ga0105246_10008469 3300011119 Bacteria 6321
202 Ga0157373_10101729 3300013100 Bacteria 2022
203 Ga0157373_10353229 3300013100 Bacteria 1049
204 Ga0157373_10994202 3300013100 Bacteria 626
205 Ga0157371_10039968 3300013102 Bacteria 3353
206 Ga0157370_10133796 3300013104 Bacteria 2312
207 Ga0157369_10215009 3300013105 Bacteria 2014
208 Ga0157374_10075302 3300013296 Bacteria 3190
209 Ga0157374_10114825 3300013296 Bacteria 2593
210 Ga0157374_10177626 3300013296 Bacteria 2078
211 Ga0157374_11140860 3300013296 Unclassified 800
212 Ga0157378_10079978 3300013297 Bacteria 2952
213 Ga0157378_10274533 3300013297 Bacteria 1623
214 Ga0157378_10889636 3300013297 Unclassified 921
215 Ga0157378_11084955 3300013297 Bacteria 837
216 Ga0163162_10008845 3300013306 Bacteria 9790
217 Ga0163162_10018082 3300013306 Bacteria 6899
218 Ga0163162_10093456 3300013306 Bacteria 3092
219 Ga0157372_10111008 3300013307 Unclassified 3141
220 Ga0157375_10153466 3300013308 Bacteria 2440
221 Ga0163163_10064627 3300014325 Bacteria 3630
222 Ga0163163_10122897 3300014325 Unclassified 2631
223 Ga0157380_10145448 3300014326 Bacteria 2042
224 Ga0157379_10070074 3300014968 Bacteria 3137
225 Ga0157379_10082683 3300014968 Unclassified 2877
226 Ga0157379_10557995 3300014968 Unclassified 1066
227 Ga0157379_12545188 3300014968 Unclassified 512
228 Ga0157376_10356146 3300014969 Unclassified 1402
229 Ga0206350_10288710 3300020080 Unclassified 573
230 Ga0213873_10100201 3300021358 Unclassified 832
231 Ga0213876_10152363 3300021384 Bacteria 1229
232 Ga0213875_10419104 3300021388 Bacteria 639
233 Ga0228598_1015242 3300024227 Unclassified 1518
234 Ga0207642_10012657 3300025899 Bacteria 3053
235 Ga0207680_10090245 3300025903 Bacteria 1947
236 Ga0207699_10363584 3300025906 Bacteria 1024
237 Ga0207684_10011901 3300025910 Bacteria 7584
238 Ga0207684_10023636 3300025910 Bacteria 5247
239 Ga0207684_10041049 3300025910 Bacteria 3925
240 Ga0207684_10177013 3300025910 Bacteria 1839
241 Ga0207654_10018592 3300025911 Bacteria 3650
242 Ga0207707_10132533 3300025912 Bacteria 2179
243 Ga0207695_10006799 3300025913 Bacteria 14742
244 Ga0207695_11692532 3300025913 Unclassified 513
245 Ga0207671_10983986 3300025914 Unclassified 665
246 Ga0207693_10000214 3300025915 Bacteria 53256
247 Ga0207693_10152351 3300025915 Bacteria 1819
248 Ga0207663_10003886 3300025916 Bacteria 7381
249 Ga0207663_11087073 3300025916 Bacteria 643
250 Ga0207663_11088136 3300025916 Unclassified 642
251 Ga0207663_11457340 3300025916 Unclassified 551
252 Ga0207660_10030728 3300025917 Bacteria 3693
253 Ga0207657_10045264 3300025919 Bacteria 3864
254 Ga0207649_10295847 3300025920 Bacteria 1182
255 Ga0207652_10200819 3300025921 Bacteria 1794
256 Ga0207652_10654686 3300025921 Bacteria 939
257 Ga0207646_10067330 3300025922 Bacteria 3197
258 Ga0207646_10095416 3300025922 Bacteria 2664
259 Ga0207646_10394606 3300025922 Bacteria 1250
260 Ga0207646_10922036 3300025922 Bacteria 774
261 Ga0207681_10463961 3300025923 Unclassified 1032
262 Ga0207694_10085099 3300025924 Bacteria 2488
263 Ga0207659_10044079 3300025926 Bacteria 3137
264 Ga0207687_10017487 3300025927 Bacteria 4722
265 Ga0207687_11093077 3300025927 Unclassified 685
266 Ga0207687_11428828 3300025927 Unclassified 594
267 Ga0207700_10215221 3300025928 Unclassified 1626
268 Ga0207700_10577465 3300025928 Bacteria 999
269 Ga0207664_10240436 3300025929 Unclassified 1577
270 Ga0207690_10105772 3300025932 Bacteria 2018
271 Ga0207706_10000868 3300025933 Bacteria 31136
272 Ga0207706_11023690 3300025933 Unclassified 693
273 Ga0207686_10197205 3300025934 Bacteria 1439
274 Ga0207709_10225282 3300025935 Bacteria 1355
275 Ga0207670_10042752 3300025936 Bacteria 2988
276 Ga0207670_10216397 3300025936 Unclassified 1464
277 Ga0207669_10285403 3300025937 Bacteria 1247
278 Ga0207704_10188724 3300025938 Bacteria 1497
279 Ga0207665_10062810 3300025939 Bacteria 2521
280 Ga0207665_10322899 3300025939 Bacteria 1159
281 Ga0207691_10017285 3300025940 Bacteria 6840
282 Ga0207691_10097660 3300025940 Bacteria 2625
283 Ga0207711_10022747 3300025941 Bacteria 5243
284 Ga0207711_10178725 3300025941 Unclassified 1929
285 Ga0207711_10943772 3300025941 Bacteria 801
286 Ga0207689_10087416 3300025942 Bacteria 2561
287 Ga0207689_10153481 3300025942 Unclassified 1898
288 Ga0207661_10034518 3300025944 Bacteria 3935
289 Ga0207679_10090319 3300025945 Bacteria 2367
290 Ga0207667_10168645 3300025949 Bacteria 2250
291 Ga0207651_11386734 3300025960 Unclassified 632
292 Ga0207712_10004079 3300025961 Bacteria 9214
293 Ga0207712_10552805 3300025961 Bacteria 990
294 Ga0207668_10131406 3300025972 Unclassified 1912
295 Ga0207658_10108859 3300025986 Bacteria 2186
296 Ga0207658_10337081 3300025986 Unclassified 1310
297 Ga0207677_10159329 3300026023 Bacteria 1751
298 Ga0207703_10439193 3300026035 Unclassified 1217
299 Ga0207703_10636425 3300026035 Bacteria 1011
300 Ga0207678_10002447 3300026067 Bacteria 16873
301 Ga0207678_10528856 3300026067 Unclassified 1030
302 Ga0207678_10961075 3300026067 Bacteria 756
303 Ga0207708_10070293 3300026075 Unclassified 2680
304 Ga0207702_10232634 3300026078 Bacteria 1723
305 Ga0207702_12002826 3300026078 Unclassified 570
306 Ga0207641_10016855 3300026088 Bacteria 5983
307 Ga0207648_10031250 3300026089 Bacteria 4708
308 Ga0207648_11222856 3300026089 Bacteria 706
309 Ga0207676_10084308 3300026095 Unclassified 2590
310 Ga0207676_10402935 3300026095 Bacteria 1279
311 Ga0207676_10903807 3300026095 Unclassified 866
312 Ga0207674_10065637 3300026116 Bacteria 3657
313 Ga0207675_100253732 3300026118 Bacteria 1703
314 Ga0207683_10266968 3300026121 Bacteria 1563
315 Ga0207698_10050520 3300026142 Bacteria 3172
316 Ga0207698_11317065 3300026142 Bacteria 737
317 Ga0209179_1036940 3300027512 Unclassified 1019
318 Ga0265356_1019011 3300028017 Unclassified 743
319 Ga0268266_10177638 3300028379 Bacteria 1936
320 Ga0268266_11290691 3300028379 Unclassified 705
321 Ga0268265_10712888 3300028380 Bacteria 970
322 Ga0268264_11593795 3300028381 Bacteria 663
323 Ga0268264_11679514 3300028381 Unclassified 646
324 Ga0265338_10017171 3300028800 Bacteria 7819
325 Ga0265338_10017868 3300028800 Bacteria 7620
326 Ga0265762_1000032 3300030760 Bacteria 15937
327 Ga0265760_10005055 3300031090 Unclassified 3775
328 Ga0265330_10238673 3300031235 Unclassified 766
329 Ga0265330_10517738 3300031235 Unclassified 508
330 Ga0265328_10036154 3300031239 Bacteria 1825
331 Ga0265328_10404892 3300031239 Unclassified 536
332 Ga0265325_10004545 3300031241 Bacteria 8744
333 Ga0265325_10011506 3300031241 Bacteria 5082
334 Ga0265325_10014940 3300031241 Bacteria 4377
335 Ga0265340_10002683 3300031247 Bacteria 10120
336 Ga0265340_10005877 3300031247 Bacteria 6787
337 Ga0265339_10266254 3300031249 Bacteria 825
338 Ga0265331_10025254 3300031250 Bacteria 3001
339 Ga0265327_10365412 3300031251 Unclassified 629
340 Ga0265327_10503299 3300031251 Unclassified 522
341 Ga0265316_10278779 3300031344 Bacteria 1222
342 Ga0265316_10910164 3300031344 Unclassified 614
343 Ga0265313_10009551 3300031595 Bacteria 6279
344 Ga0265313_10100719 3300031595 Bacteria 1283
345 Ga0307406_10121206 3300031901 Unclassified 1819
346 Ga0307412_10353856 3300031911 Bacteria 1180
347 Ga0307416_100873286 3300032002 Bacteria 998
348 Ga0307411_10370362 3300032005 Bacteria 1175
349 Ga0373928_0036074 3300035084 Unclassified 1117
350 Ga0373934_0032123 3300035086 Bacteria 2058
351 Ga0373940_0054436 3300035088 Bacteria 1131
352 Ga0373940_0141081 3300035088 Bacteria 762
353 Ga0373949_0019961 3300035090 Bacteria 1531
354 Ga0373932_0096868 3300035112 Unclassified 955
355 Ga0373939_0051562 3300035114 Unclassified 1280
356 Ga0373954_0043606 3300035118 Bacteria 2092
357 Ga0373956_0019159 3300035119 Bacteria 2901
358 Ga0373960_0109191 3300035121 Bacteria 906
359 Ga0373955_0471894 3300035172 Unclassified 765
360 Ga0373962_0072135 3300035242 Bacteria 1034
361 Ga0373931_0022478 3300035691 Bacteria 3175
362 Ga0373931_0039613 3300035691 Bacteria 2469
363 Ga0373931_0261801 3300035691 Bacteria 1055
364 Ga0373931_0288740 3300035691 Bacteria 1009
365 Ga0373931_0818649 3300035691 Bacteria 622
366 Ga0373933_0000134 3300035724 Bacteria 47187
367 Ga0373937_0000076 3300036401 Bacteria 89708
368 Ga0373937_1144744 3300036401 Unclassified 727
369 Ga0436364_1139901 3300037853 Unclassified 706
370 Ga0436364_1385332 3300037853 Bacteria 28665
371 Ga0436364_1563724 3300037853 Bacteria 663
372 Ga0395901_0588647 3300038443 Unclassified 1123
373 Ga0242420_004276 3300038996 Bacteria 2152
374 Ga0436365_1481982 3300039437 Bacteria 2101
375 Ga0436365_1683735 3300039437 Unclassified 916
376 Ga0436363_0079187 3300039450 Unclassified 515
377 Ga0436363_0353593 3300039450 Bacteria 1320
378 Ga0436363_1293518 3300039450 Unclassified 711
379 Ga0436362_0898951 3300039453 Bacteria 3990
380 Ga0451577_0456050 3300042876 Bacteria 1161
381 Ga0453683_0015498 3300044673 Bacteria 4936
382 Ga0453683_0047520 3300044673 Bacteria 2691
383 Ga0453683_0113974 3300044673 Bacteria 1701
384 Ga0453683_0139994 3300044673 Bacteria 1526
385 Ga0466963_0378098 3300044694 Bacteria 998
386 Ga0453684_0919986 3300044712 Unclassified 935
387 Ga0453684_1103703 3300044712 Bacteria 838
388 Ga0453684_2419214 3300044712 Unclassified 520
389 Ga0451576_0000637 3300045051 Bacteria 72776
390 Ga0451576_0781715 3300045051 Bacteria 1003
391 Ga0466958_0320653 3300045836 Unclassified 996
392 Ga0466967_1464199 3300045976 Unclassified 680
393 Ga0495592_0945483 3300046454 Bacteria 504
394 Ga0495651_0019548 3300046462 Bacteria 5253
395 Ga0495653_0161154 3300046463 Bacteria 1557
396 Ga0495580_0469118 3300046472 Bacteria 843
397 Ga0495608_0074737 3300046511 Bacteria 2209
398 Ga0495652_0005394 3300046529 Bacteria 12047
399 Ga0495587_0000066 3300046536 Bacteria 87398
400 Ga0495635_0843431 3300046663 Unclassified 589
401 Ga0495623_0015560 3300046679 Bacteria 4920
402 Ga0495604_0144944 3300047317 Unclassified 1693
403 Ga0495675_0000270 3300047444 Bacteria 37560
404 Ga0495684_0391878 3300047471 Unclassified 977
405 Ga0495602_0000576 3300048088 Bacteria 34173
406 Ga0496100_0172694 3300048903 Bacteria 1558
407 Ga0496100_0285814 3300048903 Bacteria 1231
408 Ga0496101_0018325 3300048904 Bacteria 4759
409 Ga0496101_0569952 3300048904 Bacteria 895
410 Ga0496101_1539300 3300048904 Unclassified 517
411 Ga0496102_0000650 3300048905 Bacteria 35051
412 Ga0496102_0000898 3300048905 Bacteria 28227
413 Ga0496102_0232614 3300048905 Bacteria 1737
414 Ga0496102_0367354 3300048905 Bacteria 1354
415 Ga0496102_0520562 3300048905 Unclassified 1112
416 Ga0496103_0006317 3300048906 Bacteria 7084
417 Ga0496103_0050175 3300048906 Bacteria 2581
418 Ga0496103_0437010 3300048906 Unclassified 840
419 Ga0496104_0063742 3300048907 Bacteria 3496
420 Ga0496104_0089236 3300048907 Bacteria 2945
421 Ga0496104_0296881 3300048907 Bacteria 1528
422 Ga0496104_1598087 3300048907 Unclassified 555
423 Ga0496105_0574785 3300048908 Bacteria 877
424 Ga0496106_0209767 3300048909 Bacteria 1551
425 Ga0496106_0245732 3300048909 Bacteria 1430
426 Ga0496107_0071404 3300048910 Bacteria 2523
427 Ga0496107_0712781 3300048910 Bacteria 738
428 Ga0496108_0002462 3300048911 Bacteria 14820
429 Ga0496108_0293257 3300048911 Bacteria 1416
430 Ga0496108_1551416 3300048911 Unclassified 549
431 Ga0496109_0000241 3300048912 Bacteria 53091
432 Ga0496109_0199721 3300048912 Bacteria 1880
433 Ga0496109_0348447 3300048912 Bacteria 1399
434 Ga0496110_0010851 3300048913 Bacteria 7430
435 Ga0496111_0008046 3300048914 Bacteria 6957
436 Ga0496112_0086708 3300048915 Bacteria 3097
437 Ga0496112_0326861 3300048915 Bacteria 1477
438 Ga0496113_0005424 3300048916 Bacteria 7950
439 Ga0496113_0742297 3300048916 Bacteria 782
440 Ga0496115_0181684 3300048918 Bacteria 1739
441 Ga0501299_087439 3300049522 Bacteria 703
442 Ga0501034_0015274 3300049571 Bacteria 7891
443 Ga0501067_0001322 3300049583 Bacteria 13425
444 Ga0501068_0001210 3300049584 Bacteria 13718
445 Ga0501069_0001423 3300049585 Bacteria 11736
446 Ga0501070_0004431 3300049586 Bacteria 12061
447 Ga0501071_0000205 3300049587 Bacteria 26898
448 Ga0501072_0002860 3300049588 Bacteria 12970
449 Ga0501073_0175169 3300049589 Bacteria 1484
450 Ga0501074_0000077 3300049590 Bacteria 47623
451 Ga0501076_0119904 3300049592 Bacteria 2130
452 Ga0501080_0004095 3300049742 Bacteria 12921
453 Ga0501083_0000477 3300049744 Bacteria 25720
454 Ga0501083_0367764 3300049744 Bacteria 935
455 Ga0501083_0485606 3300049744 Bacteria 804
456 nmdc:mga05p37_114128_c1 3300050507 Bacteria 3321
457 nmdc:mga06r32_532596_c1 3300050510 Unclassified 1150
458 nmdc:mga0n895_155801_c1 3300050512 Bacteria 2315
459 nmdc:mga0n895_89168_c1 3300050512 Bacteria 3085
460 nmdc:mga08x19_50122_c1 3300050514 Bacteria 2678
461 nmdc:mga0a205_400279_c1 3300050515 Bacteria 1237
462 Ga0501084_0006240 3300054114 Bacteria 9802
463 Ga0501084_1125925 3300054114 Unclassified 659
464 Ga0501082_0003975 3300060353 Bacteria 12909
465 Ga0065715_10007458
466 MBSR1b_contig_3548509
467 Ga0065704_10475819
468 Ga0065712_10518478
469 Ga0070683_100005070
470 Ga0070690_100007958
471 Ga0070690_100049831
472 Ga0068869_100040634
473 Ga0068869_100137455
474 Ga0068869_100822919
475 Ga0070666_10130282
476 Ga0070666_10993763
477 Ga0070680_100159592
478 Ga0070682_100087484
479 Ga0068868_100017386
480 Ga0068868_100536126
481 Ga0070660_100009078
482 Ga0070689_100156651
483 Ga0070689_100264814
484 Ga0070691_10553937
485 Ga0070687_101318523
486 Ga0070692_11274110
487 Ga0070668_100003748
488 Ga0070675_100082833
489 Ga0070674_100106620
490 Ga0070673_100043255
491 Ga0070673_101388626
492 Ga0070688_100083397
493 Ga0070659_100040955
494 Ga0070667_100018064
495 Ga0070667_100709094
496 Ga0070709_10080740
497 Ga0070709_10508523
498 Ga0070709_10715599
499 Ga0070709_10726879
500 Ga0070714_100906292
501 Ga0070714_102422373
502 Ga0070713_100027601
503 Ga0070713_100083755
504 Ga0070713_100132809
505 Ga0070713_100274139
506 Ga0070713_100897608
507 Ga0070710_10008077
508 Ga0070710_10839347
509 Ga0070701_10078229
510 Ga0070701_10240182
511 Ga0070711_100004286
512 Ga0070711_100023680
513 Ga0070705_100592989
514 Ga0070700_100075818
515 Ga0070700_100108783
516 Ga0070708_100007809
517 Ga0070708_100009233
518 Ga0070708_100017595
519 Ga0070708_100044771
520 Ga0070708_100124402
521 Ga0070708_100269958
522 Ga0070708_100319889
523 Ga0070708_101092692
524 Ga0070663_100020616
525 Ga0070663_100478969
526 Ga0070663_101069064
527 Ga0070678_100928571
528 Ga0070662_100001509
529 Ga0070681_10302371
530 Ga0070681_10354405
531 Ga0070681_10698045
532 Ga0068867_100105707
533 Ga0068867_100404291
534 Ga0068867_102231991
535 Ga0070706_100000454
536 Ga0070706_100006873
537 Ga0070707_100059118
538 Ga0070707_100105897
539 Ga0070707_100115369
540 Ga0070707_100140876
541 Ga0070707_100709016
542 Ga0070707_100795052
543 Ga0070698_100259533
544 Ga0070698_101616214
545 Ga0070699_100006134
546 Ga0070699_100007475
547 Ga0070699_100083968
548 Ga0070699_100200958
549 Ga0070699_100367844
550 Ga0070699_100751607
551 Ga0070699_100777234
552 Ga0070679_100595804
553 Ga0070679_100821745
554 Ga0070684_100009203
555 Ga0070697_100000411
556 Ga0070697_100005073
557 Ga0070697_100057250
558 Ga0070697_100309750
559 Ga0070697_100757696
560 Ga0070697_101185299
561 Ga0070697_101523692
562 Ga0068853_100277159
563 Ga0070672_100243332
564 Ga0070672_100459146
565 Ga0070695_100072218
566 Ga0070696_100004251
567 Ga0070696_100181557
568 Ga0070696_100876306
569 Ga0070696_101140570
570 Ga0070693_100134586
571 Ga0070693_100178797
572 Ga0070665_100017004
573 Ga0070665_101495319
574 Ga0070704_100033984
575 Ga0070704_100073589
576 Ga0070704_100106352
577 Ga0068855_100041603
578 Ga0070664_100056939
579 Ga0068857_100102462
580 Ga0068857_101963855
581 Ga0068854_100014267
582 Ga0068856_100026690
583 Ga0068856_100604404
584 Ga0070702_100272995
585 Ga0068852_100129769
586 Ga0068859_100011364
587 Ga0068859_100084557
588 Ga0068864_100422891
589 Ga0068864_100994205
590 Ga0068866_10603014
591 Ga0068861_100054890
592 Ga0068861_100059717
593 Ga0068863_100054521
594 Ga0068863_100281249
595 Ga0068863_100647697
596 Ga0068858_100373633
597 Ga0068858_101117953
598 Ga0068858_101459258
599 Ga0068860_100063221
600 Ga0068860_102081067
601 Ga0068862_100232424
602 Ga0068862_100399578
603 Ga0070717_10239912
604 Ga0070717_10555080
605 Ga0070717_10724845
606 Ga0070716_100044660
607 Ga0070716_100167228
608 Ga0070716_100181324
609 Ga0070712_100001686
610 Ga0070712_100220227
611 Ga0097621_100082090
612 Ga0097621_100869534
613 Ga0097621_101019060
614 Ga0097621_101226238
615 Ga0068871_100179388
616 Ga0075428_100026434
617 Ga0075428_100951607
618 Ga0075431_100380418
619 Ga0075434_100055819
620 Ga0075434_100154569
621 Ga0075429_100189356
622 Ga0068865_100046769
623 Ga0068865_100094578
624 Ga0075436_100466943
625 Ga0097620_100011364
626 Ga0097620_100084559
627 Ga0075435_100122551
628 Ga0075435_100772403
629 Ga0099794_10008233
630 Ga0099794_10040515
631 Ga0099794_10220933
632 Ga0099795_10577642
633 Ga0105250_10128447
634 Ga0105250_10254663
635 Ga0105240_10140971
636 Ga0105240_10833669
637 Ga0105245_10012140
638 Ga0105245_10063191
639 Ga0105245_10283813
640 Ga0105245_10374714
641 Ga0105245_10945390
642 Ga0105247_10380979
643 Ga0114129_10000442
644 Ga0114129_10377255
645 Ga0105243_10086729
646 Ga0105241_10058399
647 Ga0105241_10240394
648 Ga0105241_10384601
649 Ga0105242_10201194
650 Ga0105242_10336936
651 Ga0105242_10628194
652 Ga0105248_10028183
653 Ga0105248_10665801
654 Ga0105237_10206672
655 Ga0105237_10338639
656 Ga0105237_11094461
657 Ga0105238_10223771
658 Ga0105249_10040299
659 Ga0105249_10229354
660 Ga0105249_10291377
661 Ga0105249_13300263
662 Ga0099796_10067135
663 Ga0105239_10949900
664 Ga0105239_11448205
665 Ga0105246_10008469
666 Ga0157373_10101729
667 Ga0157373_10353229
668 Ga0157373_10994202
669 Ga0157371_10039968
670 Ga0157370_10133796
671 Ga0157369_10215009
672 Ga0157374_10075302
673 Ga0157374_10114825
674 Ga0157374_10177626
675 Ga0157374_11140860
676 Ga0157378_10079978
677 Ga0157378_10274533
678 Ga0157378_10889636
679 Ga0157378_11084955
680 Ga0163162_10008845
681 Ga0163162_10018082
682 Ga0163162_10093456
683 Ga0157372_10111008
684 Ga0157375_10153466
685 Ga0163163_10064627
686 Ga0163163_10122897
687 Ga0157380_10145448
688 Ga0157379_10070074
689 Ga0157379_10082683
690 Ga0157379_10557995
691 Ga0157379_12545188
692 Ga0157376_10356146
693 Ga0206350_10288710
694 Ga0213873_10100201
695 Ga0213876_10152363
696 Ga0213875_10419104
697 Ga0228598_1015242
698 Ga0207642_10012657
699 Ga0207680_10090245
700 Ga0207699_10363584
701 Ga0207684_10011901
702 Ga0207684_10023636
703 Ga0207684_10041049
704 Ga0207684_10177013
705 Ga0207654_10018592
706 Ga0207707_10132533
707 Ga0207695_10006799
708 Ga0207695_11692532
709 Ga0207671_10983986
710 Ga0207693_10000214
711 Ga0207693_10152351
712 Ga0207663_10003886
713 Ga0207663_11087073
714 Ga0207663_11088136
715 Ga0207663_11457340
716 Ga0207660_10030728
717 Ga0207657_10045264
718 Ga0207649_10295847
719 Ga0207652_10200819
720 Ga0207652_10654686
721 Ga0207646_10067330
722 Ga0207646_10095416
723 Ga0207646_10394606
724 Ga0207646_10922036
725 Ga0207681_10463961
726 Ga0207694_10085099
727 Ga0207659_10044079
728 Ga0207687_10017487
729 Ga0207687_11093077
730 Ga0207687_11428828
731 Ga0207700_10215221
732 Ga0207700_10577465
733 Ga0207664_10240436
734 Ga0207690_10105772
735 Ga0207706_10000868
736 Ga0207706_11023690
737 Ga0207686_10197205
738 Ga0207709_10225282
739 Ga0207670_10042752
740 Ga0207670_10216397
741 Ga0207669_10285403
742 Ga0207704_10188724
743 Ga0207665_10062810
744 Ga0207665_10322899
745 Ga0207691_10017285
746 Ga0207691_10097660
747 Ga0207711_10022747
748 Ga0207711_10178725
749 Ga0207711_10943772
750 Ga0207689_10087416
751 Ga0207689_10153481
752 Ga0207661_10034518
753 Ga0207679_10090319
754 Ga0207667_10168645
755 Ga0207651_11386734
756 Ga0207712_10004079
757 Ga0207712_10552805
758 Ga0207668_10131406
759 Ga0207658_10108859
760 Ga0207658_10337081
761 Ga0207677_10159329
762 Ga0207703_10439193
763 Ga0207703_10636425
764 Ga0207678_10002447
765 Ga0207678_10528856
766 Ga0207678_10961075
767 Ga0207708_10070293
768 Ga0207702_10232634
769 Ga0207702_12002826
770 Ga0207641_10016855
771 Ga0207648_10031250
772 Ga0207648_11222856
773 Ga0207676_10084308
774 Ga0207676_10402935
775 Ga0207676_10903807
776 Ga0207674_10065637
777 Ga0207675_100253732
778 Ga0207683_10266968
779 Ga0207698_10050520
780 Ga0207698_11317065
781 Ga0209179_1036940
782 Ga0265356_1019011
783 Ga0268266_10177638
784 Ga0268266_11290691
785 Ga0268265_10712888
786 Ga0268264_11593795
787 Ga0268264_11679514
788 Ga0265338_10017171
789 Ga0265338_10017868
790 Ga0265762_1000032
791 Ga0265760_10005055
792 Ga0265330_10238673
793 Ga0265330_10517738
794 Ga0265328_10036154
795 Ga0265328_10404892
796 Ga0265325_10004545
797 Ga0265325_10011506
798 Ga0265325_10014940
799 Ga0265340_10002683
800 Ga0265340_10005877
801 Ga0265339_10266254
802 Ga0265331_10025254
803 Ga0265327_10365412
804 Ga0265327_10503299
805 Ga0265316_10278779
806 Ga0265316_10910164
807 Ga0265313_10009551
808 Ga0265313_10100719
809 Ga0307406_10121206
810 Ga0307412_10353856
811 Ga0307416_100873286
812 Ga0307411_10370362
813 Ga0373928_0036074
814 Ga0373934_0032123
815 Ga0373940_0054436
816 Ga0373940_0141081
817 Ga0373949_0019961
818 Ga0373932_0096868
819 Ga0373939_0051562
820 Ga0373954_0043606
821 Ga0373956_0019159
822 Ga0373960_0109191
823 Ga0373955_0471894
824 Ga0373962_0072135
825 Ga0373931_0022478
826 Ga0373931_0039613
827 Ga0373931_0261801
828 Ga0373931_0288740
829 Ga0373931_0818649
830 Ga0373933_0000134
831 Ga0373937_0000076
832 Ga0373937_1144744
833 Ga0436364_1139901
834 Ga0436364_1385332
835 Ga0436364_1563724
836 Ga0395901_0588647
837 Ga0242420_004276
838 Ga0436365_1481982
839 Ga0436365_1683735
840 Ga0436363_0079187
841 Ga0436363_0353593
842 Ga0436363_1293518
843 Ga0436362_0898951
844 Ga0451577_0456050
845 Ga0453683_0015498
846 Ga0453683_0047520
847 Ga0453683_0113974
848 Ga0453683_0139994
849 Ga0466963_0378098
850 Ga0453684_0919986
851 Ga0453684_1103703
852 Ga0453684_2419214
853 Ga0451576_0000637
854 Ga0451576_0781715
855 Ga0466958_0320653
856 Ga0466967_1464199
857 Ga0495592_0945483
858 Ga0495651_0019548
859 Ga0495653_0161154
860 Ga0495580_0469118
861 Ga0495608_0074737
862 Ga0495652_0005394
863 Ga0495587_0000066
864 Ga0495635_0843431
865 Ga0495623_0015560
866 Ga0495604_0144944
867 Ga0495675_0000270
868 Ga0495684_0391878
869 Ga0495602_0000576
870 Ga0496100_0172694
871 Ga0496100_0285814
872 Ga0496101_0018325
873 Ga0496101_0569952
874 Ga0496101_1539300
875 Ga0496102_0000650
876 Ga0496102_0000898
877 Ga0496102_0232614
878 Ga0496102_0367354
879 Ga0496102_0520562
880 Ga0496103_0006317
881 Ga0496103_0050175
882 Ga0496103_0437010
883 Ga0496104_0063742
884 Ga0496104_0089236
885 Ga0496104_0296881
886 Ga0496104_1598087
887 Ga0496105_0574785
888 Ga0496106_0209767
889 Ga0496106_0245732
890 Ga0496107_0071404
891 Ga0496107_0712781
892 Ga0496108_0002462
893 Ga0496108_0293257
894 Ga0496108_1551416
895 Ga0496109_0000241
896 Ga0496109_0199721
897 Ga0496109_0348447
898 Ga0496110_0010851
899 Ga0496111_0008046
900 Ga0496112_0086708
901 Ga0496112_0326861
902 Ga0496113_0005424
903 Ga0496113_0742297
904 Ga0496115_0181684
905 Ga0501299_087439
906 Ga0501034_0015274
907 Ga0501067_0001322
908 Ga0501068_0001210
909 Ga0501069_0001423
910 Ga0501070_0004431
911 Ga0501071_0000205
912 Ga0501072_0002860
913 Ga0501073_0175169
914 Ga0501074_0000077
915 Ga0501076_0119904
916 Ga0501080_0004095
917 Ga0501083_0000477
918 Ga0501083_0367764
919 Ga0501083_0485606
920 nmdc:mga05p37_114128_c1
921 nmdc:mga06r32_532596_c1
922 nmdc:mga0n895_155801_c1
923 nmdc:mga0n895_89168_c1
924 nmdc:mga08x19_50122_c1
925 nmdc:mga0a205_400279_c1
926 Ga0501084_0006240
927 Ga0501084_1125925
928 Ga0501082_0003975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

3

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9655 2 132
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9643 2 132
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.9511 3 132
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9474 3 132
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.9403 1 132
ID Description Score Start End Superfamily
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.972 1 72 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.952 2 132 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9335 3 134 3.10.590.10
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.925 3 132 3.10.590.10
3eopB00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9206 4 135 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A517XRJ8-F1-model_v4 EVE domain protein 0.9959 3 132
AF-A0A2S6TIU4-F1-model_v4 EVE domain-containing protein 0.9957 3 67
AF-A0A1Q7FG16-F1-model_v4 Ubiquinol-cytochrome C reductase 0.9956 3 133
AF-A0A3D4TA91-F1-model_v4 EVE domain-containing protein 0.9954 4 64
AF-A0A2V6EM40-F1-model_v4 EVE domain-containing protein 0.9947 1 69

Map