F449209

General Info

Members Datasets Scaffolds Average Seq Length
463 316 421 347

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2857576091|2857577537
Length 411
Sequence KLVLLLIILVVVAVLVYVGMKFIPGSSSGPTPPPTTGKNAEAKPAGNPSLTVATVLPQRVQLPISLAANGNVMAWQEAVIGSEANGLRLKEVRVNVGDTVKAGQVLAIFASETVNADVAQARAAVTEANATAADASANAKRAQTLQRTGALSEQQINQYLTTADTARARVESARATLEAQQLRLTQTRVLAPDDGVISSRTATVGSVVGVGTELFKMIRKGRLEWRAEVTSAELGRLAPGTKVKVTAPSGATLDGTVRMIAPTVDPQTRNAMVYVDLPVTADSAMPVKAGMFAHGEFVLGESSAVTVPQQAVLLRDGFSYVFQLRDRSGETGHVSQAKVQTGRRLGEQVEIIEGLAPDAQVVVRGAAFLTDGDLVRVVDEAAPAAVPGAVTSPPPAAPLSTTSPVVPGAKP

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
7 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
8 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
9 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
10 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
11 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
12 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
13 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
14 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
15 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
16 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
17 2643221585 Pelomonas sp. Root662 Isolate Unclassified
18 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
19 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
20 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
21 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
22 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
23 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
24 2643221656 Pelomonas sp. Root405 Isolate Unclassified
25 2643221660 Methylibium sp. Root1272 Isolate Unclassified
26 2738541337 Pelomonas sp. BT06 Isolate Unclassified
27 2738543013 Variovorax sp. BT01 Isolate Unclassified
28 2818991436 Collimonas arenae 515 Isolate Unclassified
29 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
30 2857564685 Duganella sp. R-74599 Isolate Unclassified
31 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
32 2885266251 Ralstonia sp. SET104 Isolate Nodule
33 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
34 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
35 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
36 2928058823 Ralstonia sp. 1138 Isolate Unclassified
37 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
38 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
39 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
42 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
43 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
46 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
47 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
48 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
49 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
50 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
51 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
52 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
53 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
59 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
64 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
201 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
205 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
206 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
207 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
219 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
220 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
221 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
222 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
223 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
224 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
225 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
226 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
227 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
228 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
229 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
270 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
286 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
291 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
292 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
293 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
301 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
302 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
303 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
304 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
305 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
306 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
307 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
310 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
311 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
312 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
313 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
316 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.28
Metatranscriptomes 0.65
Isolates 9.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.52
Nodule 0.22
Rhizoplane 5.4
Rhizosphere 65.66
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000448 3300001915 Bacteria 12506
2 JGI24740J21852_10000149 3300001979 Bacteria 27167
3 JGI24740J21852_10000159 3300001979 Bacteria 26704
4 JGI25162J39368_1000025 3300002737 Bacteria 228879
5 JGI25162J39368_1000263 3300002737 Bacteria 50433
6 JGI25152J39213_1004332 3300002773 Bacteria 4507
7 JGI25165J46597_1000054 3300003214 Bacteria 228891
8 JGI25153J46596_10000006 3300003215 Bacteria 447760
9 JGI25153J46596_10004907 3300003215 Bacteria 7110
10 rootH1_10015820 3300003316 Bacteria 9106
11 rootL2_10045667 3300003322 Bacteria 4170
12 rootL2_10166950 3300003322 Bacteria 2910
13 rootL2_10212651 3300003322 Bacteria 2251
14 Ga0055538_1000026 3300003751 Bacteria 228891
15 Ga0055538_1002449 3300003751 Bacteria 2717
16 Ga0055538_1004594 3300003751 Bacteria 1542
17 Ga0055539_1000033 3300003752 Bacteria 228891
18 Ga0055539_1000086 3300003752 Bacteria 117621
19 Ga0055533_1000044 3300003756 Bacteria 228891
20 Ga0055533_1000694 3300003756 Bacteria 11041
21 Ga0055533_1004738 3300003756 Bacteria 2364
22 Ga0055532_1000041 3300003758 Bacteria 195749
23 Ga0055525_1000052 3300003759 Bacteria 228891
24 Ga0055525_1000537 3300003759 Bacteria 18089
25 Ga0055535_1000030 3300003761 Bacteria 195749
26 Ga0055542_1000628 3300003762 Bacteria 29630
27 Ga0055529_1000058 3300003763 Bacteria 195735
28 Ga0055526_1000475 3300003771 Bacteria 31936
29 Ga0055534_1000581 3300003784 Bacteria 19193
30 Ga0055531_10000007 3300003794 Bacteria 225289
31 Ga0055541_1000069 3300003841 Bacteria 94648
32 Ga0055541_1001179 3300003841 Bacteria 5832
33 Ga0055541_1009313 3300003841 Bacteria 1524
34 Ga0065165_1000863 3300005262 Bacteria 39623
35 Ga0070676_10079234 3300005328 Bacteria 1989
36 Ga0070683_100040450 3300005329 Bacteria 4287
37 Ga0070683_100042386 3300005329 Bacteria 4191
38 Ga0070683_100049742 3300005329 Bacteria 3878
39 Ga0070670_100010447 3300005331 Bacteria 7922
40 Ga0070677_10002086 3300005333 Bacteria 6368
41 Ga0068869_100000109 3300005334 Bacteria 39248
42 Ga0070666_10043113 3300005335 Bacteria 3020
43 Ga0070666_10079575 3300005335 Bacteria 2238
44 Ga0070682_100010460 3300005337 Bacteria 5266
45 Ga0070682_100075994 3300005337 Bacteria 2161
46 Ga0068868_100000895 3300005338 Bacteria 20275
47 Ga0068868_100035945 3300005338 Bacteria 3831
48 Ga0070660_100005137 3300005339 Bacteria 9047
49 Ga0070660_100108469 3300005339 Bacteria 2207
50 Ga0070661_100000072 3300005344 Bacteria 82584
51 Ga0070661_100011993 3300005344 Bacteria 6055
52 Ga0070661_100065151 3300005344 Bacteria 2677
53 Ga0070661_100103835 3300005344 Bacteria 2117
54 Ga0070668_100029724 3300005347 Bacteria 4152
55 Ga0070668_100088128 3300005347 Bacteria 2443
56 Ga0070669_100017130 3300005353 Bacteria 5170
57 Ga0070669_100022290 3300005353 Bacteria 4530
58 Ga0070675_100000621 3300005354 Bacteria 24557
59 Ga0070675_100010564 3300005354 Bacteria 7216
60 Ga0070671_100044570 3300005355 Bacteria 3686
61 Ga0070671_100062233 3300005355 Bacteria 3108
62 Ga0070674_100113799 3300005356 Unclassified 1991
63 Ga0070673_100023166 3300005364 Bacteria 4534
64 Ga0070688_100039243 3300005365 Bacteria 2897
65 Ga0070659_100017393 3300005366 Bacteria 5409
66 Ga0070659_100295927 3300005366 Bacteria 1348
67 Ga0070667_100004338 3300005367 Bacteria 11962
68 Ga0070663_100000015 3300005455 Bacteria 131905
69 Ga0070663_100003719 3300005455 Bacteria 8843
70 Ga0070662_100001965 3300005457 Bacteria 12626
71 Ga0068867_100001189 3300005459 Bacteria 17854
72 Ga0070685_10020898 3300005466 Bacteria 3549
73 Ga0070679_100009359 3300005530 Bacteria 9265
74 Ga0070684_100055993 3300005535 Bacteria 3439
75 Ga0070684_100070918 3300005535 Bacteria 3067
76 Ga0068853_100006482 3300005539 Bacteria 9309
77 Ga0070672_100000163 3300005543 Bacteria 36844
78 Ga0070672_100008125 3300005543 Bacteria 7172
79 Ga0070672_100105021 3300005543 Bacteria 2296
80 Ga0070693_100070363 3300005547 Bacteria 2059
81 Ga0070693_100079681 3300005547 Bacteria 1949
82 Ga0070665_100034040 3300005548 Bacteria 5123
83 Ga0070664_100000058 3300005564 Bacteria 67966
84 Ga0070664_100012851 3300005564 Bacteria 6811
85 Ga0070664_100014025 3300005564 Bacteria 6536
86 Ga0068857_100029891 3300005577 Bacteria 4808
87 Ga0068857_100103925 3300005577 Bacteria 2550
88 Ga0068854_100000025 3300005578 Bacteria 123547
89 Ga0068854_100020625 3300005578 Bacteria 4464
90 Ga0068856_100000084 3300005614 Bacteria 87749
91 Ga0068856_100029175 3300005614 Bacteria 5389
92 Ga0068856_100166708 3300005614 Bacteria 2214
93 Ga0068856_100206696 3300005614 Bacteria 1978
94 Ga0068852_100003094 3300005616 Bacteria 11584
95 Ga0068852_100016740 3300005616 Bacteria 5729
96 Ga0068852_100053997 3300005616 Bacteria 3461
97 Ga0068852_100063852 3300005616 Bacteria 3207
98 Ga0068852_100160114 3300005616 Bacteria 2101
99 Ga0068859_100010952 3300005617 Bacteria 9127
100 Ga0068859_100049787 3300005617 Bacteria 4208
101 Ga0068864_100004021 3300005618 Bacteria 12083
102 Ga0068864_100020937 3300005618 Bacteria 5474
103 Ga0068861_100000126 3300005719 Bacteria 39277
104 Ga0068863_100012220 3300005841 Bacteria 8291
105 Ga0068863_100023051 3300005841 Bacteria 5950
106 Ga0068858_100010727 3300005842 Bacteria 8668
107 Ga0068858_100150840 3300005842 Bacteria 2186
108 Ga0068860_100076801 3300005843 Bacteria 3176
109 Ga0075366_10004679 3300006195 Bacteria 7362
110 Ga0097621_100004823 3300006237 Bacteria 9444
111 Ga0075370_10006053 3300006353 Bacteria 6061
112 Ga0075370_10091239 3300006353 Bacteria 1757
113 Ga0068871_100017048 3300006358 Bacteria 5488
114 Ga0068871_100029265 3300006358 Bacteria 4324
115 Ga0068871_100112782 3300006358 Bacteria 2289
116 Ga0075430_100204068 3300006846 Bacteria 1641
117 Ga0068865_100206653 3300006881 Bacteria 1527
118 Ga0097620_100010952 3300006931 Bacteria 9127
119 Ga0097620_100049787 3300006931 Bacteria 4208
120 Ga0105240_10218069 3300009093 Bacteria 2224
121 Ga0105240_10309461 3300009093 Bacteria 1804
122 Ga0105245_10004379 3300009098 Bacteria 12497
123 Ga0105245_10023026 3300009098 Bacteria 5466
124 Ga0105248_10446105 3300009177 Bacteria 1458
125 Ga0105237_10191789 3300009545 Bacteria 2043
126 Ga0105238_10013310 3300009551 Bacteria 8299
127 Ga0105239_10110940 3300010375 Bacteria 3040
128 Ga0157373_10061038 3300013100 Bacteria 2670
129 Ga0157373_10163496 3300013100 Bacteria 1566
130 Ga0157371_10000100 3300013102 Bacteria 131924
131 Ga0157370_10000004 3300013104 Bacteria 366426
132 Ga0157369_10000809 3300013105 Bacteria 39990
133 Ga0157369_10173407 3300013105 Bacteria 2271
134 Ga0157372_10000279 3300013307 Bacteria 56725
135 Ga0157372_10009183 3300013307 Bacteria 10510
136 Ga0157372_10025361 3300013307 Bacteria 6445
137 Ga0157375_10005134 3300013308 Bacteria 11369
138 Ga0157375_10013596 3300013308 Bacteria 7251
139 Ga0157375_10017755 3300013308 Bacteria 6432
140 Ga0157375_10022735 3300013308 Bacteria 5775
141 Ga0157375_10373457 3300013308 Bacteria 1592
142 Ga0182008_10000421 3300014497 Bacteria 32709
143 Ga0182008_10063458 3300014497 Bacteria 1819
144 Ga0157377_10001137 3300014745 Bacteria 11282
145 Ga0157379_10005980 3300014968 Bacteria 10491
146 Ga0157379_10010227 3300014968 Bacteria 8171
147 Ga0157379_10018220 3300014968 Bacteria 6188
148 Ga0157376_10006475 3300014969 Bacteria 8275
149 Ga0157376_10006935 3300014969 Bacteria 8029
150 Ga0182006_1005758 3300015261 Bacteria 5848
151 Ga0182006_1017978 3300015261 Bacteria 2993
152 Ga0182006_1021250 3300015261 Bacteria 2709
153 Ga0182007_10001289 3300015262 Bacteria 13564
154 Ga0182007_10009797 3300015262 Bacteria 3829
155 Ga0182007_10016887 3300015262 Bacteria 2681
156 Ga0182007_10025805 3300015262 Bacteria 2043
157 Ga0182005_1000995 3300015265 Bacteria 12216
158 Ga0183362_10001 3300015683 Bacteria 2046624
159 Ga0163161_10032865 3300017792 Bacteria 3706
160 Ga0209760_101443 3300025207 Bacteria 2515
161 Ga0209784_100020 3300025224 Bacteria 412353
162 Ga0209784_100029 3300025224 Bacteria 347315
163 Ga0209784_100508 3300025224 Bacteria 15150
164 Ga0209566_100020 3300025225 Bacteria 412353
165 Ga0209566_100030 3300025225 Bacteria 347329
166 Ga0209566_100277 3300025225 Bacteria 47887
167 Ga0209674_100035 3300025226 Bacteria 412353
168 Ga0209674_100081 3300025226 Bacteria 201146
169 Ga0209674_100089 3300025226 Bacteria 178751
170 Ga0209674_100123 3300025226 Bacteria 131438
171 Ga0209674_100289 3300025226 Bacteria 36645
172 Ga0209672_100247 3300025228 Bacteria 40787
173 Ga0209147_100008 3300025229 Bacteria 777096
174 Ga0209563_100038 3300025230 Bacteria 412353
175 Ga0209563_100091 3300025230 Bacteria 168320
176 Ga0209563_100092 3300025230 Bacteria 167669
177 Ga0209563_101162 3300025230 Bacteria 7390
178 Ga0209437_100066 3300025233 Bacteria 327883
179 Ga0209258_100013 3300025242 Bacteria 777096
180 Ga0207425_1012551 3300025245 Bacteria 1983
181 Ga0209646_1000065 3300025246 Bacteria 245452
182 Ga0209677_100030 3300025253 Bacteria 347314
183 Ga0209677_100031 3300025253 Bacteria 329719
184 Ga0209677_102538 3300025253 Bacteria 6754
185 Ga0209148_1000113 3300025254 Bacteria 195646
186 Ga0209148_1004805 3300025254 Bacteria 3232
187 Ga0209759_1000492 3300025256 Bacteria 43562
188 Ga0209129_1000038 3300025258 Bacteria 322778
189 Ga0209233_1000060 3300025261 Bacteria 412379
190 Ga0209455_1000106 3300025272 Bacteria 195801
191 Ga0209673_1001320 3300025273 Bacteria 24966
192 Ga0209673_1020829 3300025273 Bacteria 2309
193 Ga0209675_1006002 3300025291 Bacteria 4970
194 Ga0209676_1006611 3300025292 Bacteria 5668
195 Ga0209564_1000129 3300025295 Bacteria 195163
196 Ga0209758_1000001 3300025297 Bacteria 1981790
197 Ga0209758_1000089 3300025297 Bacteria 251523
198 Ga0209758_1000600 3300025297 Bacteria 55923
199 Ga0209050_1002913 3300025298 Bacteria 13434
200 Ga0209050_1014738 3300025298 Bacteria 3340
201 Ga0209051_1003740 3300025303 Bacteria 9783
202 Ga0209257_1000021 3300025304 Bacteria 771986
203 Ga0209257_1006298 3300025304 Bacteria 7744
204 Ga0209257_1021236 3300025304 Bacteria 2368
205 Ga0207697_10008487 3300025315 Bacteria 4490
206 Ga0207682_10003347 3300025893 Bacteria 6991
207 Ga0207688_10042533 3300025901 Bacteria 2529
208 Ga0207680_10118030 3300025903 Bacteria 1731
209 Ga0207643_10024010 3300025908 Bacteria 3364
210 Ga0207695_10000535 3300025913 Bacteria 79187
211 Ga0207671_10194597 3300025914 Bacteria 1582
212 Ga0207662_10099781 3300025918 Bacteria 1798
213 Ga0207657_10008286 3300025919 Bacteria 10576
214 Ga0207657_10023461 3300025919 Bacteria 5744
215 Ga0207649_10000222 3300025920 Bacteria 46190
216 Ga0207649_10007761 3300025920 Bacteria 5836
217 Ga0207649_10010503 3300025920 Bacteria 5089
218 Ga0207652_10110087 3300025921 Bacteria 2442
219 Ga0207681_10011548 3300025923 Bacteria 5426
220 Ga0207681_10075133 3300025923 Bacteria 2369
221 Ga0207694_10015923 3300025924 Bacteria 5674
222 Ga0207650_10000887 3300025925 Bacteria 22633
223 Ga0207659_10003612 3300025926 Bacteria 9317
224 Ga0207687_10011547 3300025927 Bacteria 5773
225 Ga0207644_10003968 3300025931 Bacteria 9606
226 Ga0207644_10036294 3300025931 Bacteria 3459
227 Ga0207644_10043077 3300025931 Bacteria 3202
228 Ga0207690_10003347 3300025932 Bacteria 9578
229 Ga0207690_10006695 3300025932 Bacteria 6829
230 Ga0207706_10000736 3300025933 Bacteria 34115
231 Ga0207709_10035457 3300025935 Bacteria 2949
232 Ga0207669_10018827 3300025937 Bacteria 3580
233 Ga0207691_10005598 3300025940 Bacteria 12141
234 Ga0207711_10002545 3300025941 Bacteria 16235
235 Ga0207689_10000259 3300025942 Bacteria 47474
236 Ga0207661_10042324 3300025944 Bacteria 3591
237 Ga0207679_10000038 3300025945 Bacteria 131935
238 Ga0207679_10027441 3300025945 Bacteria 3937
239 Ga0207651_10004962 3300025960 Bacteria 6785
240 Ga0207668_10030926 3300025972 Bacteria 3522
241 Ga0207640_10000096 3300025981 Bacteria 68105
242 Ga0207640_10016404 3300025981 Bacteria 4308
243 Ga0207658_10031397 3300025986 Bacteria 3771
244 Ga0207677_10004015 3300026023 Bacteria 7852
245 Ga0207677_10026152 3300026023 Bacteria 3655
246 Ga0207703_10009860 3300026035 Bacteria 7492
247 Ga0207703_10016236 3300026035 Bacteria 5803
248 Ga0207703_10109441 3300026035 Bacteria 2355
249 Ga0207639_10024668 3300026041 Bacteria 4355
250 Ga0207678_10000021 3300026067 Bacteria 131877
251 Ga0207678_10007496 3300026067 Bacteria 9645
252 Ga0207702_10000203 3300026078 Bacteria 70226
253 Ga0207702_10023380 3300026078 Bacteria 5125
254 Ga0207702_10069259 3300026078 Bacteria 3033
255 Ga0207641_10021159 3300026088 Bacteria 5347
256 Ga0207641_10030693 3300026088 Bacteria 4452
257 Ga0207641_10062488 3300026088 Bacteria 3178
258 Ga0207648_10196449 3300026089 Bacteria 1789
259 Ga0207676_10008910 3300026095 Bacteria 7139
260 Ga0207676_10011244 3300026095 Bacteria 6395
261 Ga0207674_10030619 3300026116 Bacteria 5657
262 Ga0207674_10057191 3300026116 Bacteria 3954
263 Ga0207675_100000307 3300026118 Bacteria 46857
264 Ga0207698_10010835 3300026142 Bacteria 5884
265 Ga0207698_10015293 3300026142 Bacteria 5135
266 Ga0268264_10030553 3300028381 Bacteria 4416
267 Ga0268264_10123725 3300028381 Bacteria 2283
268 Ga0307515_10016569 3300028794 Bacteria 13487
269 Ga0307515_10073001 3300028794 Bacteria 4620
270 Ga0307515_10244857 3300028794 Bacteria 1556
271 Ga0265327_10031965 3300031251 Bacteria 2952
272 Ga0265316_10007164 3300031344 Bacteria 10538
273 Ga0307513_10200053 3300031456 Bacteria 1840
274 Ga0307408_100000040 3300031548 Bacteria 175456
275 Ga0316579_10000226 3300031691 Bacteria 17150
276 Ga0316576_10016405 3300031727 Bacteria 5000
277 Ga0307413_10000647 3300031824 Bacteria 11775
278 Ga0307414_10033857 3300032004 Bacteria 3381
279 Ga0307414_10133648 3300032004 Bacteria 1930
280 Ga0316583_10035536 3300032133 Bacteria 1768
281 Ga0316585_10039642 3300032137 Bacteria 1498
282 Ga0316580_10000277 3300032139 Bacteria 11029
283 Ga0316588_1000768 3300033528 Bacteria 4774
284 Ga0316587_1002934 3300033529 Bacteria 2334
285 Ga0316596_1004783 3300033541 Bacteria 3059
286 Ga0373956_0022375 3300035119 Bacteria 2705
287 Ga0316574_0000171 3300035398 Bacteria 21585
288 Ga0373931_0049829 3300035691 Bacteria 2226
289 Ga0373933_0106271 3300035724 Unclassified 1747
290 Ga0373937_0001785 3300036401 Bacteria 18065
291 Ga0316584_0166153 3300036712 Bacteria 1638
292 Ga0395900_0032985 3300037418 Bacteria 5329
293 Ga0395900_0103357 3300037418 Bacteria 2926
294 Ga0395905_0021202 3300037471 Bacteria 6149
295 Ga0439439_0018848 3300041406 Bacteria 1708
296 Ga0439466_0018269 3300041411 Bacteria 2517
297 Ga0439465_0001136 3300041413 Bacteria 8524
298 Ga0439465_0001491 3300041413 Bacteria 7591
299 Ga0439442_005508 3300042002 Bacteria 2531
300 Ga0439432_000543 3300042006 Bacteria 14052
301 Ga0439449_0000317 3300042007 Bacteria 17464
302 Ga0439452_020629 3300042010 Bacteria 1726
303 Ga0439457_004029 3300042014 Bacteria 3897
304 Ga0450911_001703 3300042115 Bacteria 4828
305 Ga0450923_008456 3300042125 Bacteria 1773
306 Ga0450891_002786 3300042129 Bacteria 1730
307 Ga0450898_012884 3300042134 Bacteria 1387
308 Ga0439446_0000499 3300042156 Bacteria 7855
309 Ga0439434_0003962 3300042435 Bacteria 4323
310 Ga0439464_0007301 3300042439 Bacteria 2889
311 Ga0451577_0072726 3300042876 Bacteria 3068
312 Ga0451577_0211148 3300042876 Bacteria 1753
313 Ga0466986_0024952 3300044650 Bacteria 4001
314 Ga0466969_0077342 3300044656 Bacteria 1592
315 Ga0466969_0114025 3300044656 Bacteria 1263
316 Ga0466978_0028381 3300044671 Bacteria 3388
317 Ga0453683_0246639 3300044673 Bacteria 1138
318 Ga0466965_0020032 3300044683 Bacteria 3213
319 Ga0466966_0050390 3300044684 Bacteria 2649
320 Ga0466961_0000404 3300044693 Bacteria 27732
321 Ga0466964_0018176 3300044706 Bacteria 2695
322 Ga0453684_0000826 3300044712 Bacteria 104663
323 Ga0453684_0007549 3300044712 Bacteria 19936
324 Ga0453684_0067601 3300044712 Bacteria 4543
325 Ga0466968_0013647 3300044735 Bacteria 3196
326 Ga0466970_0002930 3300044765 Bacteria 8269
327 Ga0466959_0045822 3300045049 Bacteria 3219
328 Ga0451576_0021302 3300045051 Bacteria 7046
329 Ga0451576_0097165 3300045051 Bacteria 3063
330 Ga0451576_0134877 3300045051 Bacteria 2574
331 Ga0451576_0159505 3300045051 Bacteria 2353
332 Ga0451576_0218268 3300045051 Bacteria 1991
333 Ga0451576_0531546 3300045051 Bacteria 1235
334 Ga0466967_0216722 3300045976 Bacteria 1817
335 Ga0495617_001271 3300046452 Bacteria 11259
336 Ga0495603_0083705 3300046455 Bacteria 1868
337 Ga0495638_0036279 3300046460 Bacteria 3142
338 Ga0495651_0010259 3300046462 Bacteria 7194
339 Ga0495651_0027368 3300046462 Bacteria 4440
340 Ga0495653_0020739 3300046463 Bacteria 5323
341 Ga0495607_0000007 3300046501 Bacteria 272517
342 Ga0495607_0000023 3300046501 Bacteria 159908
343 Ga0495628_0010495 3300046516 Bacteria 7866
344 Ga0495628_0015237 3300046516 Bacteria 6422
345 Ga0495628_0088328 3300046516 Bacteria 2402
346 Ga0495632_0001338 3300046519 Bacteria 20700
347 Ga0495632_0007969 3300046519 Bacteria 6577
348 Ga0495643_0000007 3300046522 Bacteria 383435
349 Ga0495652_0019178 3300046529 Bacteria 6093
350 Ga0495654_0003758 3300046530 Bacteria 9193
351 Ga0495645_0067075 3300046543 Bacteria 2591
352 Ga0495634_0195265 3300046642 Bacteria 1260
353 Ga0495599_0018022 3300046678 Bacteria 4397
354 Ga0495623_0015624 3300046679 Bacteria 4907
355 Ga0495646_0024693 3300046680 Bacteria 3784
356 Ga0495600_0008801 3300046809 Bacteria 6216
357 Ga0495604_0031506 3300047317 Bacteria 4205
358 Ga0495676_0256266 3300047321 Bacteria 1192
359 Ga0495687_000242 3300047443 Bacteria 75081
360 Ga0495687_019385 3300047443 Bacteria 3341
361 Ga0495602_0024377 3300048088 Bacteria 5871
362 Ga0495615_0023418 3300048090 Bacteria 1415
363 Ga0495626_0029796 3300048091 Bacteria 2637
364 Ga0496101_0008217 3300048904 Bacteria 6815
365 Ga0496102_0000706 3300048905 Bacteria 33087
366 Ga0496106_0011434 3300048909 Bacteria 6567
367 Ga0496106_0203166 3300048909 Bacteria 1577
368 Ga0496108_0031370 3300048911 Bacteria 4410
369 Ga0496109_0024773 3300048912 Bacteria 5338
370 Ga0496109_0035237 3300048912 Bacteria 4513
371 Ga0496110_0005584 3300048913 Bacteria 9874
372 Ga0496110_0018404 3300048913 Bacteria 5858
373 Ga0496111_0031950 3300048914 Bacteria 3752
374 Ga0496112_0003117 3300048915 Bacteria 13592
375 Ga0496113_0056357 3300048916 Bacteria 2950
376 Ga0496113_0288157 3300048916 Bacteria 1313
377 Ga0496114_0001178 3300048917 Bacteria 19806
378 Ga0496114_0009654 3300048917 Bacteria 7665
379 Ga0496118_0072342 3300048921 Bacteria 2477
380 Ga0496121_0019293 3300048924 Bacteria 6824
381 Ga0496124_0014401 3300048927 Bacteria 7646
382 Ga0496125_0005647 3300048928 Bacteria 13812
383 Ga0496125_0008735 3300048928 Bacteria 10541
384 Ga0501294_001662 3300049517 Bacteria 2204
385 Ga0501300_001892 3300049523 Bacteria 3122
386 Ga0501032_0072071 3300049569 Bacteria 2302
387 Ga0501033_0000035 3300049570 Bacteria 150558
388 Ga0501034_0270585 3300049571 Bacteria 1640
389 Ga0501211_002300 3300049658 Bacteria 2030
390 Ga0501235_001717 3300049669 Bacteria 4704
391 Ga0501221_000078 3300049704 Bacteria 11020
392 Ga0501267_000061 3300049764 Bacteria 6240
393 Ga0501035_0000388 3300049822 Bacteria 50606
394 Ga0501035_0265227 3300049822 Bacteria 1455
395 Ga0501044_0157826 3300049823 Bacteria 2247
396 nmdc:mga0k408_111685_c1 3300050493 Bacteria 1615
397 nmdc:mga0k408_2643_c1 3300050493 Bacteria 9515
398 nmdc:mga07m45_56611_c1 3300050496 Bacteria 2216
399 nmdc:mga07m45_587_c2 3300050496 Bacteria 15224
400 nmdc:mga07m45_6580_c1 3300050496 Bacteria 5886
401 nmdc:mga0a205_329004_c1 3300050515 Archaea 1398
402 Ga0495601_0031288 3300053077 Bacteria 3307
403 Ga0495601_0054607 3300053077 Bacteria 2528
404 Ga0500578_0000622 3300053086 Bacteria 43056
405 Ga0500644_0028828 3300053088 Bacteria 1740
406 Ga0500646_0007026 3300053090 Bacteria 2870
407 Ga0500595_003252 3300053119 Bacteria 7669
408 Ga0500607_019200 3300053121 Bacteria 3872
409 Ga0500617_007001 3300053124 Bacteria 4474
410 Ga0500642_0018256 3300053130 Bacteria 2709
411 Ga0500652_000085 3300053131 Bacteria 39352
412 Ga0500568_0055179 3300053139 Bacteria 1551
413 Ga0500574_000787 3300053141 Bacteria 4265
414 Ga0500577_0023599 3300053142 Bacteria 2057
415 Ga0500604_0014150 3300053151 Bacteria 2170
416 Ga0500619_005672 3300053154 Bacteria 2808
417 Ga0500622_0000019 3300053156 Bacteria 275028
418 Ga0500622_0000534 3300053156 Bacteria 35246
419 Ga0500622_0003635 3300053156 Bacteria 10140
420 Ga0500645_003311 3300053730 Bacteria 6628
421 Ga0466962_0001461 3300061719 Bacteria 11036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0008735 Ga0496125_0008735_2538_3704 272
2 3300003316 rootH1_10015820 rootH1_100158203 275
3 3300031548 Ga0307408_100000040 Ga0307408_10000004073 275
4 3300025935 Ga0207709_10035457 Ga0207709_100354572 276
5 3300003794 Ga0055531_10000007 Ga0055531_1000000759 278
6 3300025298 Ga0209050_1014738 Ga0209050_10147382 278
7 3300025303 Ga0209051_1003740 Ga0209051_10037403 278
8 3300025304 Ga0209257_1000021 Ga0209257_1000021169 278
9 3300005335 Ga0070666_10043113 Ga0070666_100431133 282
10 3300005355 Ga0070671_100062233 Ga0070671_1000622332 282
11 3300005365 Ga0070688_100039243 Ga0070688_1000392433 282
12 3300005564 Ga0070664_100014025 Ga0070664_1000140253 282
13 3300005614 Ga0068856_100206696 Ga0068856_1002066962 282
14 3300005617 Ga0068859_100010952 Ga0068859_1000109527 282
15 3300006237 Ga0097621_100004823 Ga0097621_1000048232 282
16 3300006358 Ga0068871_100029265 Ga0068871_1000292652 282
17 3300006931 Ga0097620_100010952 Ga0097620_1000109527 282
18 3300009098 Ga0105245_10004379 Ga0105245_100043799 282
19 3300009177 Ga0105248_10446105 Ga0105248_104461052 282
20 3300013308 Ga0157375_10005134 Ga0157375_100051342 282
21 3300025903 Ga0207680_10118030 Ga0207680_101180302 282
22 3300025927 Ga0207687_10011547 Ga0207687_100115473 282
23 3300025931 Ga0207644_10003968 Ga0207644_100039682 282
24 3300025944 Ga0207661_10042324 Ga0207661_100423242 282
25 3300048909 Ga0496106_0203166 Ga0496106_0203166_91_1194 282
26 3300048915 Ga0496112_0003117 Ga0496112_0003117_104_1207 282
27 3300048916 Ga0496113_0056357 Ga0496113_0056357_432_1535 282
28 3300037471 Ga0395905_0021202 Ga0395905_0021202_2240_3331 283
29 3300050496 nmdc:mga07m45_587_c2 nmdc:mga07m45_587_c2_523_1617 283
30 3300048917 Ga0496114_0001178 Ga0496114_0001178_8569_9708 284
31 3300005329 Ga0070683_100040450 Ga0070683_1000404502 286
32 3300005344 Ga0070661_100103835 Ga0070661_1001038352 286
33 3300005367 Ga0070667_100004338 Ga0070667_1000043384 286
34 3300005466 Ga0070685_10020898 Ga0070685_100208982 286
35 3300005535 Ga0070684_100070918 Ga0070684_1000709182 286
36 3300005547 Ga0070693_100070363 Ga0070693_1000703632 286
37 3300005548 Ga0070665_100034040 Ga0070665_1000340402 286
38 3300005616 Ga0068852_100160114 Ga0068852_1001601142 286
39 3300005841 Ga0068863_100023051 Ga0068863_1000230513 286
40 3300014968 Ga0157379_10010227 Ga0157379_100102274 286
41 3300014969 Ga0157376_10006935 Ga0157376_100069353 286
42 3300026035 Ga0207703_10009860 Ga0207703_100098603 286
43 3300026088 Ga0207641_10030693 Ga0207641_100306932 286
44 3300026095 Ga0207676_10008910 Ga0207676_100089102 286
45 3300045051 Ga0451576_0531546 Ga0451576_0531546_100_1203 286
46 3300048916 Ga0496113_0288157 Ga0496113_0288157_132_1262 287
47 3300050493 nmdc:mga0k408_111685_c1 nmdc:mga0k408_111685_c1_25_1149 287
48 3300028794 Ga0307515_10073001 Ga0307515_100730012 288
49 3300042115 Ga0450911_001703 Ga0450911_001703_1490_2641 289
50 3300044673 Ga0453683_0246639 Ga0453683_0246639_69_1055 291
51 3300048927 Ga0496124_0014401 Ga0496124_0014401_719_1870 292
52 3300048928 Ga0496125_0005647 Ga0496125_0005647_1805_2956 292
53 3300025292 Ga0209676_1006611 Ga0209676_10066113 293
54 3300031824 Ga0307413_10000647 Ga0307413_1000064712 295
55 3300041406 Ga0439439_0018848 Ga0439439_0018848_435_1607 295
56 3300042125 Ga0450923_008456 Ga0450923_008456_585_1763 296
57 3300042134 Ga0450898_012884 Ga0450898_012884_137_1315 296
58 3300031344 Ga0265316_10007164 Ga0265316_100071642 297
59 3300042439 Ga0439464_0007301 Ga0439464_0007301_1631_2845 297
60 3300053156 Ga0500622_0000019 Ga0500622_0000019_44317_45456 298
61 3300028794 Ga0307515_10016569 Ga0307515_100165699 299
62 3300003784 Ga0055534_1000581 Ga0055534_10005813 300
63 3300005331 Ga0070670_100010447 Ga0070670_1000104473 300
64 3300005333 Ga0070677_10002086 Ga0070677_100020864 300
65 3300005338 Ga0068868_100035945 Ga0068868_1000359452 300
66 3300005347 Ga0070668_100088128 Ga0070668_1000881282 300
67 3300005353 Ga0070669_100022290 Ga0070669_1000222902 300
68 3300005354 Ga0070675_100010564 Ga0070675_1000105643 300
69 3300005364 Ga0070673_100023166 Ga0070673_1000231662 300
70 3300005459 Ga0068867_100001189 Ga0068867_10000118919 300
71 3300005543 Ga0070672_100000163 Ga0070672_10000016331 300
72 3300005618 Ga0068864_100020937 Ga0068864_1000209377 300
73 3300006358 Ga0068871_100112782 Ga0068871_1001127822 300
74 3300013308 Ga0157375_10022735 Ga0157375_100227352 300
75 3300025291 Ga0209675_1006002 Ga0209675_10060022 300
76 3300025304 Ga0209257_1006298 Ga0209257_10062983 300
77 3300025315 Ga0207697_10008487 Ga0207697_100084872 300
78 3300025893 Ga0207682_10003347 Ga0207682_100033473 300
79 3300025908 Ga0207643_10024010 Ga0207643_100240102 300
80 3300025923 Ga0207681_10011548 Ga0207681_100115483 300
81 3300025925 Ga0207650_10000887 Ga0207650_1000088720 300
82 3300025926 Ga0207659_10003612 Ga0207659_100036122 300
83 3300025931 Ga0207644_10036294 Ga0207644_100362942 300
84 3300025937 Ga0207669_10018827 Ga0207669_100188272 300
85 3300025940 Ga0207691_10005598 Ga0207691_1000559814 300
86 3300025960 Ga0207651_10004962 Ga0207651_100049622 300
87 3300025972 Ga0207668_10030926 Ga0207668_100309262 300
88 3300025986 Ga0207658_10031397 Ga0207658_100313972 300
89 3300026023 Ga0207677_10004015 Ga0207677_100040158 300
90 3300049571 Ga0501034_0270585 Ga0501034_0270585_54_1034 300
91 3300005262 Ga0065165_1000863 Ga0065165_100086316 301
92 3300025273 Ga0209673_1001320 Ga0209673_100132016 301
93 3300025298 Ga0209050_1002913 Ga0209050_10029132 301
94 3300041411 Ga0439466_0018269 Ga0439466_0018269_415_1599 301
95 3300041413 Ga0439465_0001136 Ga0439465_0001136_537_1721 301
96 3300042002 Ga0439442_005508 Ga0439442_005508_267_1451 301
97 3300042006 Ga0439432_000543 Ga0439432_000543_983_2167 301
98 3300042007 Ga0439449_0000317 Ga0439449_0000317_2102_3304 301
99 3300042010 Ga0439452_020629 Ga0439452_020629_40_1224 301
100 3300042014 Ga0439457_004029 Ga0439457_004029_983_2167 301
101 3300042156 Ga0439446_0000499 Ga0439446_0000499_147_1331 301
102 3300042435 Ga0439434_0003962 Ga0439434_0003962_2719_3903 301
103 3300050515 nmdc:mga0a205_329004_c1 nmdc:mga0a205_329004_c1_10_993 301
104 3300041413 Ga0439465_0001491 Ga0439465_0001491_5950_7053 303
105 3300003322 rootL2_10212651 rootL2_102126513 304
106 3300028794 Ga0307515_10244857 Ga0307515_102448572 304
107 3300048090 Ga0495615_0023418 Ga0495615_0023418_13_1185 304
108 3300025945 Ga0207679_10027441 Ga0207679_100274412 305
109 3300046501 Ga0495607_0000007 Ga0495607_0000007_52844_54076 307
110 3300047321 Ga0495676_0256266 Ga0495676_0256266_23_1162 307
111 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006138 308
112 3300003322 rootL2_10166950 rootL2_101669502 308
113 3300015683 Ga0183362_10001 Ga0183362_100011593 308
114 3300025297 Ga0209758_1000001 Ga0209758_10000011688 308
115 3300025297 Ga0209758_1000089 Ga0209758_1000089150 308
116 3300031691 Ga0316579_10000226 Ga0316579_100002268 308
117 3300031727 Ga0316576_10016405 Ga0316576_100164052 308
118 3300032133 Ga0316583_10035536 Ga0316583_100355362 308
119 3300032137 Ga0316585_10039642 Ga0316585_100396422 308
120 3300032139 Ga0316580_10000277 Ga0316580_100002779 308
121 3300033528 Ga0316588_1000768 Ga0316588_10007682 308
122 3300033529 Ga0316587_1002934 Ga0316587_10029342 308
123 3300033541 Ga0316596_1004783 Ga0316596_10047832 308
124 3300035398 Ga0316574_0000171 Ga0316574_0000171_8547_9704 308
125 3300036712 Ga0316584_0166153 Ga0316584_0166153_38_1141 308
126 3300044712 Ga0453684_0007549 Ga0453684_0007549_6531_7661 308
127 3300005614 Ga0068856_100166708 Ga0068856_1001667082 310
128 3300006353 Ga0075370_10006053 Ga0075370_100060532 310
129 3300006846 Ga0075430_100204068 Ga0075430_1002040682 310
130 3300026078 Ga0207702_10069259 Ga0207702_100692592 310
131 3300045051 Ga0451576_0159505 Ga0451576_0159505_632_1762 310
132 3300050496 nmdc:mga07m45_6580_c1 nmdc:mga07m45_6580_c1_2084_3256 310
133 3300053124 Ga0500617_007001 Ga0500617_007001_2276_3400 310
134 3300002737 JGI25162J39368_1000025 JGI25162J39368_10000255 311
135 3300002737 JGI25162J39368_1000263 JGI25162J39368_10002635 311
136 3300003214 JGI25165J46597_1000054 JGI25165J46597_10000545 311
137 3300003751 Ga0055538_1000026 Ga0055538_1000026221 311
138 3300003752 Ga0055539_1000033 Ga0055539_1000033221 311
139 3300003756 Ga0055533_1000044 Ga0055533_1000044221 311
140 3300003759 Ga0055525_1000052 Ga0055525_1000052221 311
141 3300003841 Ga0055541_1000069 Ga0055541_100006988 311
142 3300014497 Ga0182008_10000421 Ga0182008_100004212 311
143 3300015261 Ga0182006_1021250 Ga0182006_10212502 311
144 3300015262 Ga0182007_10025805 Ga0182007_100258052 311
145 3300015265 Ga0182005_1000995 Ga0182005_10009955 311
146 3300025207 Ga0209760_101443 Ga0209760_1014432 311
147 3300025224 Ga0209784_100020 Ga0209784_10002069 311
148 3300025225 Ga0209566_100020 Ga0209566_10002069 311
149 3300025226 Ga0209674_100035 Ga0209674_10003569 311
150 3300025230 Ga0209563_100038 Ga0209563_10003869 311
151 3300025233 Ga0209437_100066 Ga0209437_100066312 311
152 3300025253 Ga0209677_100031 Ga0209677_1000319 311
153 3300025261 Ga0209233_1000060 Ga0209233_100006069 311
154 3300046455 Ga0495603_0083705 Ga0495603_0083705_696_1796 311
155 3300046462 Ga0495651_0027368 Ga0495651_0027368_76_1218 311
156 3300046463 Ga0495653_0020739 Ga0495653_0020739_1806_2948 311
157 3300046516 Ga0495628_0015237 Ga0495628_0015237_3756_4898 311
158 3300046543 Ga0495645_0067075 Ga0495645_0067075_231_1373 311
159 3300046642 Ga0495634_0195265 Ga0495634_0195265_35_1177 311
160 3300046678 Ga0495599_0018022 Ga0495599_0018022_3074_4216 311
161 3300046680 Ga0495646_0024693 Ga0495646_0024693_1340_2482 311
162 3300046809 Ga0495600_0008801 Ga0495600_0008801_2036_3178 311
163 3300047317 Ga0495604_0031506 Ga0495604_0031506_1757_2899 311
164 3300048905 Ga0496102_0000706 Ga0496102_0000706_2265_3458 311
165 3300053077 Ga0495601_0031288 Ga0495601_0031288_201_1343 311
166 3300053077 Ga0495601_0054607 Ga0495601_0054607_957_2057 311
167 3300053119 Ga0500595_003252 Ga0500595_003252_4215_5357 311
168 3300053141 Ga0500574_000787 Ga0500574_000787_755_1897 311
169 3300053154 Ga0500619_005672 Ga0500619_005672_1282_2424 311
170 3300046460 Ga0495638_0036279 Ga0495638_0036279_913_2061 312
171 3300046519 Ga0495632_0007969 Ga0495632_0007969_1824_2972 312
172 3300053086 Ga0500578_0000622 Ga0500578_0000622_29418_30566 312
173 3300053090 Ga0500646_0007026 Ga0500646_0007026_834_1982 312
174 3300053131 Ga0500652_000085 Ga0500652_000085_36770_37918 312
175 3300053156 Ga0500622_0000534 Ga0500622_0000534_25087_26235 312
176 3300042876 Ga0451577_0211148 Ga0451577_0211148_106_1236 313
177 3300044712 Ga0453684_0067601 Ga0453684_0067601_1945_3075 313
178 3300009093 Ga0105240_10309461 Ga0105240_103094612 314
179 3300025919 Ga0207657_10023461 Ga0207657_100234612 314
180 3300049764 Ga0501267_000061 Ga0501267_000061_4847_6025 314
181 3300005335 Ga0070666_10079575 Ga0070666_100795752 315
182 3300005339 Ga0070660_100108469 Ga0070660_1001084692 315
183 3300005617 Ga0068859_100049787 Ga0068859_1000497873 315
184 3300006353 Ga0075370_10091239 Ga0075370_100912392 315
185 3300006931 Ga0097620_100049787 Ga0097620_1000497872 315
186 3300044656 Ga0466969_0114025 Ga0466969_0114025_44_1192 315
187 3300053130 Ga0500642_0018256 Ga0500642_0018256_417_1568 315
188 3300053151 Ga0500604_0014150 Ga0500604_0014150_94_1245 315
189 3300005329 Ga0070683_100049742 Ga0070683_1000497423 316
190 3300005339 Ga0070660_100005137 Ga0070660_1000051377 316
191 3300005344 Ga0070661_100011993 Ga0070661_1000119933 316
192 3300005344 Ga0070661_100065151 Ga0070661_1000651512 316
193 3300005366 Ga0070659_100017393 Ga0070659_1000173932 316
194 3300005543 Ga0070672_100008125 Ga0070672_1000081252 316
195 3300005564 Ga0070664_100012851 Ga0070664_1000128516 316
196 3300005614 Ga0068856_100029175 Ga0068856_1000291752 316
197 3300005616 Ga0068852_100003094 Ga0068852_1000030942 316
198 3300005616 Ga0068852_100053997 Ga0068852_1000539972 316
199 3300005842 Ga0068858_100010727 Ga0068858_1000107274 316
200 3300005843 Ga0068860_100076801 Ga0068860_1000768012 316
201 3300009551 Ga0105238_10013310 Ga0105238_100133107 316
202 3300013100 Ga0157373_10163496 Ga0157373_101634962 316
203 3300013105 Ga0157369_10173407 Ga0157369_101734072 316
204 3300013307 Ga0157372_10025361 Ga0157372_100253614 316
205 3300013308 Ga0157375_10017755 Ga0157375_100177552 316
206 3300014968 Ga0157379_10018220 Ga0157379_100182202 316
207 3300025918 Ga0207662_10099781 Ga0207662_100997812 316
208 3300025919 Ga0207657_10008286 Ga0207657_100082862 316
209 3300025920 Ga0207649_10007761 Ga0207649_100077613 316
210 3300025920 Ga0207649_10010503 Ga0207649_100105032 316
211 3300025924 Ga0207694_10015923 Ga0207694_100159232 316
212 3300026035 Ga0207703_10016236 Ga0207703_100162362 316
213 3300026078 Ga0207702_10023380 Ga0207702_100233804 316
214 3300028381 Ga0268264_10030553 Ga0268264_100305532 316
215 3300053121 Ga0500607_019200 Ga0500607_019200_2475_3599 316
216 3300005328 Ga0070676_10079234 Ga0070676_100792341 317
217 3300005329 Ga0070683_100042386 Ga0070683_1000423862 317
218 3300005334 Ga0068869_100000109 Ga0068869_1000001099 317
219 3300005338 Ga0068868_100000895 Ga0068868_1000008959 317
220 3300005347 Ga0070668_100029724 Ga0070668_1000297244 317
221 3300005353 Ga0070669_100017130 Ga0070669_1000171302 317
222 3300005354 Ga0070675_100000621 Ga0070675_1000006217 317
223 3300005366 Ga0070659_100295927 Ga0070659_1002959271 317
224 3300005455 Ga0070663_100003719 Ga0070663_1000037196 317
225 3300005457 Ga0070662_100001965 Ga0070662_1000019656 317
226 3300005530 Ga0070679_100009359 Ga0070679_1000093592 317
227 3300005535 Ga0070684_100055993 Ga0070684_1000559932 317
228 3300005539 Ga0068853_100006482 Ga0068853_1000064829 317
229 3300005547 Ga0070693_100079681 Ga0070693_1000796812 317
230 3300005577 Ga0068857_100103925 Ga0068857_1001039252 317
231 3300005578 Ga0068854_100020625 Ga0068854_1000206252 317
232 3300005616 Ga0068852_100063852 Ga0068852_1000638522 317
233 3300005618 Ga0068864_100004021 Ga0068864_1000040214 317
234 3300005719 Ga0068861_100000126 Ga0068861_1000001269 317
235 3300005841 Ga0068863_100012220 Ga0068863_1000122204 317
236 3300006358 Ga0068871_100017048 Ga0068871_1000170485 317
237 3300009098 Ga0105245_10023026 Ga0105245_100230263 317
238 3300009545 Ga0105237_10191789 Ga0105237_101917892 317
239 3300010375 Ga0105239_10110940 Ga0105239_101109402 317
240 3300013307 Ga0157372_10009183 Ga0157372_100091832 317
241 3300013308 Ga0157375_10373457 Ga0157375_103734572 317
242 3300014745 Ga0157377_10001137 Ga0157377_100011376 317
243 3300014968 Ga0157379_10005980 Ga0157379_100059802 317
244 3300014969 Ga0157376_10006475 Ga0157376_100064755 317
245 3300017792 Ga0163161_10032865 Ga0163161_100328652 317
246 3300025901 Ga0207688_10042533 Ga0207688_100425332 317
247 3300025914 Ga0207671_10194597 Ga0207671_101945972 317
248 3300025921 Ga0207652_10110087 Ga0207652_101100872 317
249 3300025923 Ga0207681_10075133 Ga0207681_100751332 317
250 3300025932 Ga0207690_10006695 Ga0207690_100066954 317
251 3300025933 Ga0207706_10000736 Ga0207706_1000073626 317
252 3300025941 Ga0207711_10002545 Ga0207711_1000254510 317
253 3300025942 Ga0207689_10000259 Ga0207689_1000025938 317
254 3300025981 Ga0207640_10016404 Ga0207640_100164042 317
255 3300026023 Ga0207677_10026152 Ga0207677_100261522 317
256 3300026035 Ga0207703_10109441 Ga0207703_101094412 317
257 3300026041 Ga0207639_10024668 Ga0207639_100246682 317
258 3300026067 Ga0207678_10007496 Ga0207678_100074968 317
259 3300026088 Ga0207641_10021159 Ga0207641_100211595 317
260 3300026089 Ga0207648_10196449 Ga0207648_101964493 317
261 3300026095 Ga0207676_10011244 Ga0207676_100112446 317
262 3300026116 Ga0207674_10030619 Ga0207674_100306194 317
263 3300026116 Ga0207674_10057191 Ga0207674_100571912 317
264 3300026118 Ga0207675_100000307 Ga0207675_1000003079 317
265 3300026142 Ga0207698_10015293 Ga0207698_100152932 317
266 3300028381 Ga0268264_10123725 Ga0268264_101237252 317
267 3300035691 Ga0373931_0049829 Ga0373931_0049829_40_1206 317
268 3300042129 Ga0450891_002786 Ga0450891_002786_224_1417 317
269 3300048904 Ga0496101_0008217 Ga0496101_0008217_1955_3121 317
270 3300048912 Ga0496109_0024773 Ga0496109_0024773_2594_3760 317
271 3300048913 Ga0496110_0005584 Ga0496110_0005584_2446_3612 317
272 3300048917 Ga0496114_0009654 Ga0496114_0009654_5794_6960 317
273 3300003322 rootL2_10045667 rootL2_100456672 318
274 3300045051 Ga0451576_0097165 Ga0451576_0097165_710_1843 318
275 3300015262 Ga0182007_10016887 Ga0182007_100168872 319
276 3300049569 Ga0501032_0072071 Ga0501032_0072071_457_1548 319
277 3300049570 Ga0501033_0000035 Ga0501033_0000035_124264_125355 319
278 3300049822 Ga0501035_0000388 Ga0501035_0000388_30929_32020 319
279 3300025230 Ga0209563_101162 Ga0209563_1011621 320
280 iso_pu_bacteria 2643221646 2644260635 320
281 iso_pu_bacteria 2842815866 2842815893 320
282 3300002773 JGI25152J39213_1004332 JGI25152J39213_10043322 321
283 3300003215 JGI25153J46596_10004907 JGI25153J46596_100049074 321
284 3300003771 Ga0055526_1000475 Ga0055526_100047519 321
285 3300025245 Ga0207425_1012551 Ga0207425_10125512 321
286 3300025258 Ga0209129_1000038 Ga0209129_100003839 321
287 3300025273 Ga0209673_1020829 Ga0209673_10208292 321
288 3300025295 Ga0209564_1000129 Ga0209564_1000129148 321
289 3300025297 Ga0209758_1000600 Ga0209758_100060020 321
290 3300025304 Ga0209257_1021236 Ga0209257_10212362 321
291 3300045051 Ga0451576_0134877 Ga0451576_0134877_713_1882 321
292 3300049517 Ga0501294_001662 Ga0501294_001662_190_1368 321
293 3300049523 Ga0501300_001892 Ga0501300_001892_1092_2270 321
294 3300049658 Ga0501211_002300 Ga0501211_002300_204_1382 321
295 3300049669 Ga0501235_001717 Ga0501235_001717_832_2010 321
296 3300049704 Ga0501221_000078 Ga0501221_000078_4899_6077 321
297 iso_pu_bacteria 2643221639 2644222708 321
298 3300046522 Ga0495643_0000007 Ga0495643_0000007_222779_223933 322
299 3300047443 Ga0495687_019385 Ga0495687_019385_1365_2489 322
300 3300049822 Ga0501035_0265227 Ga0501035_0265227_170_1297 322
301 3300049823 Ga0501044_0157826 Ga0501044_0157826_1026_2165 322
302 iso_pu_bacteria 2643221585 2643936425 322
303 iso_pu_bacteria 2643221656 2644317070 322
304 iso_pu_bacteria 2738541337 2739056476 322
305 3300044684 Ga0466966_0050390 Ga0466966_0050390_419_1558 323
306 3300046452 Ga0495617_001271 Ga0495617_001271_4287_5387 323
307 3300046530 Ga0495654_0003758 Ga0495654_0003758_3984_5084 323
308 3300045051 Ga0451576_0218268 Ga0451576_0218268_34_1164 324
309 3300032004 Ga0307414_10133648 Ga0307414_101336481 325
310 3300037418 Ga0395900_0103357 Ga0395900_0103357_1489_2589 325
311 3300048909 Ga0496106_0011434 Ga0496106_0011434_2511_3659 325
312 3300006195 Ga0075366_10004679 Ga0075366_100046793 326
313 3300031456 Ga0307513_10200053 Ga0307513_102000532 326
314 3300032004 Ga0307414_10033857 Ga0307414_100338572 326
315 3300045976 Ga0466967_0216722 Ga0466967_0216722_222_1346 326
316 3300046519 Ga0495632_0001338 Ga0495632_0001338_10016_11122 326
317 3300047443 Ga0495687_000242 Ga0495687_000242_58617_59771 326
318 3300050493 nmdc:mga0k408_2643_c1 nmdc:mga0k408_2643_c1_3902_5008 326
319 3300050496 nmdc:mga07m45_56611_c1 nmdc:mga07m45_56611_c1_654_1760 326
320 3300053088 Ga0500644_0028828 Ga0500644_0028828_569_1675 326
321 3300053139 Ga0500568_0055179 Ga0500568_0055179_13_1119 326
322 3300053142 Ga0500577_0023599 Ga0500577_0023599_386_1492 326
323 3300053156 Ga0500622_0003635 Ga0500622_0003635_8008_9114 326
324 3300053730 Ga0500645_003311 Ga0500645_003311_1284_2471 326
325 iso_pu_bacteria 2585428057 2587729896 326
326 iso_pu_bacteria 2585428058 2587735057 326
327 3300005355 Ga0070671_100044570 Ga0070671_1000445702 327
328 3300025931 Ga0207644_10043077 Ga0207644_100430772 327
329 3300048924 Ga0496121_0019293 Ga0496121_0019293_3740_4912 327
330 iso_pu_bacteria 2522572158 2523108136 327
331 3300005356 Ga0070674_100113799 Ga0070674_1001137991 328
332 3300005543 Ga0070672_100105021 Ga0070672_1001050212 328
333 3300005842 Ga0068858_100150840 Ga0068858_1001508402 328
334 3300006881 Ga0068865_100206653 Ga0068865_1002066532 328
335 3300013308 Ga0157375_10013596 Ga0157375_100135962 328
336 3300026088 Ga0207641_10062488 Ga0207641_100624883 328
337 iso_pu_bacteria 2585428058 2587733490 328
338 iso_pu_bacteria 2643221660 2644337556 328
339 3300031251 Ga0265327_10031965 Ga0265327_100319652 329
340 3300035119 Ga0373956_0022375 Ga0373956_0022375_555_1658 329
341 3300035724 Ga0373933_0106271 Ga0373933_0106271_618_1721 329
342 3300036401 Ga0373937_0001785 Ga0373937_0001785_13807_14910 329
343 3300048911 Ga0496108_0031370 Ga0496108_0031370_2147_3295 329
344 3300048914 Ga0496111_0031950 Ga0496111_0031950_2082_3218 329
345 iso_pu_bacteria 2585428062 2587756785 329
346 iso_pu_bacteria 2588253510 2588294466 329
347 iso_pu_bacteria 2643221592 2643968866 329
348 iso_pu_bacteria 2643221625 2644139829 329
349 iso_pu_bacteria 2643221648 2644273781 329
350 iso_pu_bacteria 2857564685 2857568681 329
351 iso_pu_bacteria 2919130084 2919130908 329
352 iso_pu_bacteria 2929195423 2929196139 329
353 3300048912 Ga0496109_0035237 Ga0496109_0035237_2869_4020 330
354 iso_pu_bacteria 2599185188 2599501661 330
355 iso_pu_bacteria 2599185300 2599931417 330
356 iso_pu_bacteria 2643221644 2644249063 330
357 iso_pu_bacteria 2738543013 2739250935 330
358 3300005337 Ga0070682_100010460 Ga0070682_1000104602 331
359 3300042876 Ga0451577_0072726 Ga0451577_0072726_753_1892 331
360 3300044712 Ga0453684_0000826 Ga0453684_0000826_102053_103192 331
361 3300045051 Ga0451576_0021302 Ga0451576_0021302_1036_2175 331
362 3300048913 Ga0496110_0018404 Ga0496110_0018404_1258_2409 331
363 iso_pu_bacteria 2818991436 2819545289 331
364 iso_pu_bacteria 2928115317 2928117772 331
365 iso_pu_bacteria 8015394850 8015395446 332
366 3300003756 Ga0055533_1000694 Ga0055533_10006945 333
367 3300003841 Ga0055541_1001179 Ga0055541_10011792 333
368 iso_pu_bacteria 2602042109 2603867194 333
369 iso_pu_bacteria 2888366609 2888368611 333
370 3300015262 Ga0182007_10001289 Ga0182007_100012893 334
371 3300046462 Ga0495651_0010259 Ga0495651_0010259_3627_4799 334
372 3300046516 Ga0495628_0010495 Ga0495628_0010495_4608_5780 334
373 3300046516 Ga0495628_0088328 Ga0495628_0088328_751_1926 334
374 3300046529 Ga0495652_0019178 Ga0495652_0019178_3522_4694 334
375 3300046679 Ga0495623_0015624 Ga0495623_0015624_2336_3508 334
376 3300048088 Ga0495602_0024377 Ga0495602_0024377_3076_4248 334
377 3300048921 Ga0496118_0072342 Ga0496118_0072342_191_1345 334
378 iso_pu_bacteria 2857576091 2857577537 334
379 3300044650 Ga0466986_0024952 Ga0466986_0024952_319_1443 335
380 iso_pu_bacteria 2596583598 2597031444 335
381 iso_pu_bacteria 2599185178 2599445210 335
382 iso_pu_bacteria 2643221660 2644337466 335
383 iso_pu_bacteria 2857576091 2857580463 335
384 3300046501 Ga0495607_0000023 Ga0495607_0000023_3345_4580 336
385 3300048091 Ga0495626_0029796 Ga0495626_0029796_163_1398 336
386 iso_pu_bacteria 2599185302 2599944340 336
387 iso_pu_bacteria 2599185304 2599954812 336
388 iso_pu_bacteria 2599185309 2599984260 336
389 iso_pu_bacteria 2599185310 2599991468 336
390 iso_pu_bacteria 2599185312 2600001152 336
391 iso_pu_bacteria 2599185320 2600048941 336
392 3300044656 Ga0466969_0077342 Ga0466969_0077342_361_1482 337
393 3300044671 Ga0466978_0028381 Ga0466978_0028381_1367_2488 337
394 3300044683 Ga0466965_0020032 Ga0466965_0020032_853_1974 337
395 3300044693 Ga0466961_0000404 Ga0466961_0000404_25597_26718 337
396 3300044706 Ga0466964_0018176 Ga0466964_0018176_1012_2133 337
397 3300044735 Ga0466968_0013647 Ga0466968_0013647_682_1803 337
398 3300044765 Ga0466970_0002930 Ga0466970_0002930_148_1269 337
399 3300061719 Ga0466962_0001461 Ga0466962_0001461_6580_7701 337
400 3300045049 Ga0466959_0045822 Ga0466959_0045822_811_1932 338
401 3300001915 JGI24741J21665_1000448 JGI24741J21665_10004482 339
402 3300001979 JGI24740J21852_10000149 JGI24740J21852_1000014910 339
403 3300001979 JGI24740J21852_10000159 JGI24740J21852_1000015913 339
404 3300003751 Ga0055538_1002449 Ga0055538_10024492 339
405 3300003751 Ga0055538_1004594 Ga0055538_10045941 339
406 3300003752 Ga0055539_1000086 Ga0055539_100008695 339
407 3300003756 Ga0055533_1004738 Ga0055533_10047382 339
408 3300003758 Ga0055532_1000041 Ga0055532_100004160 339
409 3300003759 Ga0055525_1000537 Ga0055525_10005377 339
410 3300003761 Ga0055535_1000030 Ga0055535_1000030117 339
411 3300003762 Ga0055542_1000628 Ga0055542_10006284 339
412 3300003763 Ga0055529_1000058 Ga0055529_100005860 339
413 3300003841 Ga0055541_1009313 Ga0055541_10093132 339
414 3300005337 Ga0070682_100075994 Ga0070682_1000759942 339
415 3300005344 Ga0070661_100000072 Ga0070661_10000007261 339
416 3300005455 Ga0070663_100000015 Ga0070663_10000001559 339
417 3300005564 Ga0070664_100000058 Ga0070664_1000000582 339
418 3300005577 Ga0068857_100029891 Ga0068857_1000298912 339
419 3300005578 Ga0068854_100000025 Ga0068854_10000002563 339
420 3300005614 Ga0068856_100000084 Ga0068856_10000008462 339
421 3300005616 Ga0068852_100016740 Ga0068852_1000167402 339
422 3300009093 Ga0105240_10218069 Ga0105240_102180692 339
423 3300013100 Ga0157373_10061038 Ga0157373_100610382 339
424 3300013102 Ga0157371_10000100 Ga0157371_1000010062 339
425 3300013104 Ga0157370_10000004 Ga0157370_1000000463 339
426 3300013105 Ga0157369_10000809 Ga0157369_1000080934 339
427 3300013307 Ga0157372_10000279 Ga0157372_1000027937 339
428 3300014497 Ga0182008_10063458 Ga0182008_100634582 339
429 3300015261 Ga0182006_1005758 Ga0182006_10057585 339
430 3300015261 Ga0182006_1017978 Ga0182006_10179782 339
431 3300015262 Ga0182007_10009797 Ga0182007_100097972 339
432 3300025224 Ga0209784_100029 Ga0209784_100029275 339
433 3300025224 Ga0209784_100508 Ga0209784_10050812 339
434 3300025225 Ga0209566_100030 Ga0209566_10003063 339
435 3300025225 Ga0209566_100277 Ga0209566_10027723 339
436 3300025226 Ga0209674_100081 Ga0209674_10008175 339
437 3300025226 Ga0209674_100089 Ga0209674_10008931 339
438 3300025226 Ga0209674_100123 Ga0209674_10012356 339
439 3300025226 Ga0209674_100289 Ga0209674_10028931 339
440 3300025228 Ga0209672_100247 Ga0209672_10024736 339
441 3300025229 Ga0209147_100008 Ga0209147_100008661 339
442 3300025230 Ga0209563_100091 Ga0209563_10009129 339
443 3300025230 Ga0209563_100092 Ga0209563_100092122 339
444 3300025242 Ga0209258_100013 Ga0209258_100013661 339
445 3300025246 Ga0209646_1000065 Ga0209646_1000065113 339
446 3300025253 Ga0209677_100030 Ga0209677_10003063 339
447 3300025253 Ga0209677_102538 Ga0209677_1025383 339
448 3300025254 Ga0209148_1000113 Ga0209148_1000113112 339
449 3300025254 Ga0209148_1004805 Ga0209148_10048053 339
450 3300025256 Ga0209759_1000492 Ga0209759_10004924 339
451 3300025272 Ga0209455_1000106 Ga0209455_100010662 339
452 3300025913 Ga0207695_10000535 Ga0207695_1000053537 339
453 3300025920 Ga0207649_10000222 Ga0207649_1000022223 339
454 3300025932 Ga0207690_10003347 Ga0207690_100033477 339
455 3300025945 Ga0207679_10000038 Ga0207679_1000003858 339
456 3300025981 Ga0207640_10000096 Ga0207640_1000009627 339
457 3300026067 Ga0207678_10000021 Ga0207678_1000002157 339
458 3300026078 Ga0207702_10000203 Ga0207702_1000020337 339
459 3300026142 Ga0207698_10010835 Ga0207698_100108354 339
460 3300037418 Ga0395900_0032985 Ga0395900_0032985_2544_3674 339
461 iso_pu_bacteria 2885266251 2885270341 339
462 iso_pu_bacteria 2900577576 2900580488 339
463 iso_pu_bacteria 2928058823 2928063781 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13437

HlyD_3

HlyD family secretion protein

188

290

0.92

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

78

126

0.9

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

61

293

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qsh-assembly1.cif.gz_B crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.8934 62 180
4qsh-assembly1.cif.gz_D crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.8932 62 180
4qsh-assembly1.cif.gz_C crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.893 62 180
4qsh-assembly1.cif.gz_A crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.8928 62 180
3hb9-assembly1.cif.gz_B crystal structure of s. aureus pyruvate carboxylase a610t mutant 0.8865 62 178
ID Description Score Start End Superfamily
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9636 59 180 2.40.50.100
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9432 59 180 2.40.50.100
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9295 59 180 2.40.50.100
3lnnA01 Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; 0.9237 261 318 2.40.420.20
3ne5C01 Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; 0.9175 265 324 2.40.420.20
ID Description Score Start End GO Terms
AF-A0A519WVK6-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.9217 264 337 GO:0005886
GO:0046677
AF-A0A3B0WKP4-F1-model_v4 RND efflux system, membrane fusion protein 0.9044 264 337 GO:0005886
GO:0046677
AF-A0A1M5VF26-F1-model_v4 RND family efflux transporter, MFP subunit 0.8874 264 337 GO:0005886
GO:0015562
GO:1990281
AF-A0A4R0WYL8-F1-model_v4 Efflux transporter periplasmic adaptor subunit 0.8431 266 339 GO:0015562
GO:1990281
AF-A0A352AFL2-F1-model_v4 Efflux transporter periplasmic adaptor subunit 0.772 9 336 GO:0005886
GO:0015562
GO:1990281

Feature Viewer

pLDDT pTM Quality
84.17 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map