F449203

General Info

Members Datasets Scaffolds Average Seq Length
463 305 926 264

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0206068|Ga0495619_0206068_17_937
Length 306
Sequence MRSNSSAYRFRLTVNVLARANPRLRLDNTTRFCGRPLPREKQMRNDFETIIAERHDNQVLIVTLNRADAANAMNTQMGLDLMELFEGLTVDIEGLRVVILTGSGTKAFCAGGDLKQRNGMTDEAWVAQHLVFERMLRAIVACPVPVIAAVNGAAYGGGCEIAAAADFVYASTNARFALTEVTLGIMPGAGGTQNLPRAVGERRAKELILSGLPFSAEEAERWGLVNRVLAPEELLKATLAIADRIACNGPISVRQAKQAIHRGLQMSLADGLAFEIEAYNRLIPTSDRREGVLAFNERRKPDFQGK

Samples

Sample ID Description Type Environment
1 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
263 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
264 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
265 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
268 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
269 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
275 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
276 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
281 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
282 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
283 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
284 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
285 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
286 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
287 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
288 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
289 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
290 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
291 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
292 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
293 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
294 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
295 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
296 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
297 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
298 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
299 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
300 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
301 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
302 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
303 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
304 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
305 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.6
Metatranscriptomes 0
Isolates 5.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.26
Nodule 4.54
Rhizoplane 3.24
Rhizosphere 82.29
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495619_0206068 3300053085 Bacteria 1361
2 JGI24742J22300_10021539 3300002244 Bacteria 1101
3 rootH1_10111875 3300003323 Bacteria 2476
4 Ga0065165_1007440 3300005262 Bacteria 5378
5 Ga0065715_10033482 3300005293 Bacteria 1487
6 Ga0065715_10102828 3300005293 Bacteria 3081
7 Ga0065715_10218274 3300005293 Unclassified 1283
8 Ga0070670_100105480 3300005331 Bacteria 2428
9 Ga0070670_100137461 3300005331 Bacteria 2112
10 Ga0070677_10000024 3300005333 Bacteria 44512
11 Ga0070680_100089449 3300005336 Bacteria 2548
12 Ga0070680_100100349 3300005336 Bacteria 2402
13 Ga0068868_100045853 3300005338 Bacteria 3421
14 Ga0070689_100053653 3300005340 Bacteria 3120
15 Ga0070689_100086452 3300005340 Bacteria 2466
16 Ga0070669_100084254 3300005353 Bacteria 2371
17 Ga0070675_100000353 3300005354 Bacteria 31011
18 Ga0070671_100003775 3300005355 Bacteria 11893
19 Ga0070674_100000273 3300005356 Bacteria 25413
20 Ga0070667_100126849 3300005367 Bacteria 2224
21 Ga0070709_10007135 3300005434 Bacteria 6117
22 Ga0070709_10214806 3300005434 Bacteria 1369
23 Ga0070709_10223050 3300005434 Bacteria 1345
24 Ga0070714_100021600 3300005435 Bacteria 5267
25 Ga0070714_100067089 3300005435 Bacteria 3093
26 Ga0070713_100023989 3300005436 Bacteria 4743
27 Ga0070713_100075632 3300005436 Bacteria 2857
28 Ga0070713_100248139 3300005436 Bacteria 1623
29 Ga0070710_10088311 3300005437 Bacteria 1824
30 Ga0070711_100001130 3300005439 Bacteria 14272
31 Ga0070711_100030087 3300005439 Bacteria 3591
32 Ga0070711_100039210 3300005439 Bacteria 3189
33 Ga0070708_100090135 3300005445 Bacteria 2791
34 Ga0070678_100012068 3300005456 Bacteria 5355
35 Ga0070681_10005696 3300005458 Bacteria 12042
36 Ga0070681_10143790 3300005458 Bacteria 2314
37 Ga0068867_100070922 3300005459 Bacteria 2605
38 Ga0070685_10070242 3300005466 Bacteria 2073
39 Ga0070706_100051266 3300005467 Bacteria 3808
40 Ga0070707_100062252 3300005468 Bacteria 3580
41 Ga0070698_100647511 3300005471 Bacteria 998
42 Ga0070699_100379522 3300005518 Bacteria 1276
43 Ga0070679_100003053 3300005530 Bacteria 15300
44 Ga0070679_100122268 3300005530 Bacteria 2587
45 Ga0070684_100046980 3300005535 Bacteria 3741
46 Ga0070672_100000405 3300005543 Bacteria 24979
47 Ga0070686_100062632 3300005544 Bacteria 2407
48 Ga0070665_100198061 3300005548 Bacteria 2009
49 Ga0068855_100053468 3300005563 Bacteria 4751
50 Ga0068855_100166002 3300005563 Bacteria 2503
51 Ga0068855_100359035 3300005563 Bacteria 1603
52 Ga0068855_100770899 3300005563 Bacteria 1024
53 Ga0070664_100119455 3300005564 Bacteria 2307
54 Ga0068857_100212183 3300005577 Bacteria 1767
55 Ga0068857_100858994 3300005577 Bacteria 869
56 Ga0068854_100170507 3300005578 Bacteria 1693
57 Ga0068854_100192676 3300005578 Bacteria 1598
58 Ga0068856_100018516 3300005614 Bacteria 6749
59 Ga0068864_100166690 3300005618 Bacteria 2006
60 Ga0068861_100060885 3300005719 Bacteria 2895
61 Ga0068858_100237697 3300005842 Bacteria 1728
62 Ga0070717_10012707 3300006028 Bacteria 6426
63 Ga0075363_100000044 3300006048 Bacteria 24255
64 Ga0075363_100187888 3300006048 Bacteria 1177
65 Ga0075364_10000523 3300006051 Bacteria 19541
66 Ga0070716_100092125 3300006173 Bacteria 1837
67 Ga0070716_100130183 3300006173 Bacteria 1589
68 Ga0070712_100070119 3300006175 Bacteria 2503
69 Ga0070712_100096399 3300006175 Bacteria 2178
70 Ga0070712_100468146 3300006175 Bacteria 1052
71 Ga0075367_10000045 3300006178 Bacteria 28293
72 Ga0097621_100097115 3300006237 Bacteria 2473
73 Ga0068871_100077804 3300006358 Bacteria 2742
74 Ga0075428_100000587 3300006844 Bacteria 37141
75 Ga0075430_100027991 3300006846 Bacteria 4788
76 Ga0075430_100077609 3300006846 Bacteria 2784
77 Ga0075430_100150142 3300006846 Bacteria 1940
78 Ga0075431_100000130 3300006847 Bacteria 50226
79 Ga0075431_100144335 3300006847 Bacteria 2453
80 Ga0075431_100409940 3300006847 Bacteria 1355
81 Ga0075429_100018065 3300006880 Bacteria 6101
82 Ga0068865_100046818 3300006881 Bacteria 2969
83 Ga0075435_100133751 3300007076 Bacteria 2076
84 Ga0099794_10011307 3300007265 Bacteria 3817
85 Ga0105240_10014508 3300009093 Bacteria 10756
86 Ga0105240_10348858 3300009093 Bacteria 1680
87 Ga0114129_10000126 3300009147 Bacteria 77521
88 Ga0114129_10330904 3300009147 Bacteria 2023
89 Ga0105242_10186438 3300009176 Bacteria 1834
90 Ga0105237_10123276 3300009545 Bacteria 2586
91 Ga0105237_10128253 3300009545 Bacteria 2531
92 Ga0105238_10020841 3300009551 Bacteria 6677
93 Ga0105238_10021471 3300009551 Bacteria 6576
94 Ga0105238_10056096 3300009551 Bacteria 3953
95 Ga0157369_10015147 3300013105 Bacteria 8702
96 Ga0157369_10822292 3300013105 Bacteria 954
97 Ga0157374_10141526 3300013296 Bacteria 2335
98 Ga0157378_10015391 3300013297 Bacteria 6700
99 Ga0157372_10012738 3300013307 Bacteria 8959
100 Ga0157380_10010129 3300014326 Bacteria 6774
101 Ga0163161_10091866 3300017792 Bacteria 2247
102 Ga0213874_10003542 3300021377 Bacteria 3476
103 Ga0209026_1002061 3300025250 Bacteria 7917
104 Ga0209257_1005224 3300025304 Bacteria 9286
105 Ga0207697_10054393 3300025315 Bacteria 1658
106 Ga0207682_10000148 3300025893 Bacteria 31559
107 Ga0207699_10056984 3300025906 Bacteria 2332
108 Ga0207699_10195702 3300025906 Bacteria 1367
109 Ga0207684_10082562 3300025910 Bacteria 2737
110 Ga0207684_10663019 3300025910 Bacteria 888
111 Ga0207707_10007742 3300025912 Bacteria 9352
112 Ga0207707_10043631 3300025912 Bacteria 3910
113 Ga0207707_10059610 3300025912 Bacteria 3321
114 Ga0207695_10012361 3300025913 Bacteria 10255
115 Ga0207671_10121737 3300025914 Bacteria 1995
116 Ga0207693_10014557 3300025915 Bacteria 6321
117 Ga0207663_10021983 3300025916 Bacteria 3639
118 Ga0207660_10075437 3300025917 Bacteria 2464
119 Ga0207660_10129540 3300025917 Bacteria 1919
120 Ga0207652_10010009 3300025921 Bacteria 7636
121 Ga0207652_10026927 3300025921 Bacteria 4791
122 Ga0207652_10037570 3300025921 Bacteria 4099
123 Ga0207646_10093875 3300025922 Bacteria 2687
124 Ga0207681_10012714 3300025923 Bacteria 5199
125 Ga0207694_10015517 3300025924 Bacteria 5745
126 Ga0207694_10081456 3300025924 Bacteria 2543
127 Ga0207650_10040792 3300025925 Bacteria 3399
128 Ga0207650_10099176 3300025925 Bacteria 2239
129 Ga0207659_10002366 3300025926 Bacteria 11227
130 Ga0207700_10330843 3300025928 Bacteria 1322
131 Ga0207700_10390822 3300025928 Bacteria 1218
132 Ga0207664_10104883 3300025929 Bacteria 2341
133 Ga0207664_10228659 3300025929 Bacteria 1616
134 Ga0207670_10020569 3300025936 Bacteria 4058
135 Ga0207670_10071158 3300025936 Bacteria 2404
136 Ga0207669_10000454 3300025937 Bacteria 17837
137 Ga0207704_10036159 3300025938 Bacteria 2839
138 Ga0207665_10036189 3300025939 Bacteria 3281
139 Ga0207665_10121562 3300025939 Bacteria 1845
140 Ga0207665_10232438 3300025939 Bacteria 1355
141 Ga0207691_10000377 3300025940 Bacteria 44840
142 Ga0207661_10009972 3300025944 Bacteria 6825
143 Ga0207679_10265505 3300025945 Bacteria 1466
144 Ga0207667_10027660 3300025949 Bacteria 6169
145 Ga0207667_10120343 3300025949 Bacteria 2705
146 Ga0207667_10299870 3300025949 Bacteria 1642
147 Ga0207667_10690072 3300025949 Bacteria 1024
148 Ga0207651_10000579 3300025960 Bacteria 15365
149 Ga0207640_10231177 3300025981 Bacteria 1423
150 Ga0207640_10449703 3300025981 Bacteria 1061
151 Ga0207677_10066244 3300026023 Bacteria 2524
152 Ga0207703_10327541 3300026035 Bacteria 1404
153 Ga0207639_10149121 3300026041 Bacteria 1957
154 Ga0207708_10336224 3300026075 Bacteria 1236
155 Ga0207702_10001309 3300026078 Bacteria 24941
156 Ga0207648_10092330 3300026089 Bacteria 2647
157 Ga0207674_10230983 3300026116 Bacteria 1797
158 Ga0207674_10282874 3300026116 Bacteria 1607
159 Ga0207683_10000803 3300026121 Bacteria 28713
160 Ga0207683_10142929 3300026121 Bacteria 2157
161 Ga0209179_1020753 3300027512 Bacteria 1277
162 Ga0209588_1001764 3300027671 Bacteria 5738
163 Ga0209813_10000736 3300027866 Bacteria 7450
164 Ga0207428_10004402 3300027907 Bacteria 13417
165 Ga0268266_10015944 3300028379 Bacteria 6429
166 Ga0265330_10084628 3300031235 Bacteria 1364
167 Ga0265320_10096048 3300031240 Bacteria 1369
168 Ga0265320_10143045 3300031240 Bacteria 1082
169 Ga0265325_10011060 3300031241 Bacteria 5194
170 Ga0265340_10030186 3300031247 Bacteria 2718
171 Ga0265340_10180755 3300031247 Bacteria 953
172 Ga0265339_10017872 3300031249 Bacteria 4191
173 Ga0265316_10232430 3300031344 Bacteria 1357
174 Ga0307408_100030057 3300031548 Bacteria 3770
175 Ga0265313_10072339 3300031595 Bacteria 1585
176 Ga0265314_10000412 3300031711 Bacteria 57508
177 Ga0265314_10123138 3300031711 Bacteria 1629
178 Ga0307405_10139301 3300031731 Bacteria 1689
179 Ga0307510_10007295 3300033180 Bacteria 13167
180 Ga0373934_0031618 3300035086 Bacteria 2073
181 Ga0373923_0017999 3300035111 Bacteria 2711
182 Ga0373936_0021122 3300035113 Bacteria 2531
183 Ga0373936_0045110 3300035113 Bacteria 1775
184 Ga0373939_0046273 3300035114 Bacteria 1331
185 Ga0373945_0031887 3300035116 Bacteria 1864
186 Ga0373945_0048622 3300035116 Bacteria 1554
187 Ga0373954_0005774 3300035118 Bacteria 5374
188 Ga0373956_0029092 3300035119 Bacteria 2408
189 Ga0373956_0120557 3300035119 Bacteria 1225
190 Ga0373956_0128968 3300035119 Bacteria 1183
191 Ga0373957_0010810 3300035120 Bacteria 3029
192 Ga0373943_0063585 3300035170 Bacteria 1850
193 Ga0373943_0100130 3300035170 Bacteria 1514
194 Ga0373946_0077674 3300035171 Bacteria 1447
195 Ga0373955_0049989 3300035172 Bacteria 2272
196 Ga0373955_0214061 3300035172 Bacteria 1149
197 Ga0373924_0011673 3300035410 Bacteria 3267
198 Ga0373924_0014008 3300035410 Bacteria 3023
199 Ga0373924_0134794 3300035410 Bacteria 1075
200 Ga0373931_0193305 3300035691 Bacteria 1212
201 Ga0373935_0000854 3300035692 Bacteria 16418
202 Ga0373935_0042825 3300035692 Bacteria 2848
203 Ga0373935_0178457 3300035692 Bacteria 1457
204 Ga0373927_0001836 3300035695 Bacteria 15770
205 Ga0373927_0018511 3300035695 Bacteria 4577
206 Ga0373927_0025006 3300035695 Bacteria 3904
207 Ga0373927_0028451 3300035695 Bacteria 3645
208 Ga0373927_0125972 3300035695 Bacteria 1672
209 Ga0373927_0134894 3300035695 Bacteria 1613
210 Ga0373933_0000041 3300035724 Bacteria 79805
211 Ga0373933_0031432 3300035724 Bacteria 3080
212 Ga0373933_0200926 3300035724 Bacteria 1275
213 Ga0373947_0006130 3300035725 Bacteria 6995
214 Ga0373947_0015963 3300035725 Bacteria 4314
215 Ga0373947_0040588 3300035725 Bacteria 2772
216 Ga0373947_0095141 3300035725 Bacteria 1864
217 Ga0373937_0007183 3300036401 Bacteria 9633
218 Ga0373937_0215830 3300036401 Bacteria 1805
219 Ga0373937_0444176 3300036401 Bacteria 1231
220 Ga0373925_0004009 3300037068 Bacteria 11204
221 Ga0373925_0014885 3300037068 Bacteria 5621
222 Ga0373925_0075317 3300037068 Bacteria 2557
223 Ga0373925_0088202 3300037068 Bacteria 2369
224 Ga0395898_0009823 3300037466 Bacteria 10030
225 Ga0395905_0061862 3300037471 Bacteria 3502
226 Ga0436364_0525560 3300037853 Bacteria 1048
227 Ga0436364_1011150 3300037853 Bacteria 932
228 Ga0436364_1106476 3300037853 Bacteria 4173
229 Ga0436365_1774439 3300039437 Bacteria 1773
230 Ga0436360_0168349 3300039438 Bacteria 1262
231 Ga0436360_0408922 3300039438 Bacteria 1435
232 Ga0436360_0541205 3300039438 Bacteria 1425
233 Ga0436361_0444289 3300039447 Bacteria 3505
234 Ga0436361_0529928 3300039447 Bacteria 1034
235 Ga0436361_0532852 3300039447 Bacteria 9375
236 Ga0436361_1216070 3300039447 Bacteria 1898
237 Ga0436363_0036248 3300039450 Bacteria 1187
238 Ga0436363_0699116 3300039450 Bacteria 17143
239 Ga0436362_1045404 3300039453 Bacteria 2570
240 Ga0439435_0008571 3300042436 Bacteria 2374
241 Ga0466966_0080340 3300044684 Bacteria 2031
242 Ga0466966_0194744 3300044684 Bacteria 1227
243 Ga0466961_0304993 3300044693 Bacteria 972
244 Ga0466971_0080163 3300044719 Bacteria 1488
245 Ga0466960_0287964 3300044901 Bacteria 922
246 Ga0466958_0159137 3300045836 Bacteria 1426
247 Ga0466967_0310363 3300045976 Bacteria 1519
248 Ga0466967_0606435 3300045976 Bacteria 1081
249 Ga0495592_0017928 3300046454 Bacteria 5380
250 Ga0495592_0040711 3300046454 Bacteria 3486
251 Ga0495603_0000032 3300046455 Bacteria 59469
252 Ga0495603_0030606 3300046455 Bacteria 3241
253 Ga0495603_0036414 3300046455 Bacteria 2954
254 Ga0495603_0051934 3300046455 Bacteria 2435
255 Ga0495590_0023899 3300046457 Bacteria 2155
256 Ga0495629_0000094 3300046459 Bacteria 77297
257 Ga0495629_0106284 3300046459 Bacteria 1958
258 Ga0495638_0028090 3300046460 Bacteria 3635
259 Ga0495641_0001071 3300046461 Bacteria 23547
260 Ga0495651_0375794 3300046462 Bacteria 933
261 Ga0495653_0214268 3300046463 Bacteria 1299
262 Ga0495653_0240463 3300046463 Bacteria 1207
263 Ga0495653_0357740 3300046463 Bacteria 937
264 Ga0495580_0001375 3300046472 Bacteria 21338
265 Ga0495580_0043322 3300046472 Bacteria 3203
266 Ga0495582_0000030 3300046473 Bacteria 77594
267 Ga0495582_0023738 3300046473 Bacteria 3353
268 Ga0495582_0129536 3300046473 Bacteria 1425
269 Ga0495639_0000003 3300046475 Bacteria 118479
270 Ga0495639_0011505 3300046475 Bacteria 3816
271 Ga0495662_0000008 3300046476 Bacteria 71128
272 Ga0495664_0011558 3300046477 Bacteria 4979
273 Ga0495664_0035787 3300046477 Bacteria 2925
274 Ga0495664_0162674 3300046477 Bacteria 1354
275 Ga0495584_0080932 3300046491 Bacteria 1635
276 Ga0495584_0172249 3300046491 Bacteria 1100
277 Ga0495594_0000381 3300046499 Bacteria 22212
278 Ga0495594_0302053 3300046499 Bacteria 912
279 Ga0495608_0324611 3300046511 Bacteria 951
280 Ga0495618_0016543 3300046514 Bacteria 4514
281 Ga0495628_0028786 3300046516 Bacteria 4512
282 Ga0495628_0124324 3300046516 Bacteria 1977
283 Ga0495630_0024228 3300046517 Bacteria 4488
284 Ga0495666_0014206 3300046526 Bacteria 3967
285 Ga0495652_0024597 3300046529 Bacteria 5329
286 Ga0495665_0000001 3300046531 Bacteria 156121
287 Ga0495665_0032511 3300046531 Bacteria 2791
288 Ga0495640_0018387 3300046533 Bacteria 5186
289 Ga0495640_0047739 3300046533 Bacteria 2962
290 Ga0495586_0100864 3300046535 Bacteria 1602
291 Ga0495587_0041906 3300046536 Bacteria 2731
292 Ga0495587_0115363 3300046536 Bacteria 1541
293 Ga0495598_0015082 3300046537 Bacteria 1943
294 Ga0495621_0016088 3300046539 Bacteria 2395
295 Ga0495597_0061341 3300046542 Bacteria 1638
296 Ga0495645_0062446 3300046543 Bacteria 2698
297 Ga0495645_0124452 3300046543 Bacteria 1812
298 Ga0495622_0004966 3300046557 Bacteria 6162
299 Ga0495622_0019544 3300046557 Bacteria 3153
300 Ga0495622_0053579 3300046557 Bacteria 1872
301 Ga0495667_0006620 3300046559 Bacteria 7867
302 Ga0495634_0001001 3300046642 Bacteria 26654
303 Ga0495634_0028610 3300046642 Bacteria 3867
304 Ga0495634_0110904 3300046642 Bacteria 1764
305 Ga0495635_0032514 3300046663 Bacteria 3619
306 Ga0495635_0034992 3300046663 Bacteria 3483
307 Ga0495635_0045039 3300046663 Bacteria 3043
308 Ga0495588_0044685 3300046674 Bacteria 2270
309 Ga0495588_0084956 3300046674 Bacteria 1654
310 Ga0495657_0142598 3300046675 Bacteria 1492
311 Ga0495599_0016576 3300046678 Bacteria 4575
312 Ga0495623_0010948 3300046679 Bacteria 5869
313 Ga0495646_0025182 3300046680 Bacteria 3744
314 Ga0495646_0071427 3300046680 Bacteria 2042
315 Ga0495646_0125742 3300046680 Bacteria 1447
316 Ga0495647_0000582 3300046681 Bacteria 10816
317 Ga0495647_0106421 3300046681 Bacteria 1166
318 Ga0495658_0002447 3300046683 Bacteria 9349
319 Ga0495658_0035321 3300046683 Bacteria 2749
320 Ga0495613_0002985 3300046689 Bacteria 12667
321 Ga0495624_0000193 3300046690 Bacteria 46434
322 Ga0495624_0124789 3300046690 Bacteria 1580
323 Ga0495624_0154044 3300046690 Bacteria 1405
324 Ga0495624_0312233 3300046690 Bacteria 947
325 Ga0495589_0088282 3300046794 Bacteria 1506
326 Ga0495600_0024220 3300046809 Bacteria 3906
327 Ga0495600_0034975 3300046809 Bacteria 3262
328 Ga0495581_0000011 3300047315 Bacteria 63980
329 Ga0495581_0222561 3300047315 Bacteria 1103
330 Ga0495581_0229348 3300047315 Bacteria 1086
331 Ga0495604_0064710 3300047317 Bacteria 2785
332 Ga0495604_0226821 3300047317 Bacteria 1283
333 Ga0495674_0000031 3300047319 Bacteria 115867
334 Ga0495674_0016401 3300047319 Bacteria 6908
335 Ga0495674_0238038 3300047319 Bacteria 1501
336 Ga0495674_0366197 3300047319 Bacteria 1168
337 Ga0495672_0073089 3300047320 Bacteria 1935
338 Ga0495676_0008652 3300047321 Bacteria 9318
339 Ga0495676_0403682 3300047321 Bacteria 906
340 Ga0495680_0034448 3300047322 Bacteria 4088
341 Ga0495684_0050726 3300047471 Bacteria 3167
342 Ga0495684_0187060 3300047471 Bacteria 1533
343 Ga0495686_0020629 3300047472 Bacteria 4393
344 Ga0495593_0000231 3300047673 Bacteria 29745
345 Ga0495593_0118450 3300047673 Bacteria 1348
346 Ga0495602_0369150 3300048088 Bacteria 1031
347 Ga0495614_0034544 3300048089 Bacteria 2173
348 Ga0496102_0289356 3300048905 Bacteria 1544
349 Ga0496104_0022025 3300048907 Bacteria 5855
350 Ga0496104_0107156 3300048907 Bacteria 2678
351 Ga0496105_0009875 3300048908 Bacteria 7485
352 Ga0496105_0060669 3300048908 Bacteria 3121
353 Ga0496105_0189909 3300048908 Bacteria 1680
354 Ga0496106_0175532 3300048909 Bacteria 1700
355 Ga0496107_0209657 3300048910 Bacteria 1449
356 Ga0496108_0186755 3300048911 Bacteria 1796
357 Ga0496109_0041295 3300048912 Bacteria 4179
358 Ga0496110_0061547 3300048913 Bacteria 3313
359 Ga0496110_0471765 3300048913 Bacteria 1143
360 Ga0496111_0471944 3300048914 Bacteria 925
361 Ga0496112_0065094 3300048915 Bacteria 3597
362 Ga0496115_0159655 3300048918 Bacteria 1863
363 Ga0496121_0041395 3300048924 Bacteria 4026
364 Ga0496126_0084502 3300048929 Bacteria 2799
365 Ga0496126_0256510 3300048929 Bacteria 1455
366 Ga0501032_0015988 3300049569 Bacteria 5283
367 Ga0501032_0178355 3300049569 Bacteria 1392
368 Ga0501033_0032762 3300049570 Bacteria 3903
369 Ga0501034_0236769 3300049571 Bacteria 1773
370 Ga0501037_0032855 3300049573 Bacteria 3834
371 Ga0501039_0075176 3300049575 Bacteria 2626
372 Ga0501039_0353695 3300049575 Bacteria 1154
373 Ga0501041_0136099 3300049577 Bacteria 1531
374 Ga0501047_0013971 3300049581 Bacteria 7631
375 Ga0501047_0037288 3300049581 Bacteria 4700
376 Ga0501047_0100725 3300049581 Bacteria 2768
377 Ga0501069_0000174 3300049585 Bacteria 28891
378 Ga0501070_0000491 3300049586 Bacteria 35953
379 Ga0501070_0061901 3300049586 Bacteria 3100
380 Ga0501071_0043893 3300049587 Bacteria 3207
381 Ga0501071_0552354 3300049587 Bacteria 885
382 Ga0501072_0014327 3300049588 Bacteria 6077
383 Ga0501073_0147551 3300049589 Bacteria 1630
384 Ga0501073_0157471 3300049589 Bacteria 1574
385 Ga0501074_0020304 3300049590 Bacteria 4828
386 Ga0501074_0091285 3300049590 Bacteria 2181
387 Ga0501076_0014444 3300049592 Bacteria 5949
388 Ga0501076_0224917 3300049592 Bacteria 1534
389 Ga0501077_0230924 3300049593 Bacteria 1176
390 Ga0501079_0256415 3300049741 Bacteria 1367
391 Ga0501080_0034324 3300049742 Bacteria 4734
392 Ga0501080_0036748 3300049742 Bacteria 4572
393 Ga0501081_0348595 3300049743 Bacteria 1091
394 Ga0501035_0001612 3300049822 Bacteria 22817
395 Ga0501044_0001198 3300049823 Bacteria 30750
396 Ga0501044_0061265 3300049823 Bacteria 3850
397 Ga0501044_0121240 3300049823 Bacteria 2616
398 Ga0501045_0191085 3300049824 Bacteria 1526
399 nmdc:mga03n38_3296_c1 3300050490 Bacteria 5165
400 nmdc:mga00v17_56980_c1 3300050491 Bacteria 2390
401 nmdc:mga0yw44_503_c1 3300050492 Bacteria 13955
402 nmdc:mga06z11_552_c1 3300050494 Bacteria 13727
403 nmdc:mga04h51_9496_c1 3300050495 Bacteria 2640
404 nmdc:mga05p37_1068_c1 3300050507 Bacteria 31371
405 nmdc:mga05p37_240488_c1 3300050507 Bacteria 2177
406 nmdc:mga09592_425348_c1 3300050508 Bacteria 1147
407 nmdc:mga09592_582_c1 3300050508 Bacteria 27628
408 nmdc:mga0qj67_11444_c1 3300050509 Bacteria 6647
409 nmdc:mga06r32_125_c1 3300050510 Bacteria 55385
410 nmdc:mga08y16_835_c1 3300050511 Bacteria 29607
411 nmdc:mga0n895_30871_c1 3300050512 Bacteria 5126
412 nmdc:mga0rr50_117301_c1 3300050513 Bacteria 2114
413 nmdc:mga0sz30_124197_c1 3300050516 Bacteria 1135
414 Ga0495612_0026019 3300053078 Bacteria 2352
415 Ga0495595_0010305 3300053084 Bacteria 3883
416 Ga0495595_0062917 3300053084 Bacteria 1741
417 Ga0500647_0033027 3300053091 Bacteria 2466
418 Ga0500566_0000536 3300053094 Bacteria 21299
419 Ga0500640_002402 3300053095 Bacteria 6185
420 Ga0500572_000167 3300053111 Bacteria 22941
421 Ga0500595_004771 3300053119 Bacteria 6007
422 Ga0500608_056181 3300053122 Bacteria 1886
423 Ga0500614_001087 3300053123 Bacteria 6720
424 Ga0500655_006765 3300053133 Bacteria 2063
425 Ga0500559_0003193 3300053136 Bacteria 8148
426 Ga0500568_0078095 3300053139 Bacteria 1259
427 Ga0500603_003194 3300053150 Bacteria 3530
428 Ga0500616_0005679 3300053153 Bacteria 8409
429 Ga0500630_002206 3300053159 Bacteria 9414
430 Ga0500639_000001 3300053163 Bacteria 244795
431 Ga0500639_102543 3300053163 Bacteria 1405
432 Ga0500596_000149 3300053735 Bacteria 10700
433 Ga0501084_0151472 3300054114 Bacteria 1955
434 Ga0501084_0159249 3300054114 Bacteria 1904
435 Ga0501082_0203316 3300060353 Bacteria 1723
436 Ga0466962_0068247 3300061719 Bacteria 1698
437 Ga0530510_0003126 3300061734 Bacteria 11362
438 Ga0530510_0062793 3300061734 Bacteria 2689
439 2513656024 2513237096 Bacteria 8722461
440 2513671679 2513237098 Bacteria 9902361
441 2513889866 2513237141 Bacteria 8496279
442 2513917062 2513237145 Bacteria 8979722
443 2517895675 2517572143 Bacteria 9484767
444 2524466777 2524023210 Bacteria 9029266
445 2841961838 2841957949 Bacteria 8652217
446 2842334174 2842333319 Bacteria 8899485
447 2903769536 2903768456 Bacteria 9749579
448 2906639906 2906635258 Bacteria 8601019
449 2906662702 2906660503 Bacteria 8595048
450 2935782433 2935777560 Bacteria 8077691
451 8016524449 8016522445 Bacteria 8156687
452 8016538003 8016530956 Bacteria 8155261
453 8016542279 8016539877 Bacteria 8155419
454 8016559407 8016557553 Bacteria 8154380
455 8016567662 8016566248 Bacteria 8158151
456 8016580362 8016575299 Bacteria 8154085
457 8016597346 8016595262 Bacteria 8149947
458 8016604905 8016603502 Bacteria 8731218
459 8016620104 8016613128 Bacteria 8794220
460 8019539301 8019538911 Bacteria 7872763
461 8045866877 8045864390 Bacteria 5043873
462 8056685630 8056681323 Bacteria 8472857
463 8056694994 8056689827 Bacteria 6712655
464 Ga0495619_0206068
465 JGI24742J22300_10021539
466 rootH1_10111875
467 Ga0065165_1007440
468 Ga0065715_10033482
469 Ga0065715_10102828
470 Ga0065715_10218274
471 Ga0070670_100105480
472 Ga0070670_100137461
473 Ga0070677_10000024
474 Ga0070680_100089449
475 Ga0070680_100100349
476 Ga0068868_100045853
477 Ga0070689_100053653
478 Ga0070689_100086452
479 Ga0070669_100084254
480 Ga0070675_100000353
481 Ga0070671_100003775
482 Ga0070674_100000273
483 Ga0070667_100126849
484 Ga0070709_10007135
485 Ga0070709_10214806
486 Ga0070709_10223050
487 Ga0070714_100021600
488 Ga0070714_100067089
489 Ga0070713_100023989
490 Ga0070713_100075632
491 Ga0070713_100248139
492 Ga0070710_10088311
493 Ga0070711_100001130
494 Ga0070711_100030087
495 Ga0070711_100039210
496 Ga0070708_100090135
497 Ga0070678_100012068
498 Ga0070681_10005696
499 Ga0070681_10143790
500 Ga0068867_100070922
501 Ga0070685_10070242
502 Ga0070706_100051266
503 Ga0070707_100062252
504 Ga0070698_100647511
505 Ga0070699_100379522
506 Ga0070679_100003053
507 Ga0070679_100122268
508 Ga0070684_100046980
509 Ga0070672_100000405
510 Ga0070686_100062632
511 Ga0070665_100198061
512 Ga0068855_100053468
513 Ga0068855_100166002
514 Ga0068855_100359035
515 Ga0068855_100770899
516 Ga0070664_100119455
517 Ga0068857_100212183
518 Ga0068857_100858994
519 Ga0068854_100170507
520 Ga0068854_100192676
521 Ga0068856_100018516
522 Ga0068864_100166690
523 Ga0068861_100060885
524 Ga0068858_100237697
525 Ga0070717_10012707
526 Ga0075363_100000044
527 Ga0075363_100187888
528 Ga0075364_10000523
529 Ga0070716_100092125
530 Ga0070716_100130183
531 Ga0070712_100070119
532 Ga0070712_100096399
533 Ga0070712_100468146
534 Ga0075367_10000045
535 Ga0097621_100097115
536 Ga0068871_100077804
537 Ga0075428_100000587
538 Ga0075430_100027991
539 Ga0075430_100077609
540 Ga0075430_100150142
541 Ga0075431_100000130
542 Ga0075431_100144335
543 Ga0075431_100409940
544 Ga0075429_100018065
545 Ga0068865_100046818
546 Ga0075435_100133751
547 Ga0099794_10011307
548 Ga0105240_10014508
549 Ga0105240_10348858
550 Ga0114129_10000126
551 Ga0114129_10330904
552 Ga0105242_10186438
553 Ga0105237_10123276
554 Ga0105237_10128253
555 Ga0105238_10020841
556 Ga0105238_10021471
557 Ga0105238_10056096
558 Ga0157369_10015147
559 Ga0157369_10822292
560 Ga0157374_10141526
561 Ga0157378_10015391
562 Ga0157372_10012738
563 Ga0157380_10010129
564 Ga0163161_10091866
565 Ga0213874_10003542
566 Ga0209026_1002061
567 Ga0209257_1005224
568 Ga0207697_10054393
569 Ga0207682_10000148
570 Ga0207699_10056984
571 Ga0207699_10195702
572 Ga0207684_10082562
573 Ga0207684_10663019
574 Ga0207707_10007742
575 Ga0207707_10043631
576 Ga0207707_10059610
577 Ga0207695_10012361
578 Ga0207671_10121737
579 Ga0207693_10014557
580 Ga0207663_10021983
581 Ga0207660_10075437
582 Ga0207660_10129540
583 Ga0207652_10010009
584 Ga0207652_10026927
585 Ga0207652_10037570
586 Ga0207646_10093875
587 Ga0207681_10012714
588 Ga0207694_10015517
589 Ga0207694_10081456
590 Ga0207650_10040792
591 Ga0207650_10099176
592 Ga0207659_10002366
593 Ga0207700_10330843
594 Ga0207700_10390822
595 Ga0207664_10104883
596 Ga0207664_10228659
597 Ga0207670_10020569
598 Ga0207670_10071158
599 Ga0207669_10000454
600 Ga0207704_10036159
601 Ga0207665_10036189
602 Ga0207665_10121562
603 Ga0207665_10232438
604 Ga0207691_10000377
605 Ga0207661_10009972
606 Ga0207679_10265505
607 Ga0207667_10027660
608 Ga0207667_10120343
609 Ga0207667_10299870
610 Ga0207667_10690072
611 Ga0207651_10000579
612 Ga0207640_10231177
613 Ga0207640_10449703
614 Ga0207677_10066244
615 Ga0207703_10327541
616 Ga0207639_10149121
617 Ga0207708_10336224
618 Ga0207702_10001309
619 Ga0207648_10092330
620 Ga0207674_10230983
621 Ga0207674_10282874
622 Ga0207683_10000803
623 Ga0207683_10142929
624 Ga0209179_1020753
625 Ga0209588_1001764
626 Ga0209813_10000736
627 Ga0207428_10004402
628 Ga0268266_10015944
629 Ga0265330_10084628
630 Ga0265320_10096048
631 Ga0265320_10143045
632 Ga0265325_10011060
633 Ga0265340_10030186
634 Ga0265340_10180755
635 Ga0265339_10017872
636 Ga0265316_10232430
637 Ga0307408_100030057
638 Ga0265313_10072339
639 Ga0265314_10000412
640 Ga0265314_10123138
641 Ga0307405_10139301
642 Ga0307510_10007295
643 Ga0373934_0031618
644 Ga0373923_0017999
645 Ga0373936_0021122
646 Ga0373936_0045110
647 Ga0373939_0046273
648 Ga0373945_0031887
649 Ga0373945_0048622
650 Ga0373954_0005774
651 Ga0373956_0029092
652 Ga0373956_0120557
653 Ga0373956_0128968
654 Ga0373957_0010810
655 Ga0373943_0063585
656 Ga0373943_0100130
657 Ga0373946_0077674
658 Ga0373955_0049989
659 Ga0373955_0214061
660 Ga0373924_0011673
661 Ga0373924_0014008
662 Ga0373924_0134794
663 Ga0373931_0193305
664 Ga0373935_0000854
665 Ga0373935_0042825
666 Ga0373935_0178457
667 Ga0373927_0001836
668 Ga0373927_0018511
669 Ga0373927_0025006
670 Ga0373927_0028451
671 Ga0373927_0125972
672 Ga0373927_0134894
673 Ga0373933_0000041
674 Ga0373933_0031432
675 Ga0373933_0200926
676 Ga0373947_0006130
677 Ga0373947_0015963
678 Ga0373947_0040588
679 Ga0373947_0095141
680 Ga0373937_0007183
681 Ga0373937_0215830
682 Ga0373937_0444176
683 Ga0373925_0004009
684 Ga0373925_0014885
685 Ga0373925_0075317
686 Ga0373925_0088202
687 Ga0395898_0009823
688 Ga0395905_0061862
689 Ga0436364_0525560
690 Ga0436364_1011150
691 Ga0436364_1106476
692 Ga0436365_1774439
693 Ga0436360_0168349
694 Ga0436360_0408922
695 Ga0436360_0541205
696 Ga0436361_0444289
697 Ga0436361_0529928
698 Ga0436361_0532852
699 Ga0436361_1216070
700 Ga0436363_0036248
701 Ga0436363_0699116
702 Ga0436362_1045404
703 Ga0439435_0008571
704 Ga0466966_0080340
705 Ga0466966_0194744
706 Ga0466961_0304993
707 Ga0466971_0080163
708 Ga0466960_0287964
709 Ga0466958_0159137
710 Ga0466967_0310363
711 Ga0466967_0606435
712 Ga0495592_0017928
713 Ga0495592_0040711
714 Ga0495603_0000032
715 Ga0495603_0030606
716 Ga0495603_0036414
717 Ga0495603_0051934
718 Ga0495590_0023899
719 Ga0495629_0000094
720 Ga0495629_0106284
721 Ga0495638_0028090
722 Ga0495641_0001071
723 Ga0495651_0375794
724 Ga0495653_0214268
725 Ga0495653_0240463
726 Ga0495653_0357740
727 Ga0495580_0001375
728 Ga0495580_0043322
729 Ga0495582_0000030
730 Ga0495582_0023738
731 Ga0495582_0129536
732 Ga0495639_0000003
733 Ga0495639_0011505
734 Ga0495662_0000008
735 Ga0495664_0011558
736 Ga0495664_0035787
737 Ga0495664_0162674
738 Ga0495584_0080932
739 Ga0495584_0172249
740 Ga0495594_0000381
741 Ga0495594_0302053
742 Ga0495608_0324611
743 Ga0495618_0016543
744 Ga0495628_0028786
745 Ga0495628_0124324
746 Ga0495630_0024228
747 Ga0495666_0014206
748 Ga0495652_0024597
749 Ga0495665_0000001
750 Ga0495665_0032511
751 Ga0495640_0018387
752 Ga0495640_0047739
753 Ga0495586_0100864
754 Ga0495587_0041906
755 Ga0495587_0115363
756 Ga0495598_0015082
757 Ga0495621_0016088
758 Ga0495597_0061341
759 Ga0495645_0062446
760 Ga0495645_0124452
761 Ga0495622_0004966
762 Ga0495622_0019544
763 Ga0495622_0053579
764 Ga0495667_0006620
765 Ga0495634_0001001
766 Ga0495634_0028610
767 Ga0495634_0110904
768 Ga0495635_0032514
769 Ga0495635_0034992
770 Ga0495635_0045039
771 Ga0495588_0044685
772 Ga0495588_0084956
773 Ga0495657_0142598
774 Ga0495599_0016576
775 Ga0495623_0010948
776 Ga0495646_0025182
777 Ga0495646_0071427
778 Ga0495646_0125742
779 Ga0495647_0000582
780 Ga0495647_0106421
781 Ga0495658_0002447
782 Ga0495658_0035321
783 Ga0495613_0002985
784 Ga0495624_0000193
785 Ga0495624_0124789
786 Ga0495624_0154044
787 Ga0495624_0312233
788 Ga0495589_0088282
789 Ga0495600_0024220
790 Ga0495600_0034975
791 Ga0495581_0000011
792 Ga0495581_0222561
793 Ga0495581_0229348
794 Ga0495604_0064710
795 Ga0495604_0226821
796 Ga0495674_0000031
797 Ga0495674_0016401
798 Ga0495674_0238038
799 Ga0495674_0366197
800 Ga0495672_0073089
801 Ga0495676_0008652
802 Ga0495676_0403682
803 Ga0495680_0034448
804 Ga0495684_0050726
805 Ga0495684_0187060
806 Ga0495686_0020629
807 Ga0495593_0000231
808 Ga0495593_0118450
809 Ga0495602_0369150
810 Ga0495614_0034544
811 Ga0496102_0289356
812 Ga0496104_0022025
813 Ga0496104_0107156
814 Ga0496105_0009875
815 Ga0496105_0060669
816 Ga0496105_0189909
817 Ga0496106_0175532
818 Ga0496107_0209657
819 Ga0496108_0186755
820 Ga0496109_0041295
821 Ga0496110_0061547
822 Ga0496110_0471765
823 Ga0496111_0471944
824 Ga0496112_0065094
825 Ga0496115_0159655
826 Ga0496121_0041395
827 Ga0496126_0084502
828 Ga0496126_0256510
829 Ga0501032_0015988
830 Ga0501032_0178355
831 Ga0501033_0032762
832 Ga0501034_0236769
833 Ga0501037_0032855
834 Ga0501039_0075176
835 Ga0501039_0353695
836 Ga0501041_0136099
837 Ga0501047_0013971
838 Ga0501047_0037288
839 Ga0501047_0100725
840 Ga0501069_0000174
841 Ga0501070_0000491
842 Ga0501070_0061901
843 Ga0501071_0043893
844 Ga0501071_0552354
845 Ga0501072_0014327
846 Ga0501073_0147551
847 Ga0501073_0157471
848 Ga0501074_0020304
849 Ga0501074_0091285
850 Ga0501076_0014444
851 Ga0501076_0224917
852 Ga0501077_0230924
853 Ga0501079_0256415
854 Ga0501080_0034324
855 Ga0501080_0036748
856 Ga0501081_0348595
857 Ga0501035_0001612
858 Ga0501044_0001198
859 Ga0501044_0061265
860 Ga0501044_0121240
861 Ga0501045_0191085
862 nmdc:mga03n38_3296_c1
863 nmdc:mga00v17_56980_c1
864 nmdc:mga0yw44_503_c1
865 nmdc:mga06z11_552_c1
866 nmdc:mga04h51_9496_c1
867 nmdc:mga05p37_1068_c1
868 nmdc:mga05p37_240488_c1
869 nmdc:mga09592_425348_c1
870 nmdc:mga09592_582_c1
871 nmdc:mga0qj67_11444_c1
872 nmdc:mga06r32_125_c1
873 nmdc:mga08y16_835_c1
874 nmdc:mga0n895_30871_c1
875 nmdc:mga0rr50_117301_c1
876 nmdc:mga0sz30_124197_c1
877 Ga0495612_0026019
878 Ga0495595_0010305
879 Ga0495595_0062917
880 Ga0500647_0033027
881 Ga0500566_0000536
882 Ga0500640_002402
883 Ga0500572_000167
884 Ga0500595_004771
885 Ga0500608_056181
886 Ga0500614_001087
887 Ga0500655_006765
888 Ga0500559_0003193
889 Ga0500568_0078095
890 Ga0500603_003194
891 Ga0500616_0005679
892 Ga0500630_002206
893 Ga0500639_000001
894 Ga0500639_102543
895 Ga0500596_000149
896 Ga0501084_0151472
897 Ga0501084_0159249
898 Ga0501082_0203316
899 Ga0466962_0068247
900 Ga0530510_0003126
901 Ga0530510_0062793
902 2513656024
903 2513671679
904 2513889866
905 2513917062
906 2517895675
907 2524466777
908 2841961838
909 2842334174
910 2903769536
911 2906639906
912 2906662702
913 2935782433
914 8016524449
915 8016538003
916 8016542279
917 8016559407
918 8016567662
919 8016580362
920 8016597346
921 8016604905
922 8016620104
923 8019539301
924 8045866877
925 8056685630
926 8056694994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

54

306

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

59

243

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kqf-assembly1.cif.gz_B 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis. 0.9709 6 264
3kqf-assembly1.cif.gz_B 1.8 angstrom resolution crystal structure of enoyl-coa hydratase from bacillus anthracis. 0.9672 6 264
7eum-assembly1.cif.gz_C crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9526 8 250
5jbw-assembly1.cif.gz_A crystal structure of liuc 0.9487 4 264
2zqq-assembly1.cif.gz_C crystal structure of human auh (3-methylglutaconyl-coa hydratase) mixed with (auuu)24a rna 0.9487 6 264
ID Description Score Start End Superfamily
af_P76082_198_255_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.994 207 264 1.10.12.10
2qq3D02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.992 208 263 1.10.12.10
2zqqF02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9896 206 264 1.10.12.10
1hzdF02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9895 206 264 1.10.12.10
2zqqC02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9888 206 264 1.10.12.10
ID Description Score Start End GO Terms
AF-W4RKW3-F1-model_v4 Methylglutaconyl-CoA hydratase 0.9842 121 264 GO:0006635
GO:0016829
AF-A0A7W1LYZ4-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9829 110 264 GO:0006635
GO:0016829
GO:0016853
AF-A0A0A9I745-F1-model_v4 deleted 0.9792 149 264
AF-A0A1Y2N9D2-F1-model_v4 Putative enoyl-CoA hydratase echA8 (EC 4.2.1.17) 0.9773 98 262 GO:0004300
GO:0006635
AF-A0A7W0Y449-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.977 146 264 GO:0004300
GO:0006635

Map