F449180

General Info

Members Datasets Scaffolds Average Seq Length
463 210 463 106

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0001037|Ga0495686_0001037_10245_10634
Length 129
Sequence LPVHLVGVSTREGSRVASEGVITMPAIGYVTKSDDGSFKGQLKTLSIRADIHIVANHGKTADTQPDYRILSDGIEIGAGWTRRSETSGRDYVSLSLAAPEFGPRRLYANLGAAAGGAEDRFALIWNPAD

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 0.22
Rhizoplane 0.65
Rhizosphere 86.39
Stem 0
Stem Tuber 0
Unclassified 6.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000687 3300001979 Bacteria 14679
2 JGI24740J21852_10001302 3300001979 Bacteria 11345
3 JGI24739J22299_10001673 3300001989 Bacteria 8429
4 JGI24739J22299_10009315 3300001989 Bacteria 3663
5 JGI24737J22298_10012661 3300001990 Bacteria 2749
6 JGI24737J22298_10081996 3300001990 Bacteria 959
7 JGI24743J22301_10005961 3300001991 Bacteria 2056
8 JGI24735J21928_10004667 3300002067 Bacteria 4582
9 JGI24735J21928_10008753 3300002067 Bacteria 3266
10 JGI24738J21930_10000757 3300002075 Bacteria 9256
11 JGI24749J21850_1030117 3300002076 Bacteria 778
12 JGI25153J46596_10000005 3300003215 Bacteria 492839
13 rootL2_10011494 3300003322 Bacteria 1786
14 rootL2_10066562 3300003322 Bacteria 3110
15 Ga0055539_1019345 3300003752 Bacteria 816
16 Ga0055533_1019550 3300003756 Bacteria 625
17 Ga0055542_1000115 3300003762 Bacteria 106506
18 Ga0055529_1000052 3300003763 Bacteria 203029
19 Ga0065165_1009740 3300005262 Bacteria 4255
20 Ga0065165_1055254 3300005262 Bacteria 1109
21 Ga0070658_10000149 3300005327 Bacteria 61881
22 Ga0070658_10004086 3300005327 Bacteria 11954
23 Ga0070658_10047389 3300005327 Bacteria 3479
24 Ga0070658_10277362 3300005327 Bacteria 1426
25 Ga0070658_10457169 3300005327 Bacteria 1100
26 Ga0070658_10855700 3300005327 Bacteria 790
27 Ga0070676_10039410 3300005328 Bacteria 2732
28 Ga0070676_10121558 3300005328 Bacteria 1640
29 Ga0070683_100952705 3300005329 Bacteria 824
30 Ga0070670_100840284 3300005331 Unclassified 830
31 Ga0070677_10295863 3300005333 Bacteria 821
32 Ga0068869_100043435 3300005334 Bacteria 3228
33 Ga0070666_10114186 3300005335 Bacteria 1870
34 Ga0068868_100023987 3300005338 Bacteria 4623
35 Ga0070660_100212622 3300005339 Bacteria 1570
36 Ga0070660_100400665 3300005339 Bacteria 1135
37 Ga0070660_100850608 3300005339 Bacteria 768
38 Ga0070687_100285153 3300005343 Bacteria 1041
39 Ga0070661_100004976 3300005344 Bacteria 9153
40 Ga0070661_100161612 3300005344 Bacteria 1697
41 Ga0070661_100369230 3300005344 Bacteria 1129
42 Ga0070661_100486734 3300005344 Bacteria 986
43 Ga0070661_100545605 3300005344 Bacteria 932
44 Ga0070668_100045788 3300005347 Bacteria 3357
45 Ga0070669_100000916 3300005353 Bacteria 21441
46 Ga0070675_100371554 3300005354 Bacteria 1271
47 Ga0070674_100000169 3300005356 Bacteria 30506
48 Ga0070674_100295321 3300005356 Bacteria 1290
49 Ga0070673_100000020 3300005364 Bacteria 102632
50 Ga0070673_100008792 3300005364 Bacteria 6742
51 Ga0070688_101072526 3300005365 Unclassified 643
52 Ga0070659_100000240 3300005366 Bacteria 42863
53 Ga0070659_100261451 3300005366 Bacteria 1436
54 Ga0070659_101763441 3300005366 Bacteria 554
55 Ga0070667_100074896 3300005367 Bacteria 2889
56 Ga0070663_100036157 3300005455 Bacteria 3431
57 Ga0070663_100314397 3300005455 Bacteria 1258
58 Ga0070663_101793824 3300005455 Unclassified 550
59 Ga0070678_100000077 3300005456 Bacteria 37044
60 Ga0070678_101092154 3300005456 Unclassified 736
61 Ga0070662_100047932 3300005457 Bacteria 3076
62 Ga0070681_11993040 3300005458 Bacteria 509
63 Ga0068867_100000660 3300005459 Bacteria 22843
64 Ga0068867_100000863 3300005459 Bacteria 20449
65 Ga0068867_100398435 3300005459 Bacteria 1160
66 Ga0070684_100731121 3300005535 Bacteria 923
67 Ga0068853_100000281 3300005539 Bacteria 35996
68 Ga0068853_100006894 3300005539 Bacteria 9069
69 Ga0068853_100026730 3300005539 Bacteria 4848
70 Ga0068853_100333415 3300005539 Bacteria 1408
71 Ga0068853_100836618 3300005539 Bacteria 882
72 Ga0068853_101678887 3300005539 Bacteria 616
73 Ga0070672_100058159 3300005543 Bacteria 3037
74 Ga0070672_100096740 3300005543 Bacteria 2389
75 Ga0070693_100728483 3300005547 Unclassified 729
76 Ga0070665_100000051 3300005548 Bacteria 249317
77 Ga0068855_100000062 3300005563 Bacteria 131470
78 Ga0068855_100003517 3300005563 Bacteria 19169
79 Ga0068855_100046926 3300005563 Bacteria 5105
80 Ga0068855_100196688 3300005563 Bacteria 2271
81 Ga0068855_100307387 3300005563 Bacteria 1755
82 Ga0068855_100326580 3300005563 Bacteria 1694
83 Ga0068855_101625270 3300005563 Bacteria 661
84 Ga0070664_100066829 3300005564 Bacteria 3071
85 Ga0070664_100168652 3300005564 Bacteria 1941
86 Ga0068857_100007852 3300005577 Bacteria 9204
87 Ga0068854_100003389 3300005578 Bacteria 9929
88 Ga0068854_100204079 3300005578 Bacteria 1556
89 Ga0068854_100266857 3300005578 Bacteria 1373
90 Ga0068854_100857050 3300005578 Bacteria 796
91 Ga0068856_100002482 3300005614 Bacteria 18981
92 Ga0068856_100003049 3300005614 Bacteria 17140
93 Ga0068856_100854591 3300005614 Bacteria 929
94 Ga0068856_101148556 3300005614 Unclassified 793
95 Ga0070702_100553223 3300005615 Bacteria 854
96 Ga0068852_100099192 3300005616 Bacteria 2625
97 Ga0068852_100600759 3300005616 Bacteria 1104
98 Ga0068852_100610886 3300005616 Bacteria 1095
99 Ga0068852_100924861 3300005616 Unclassified 890
100 Ga0068859_100345043 3300005617 Bacteria 1583
101 Ga0068864_100643905 3300005618 Bacteria 1031
102 Ga0068861_100964586 3300005719 Bacteria 812
103 Ga0068863_100008045 3300005841 Bacteria 10297
104 Ga0068858_100000769 3300005842 Bacteria 33482
105 Ga0068858_100004175 3300005842 Bacteria 14217
106 Ga0068858_100006004 3300005842 Bacteria 11861
107 Ga0068860_100755035 3300005843 Bacteria 984
108 Ga0068862_100097199 3300005844 Bacteria 2571
109 Ga0081455_10017127 3300005937 Bacteria 6962
110 Ga0070717_10068448 3300006028 Bacteria 2955
111 Ga0075367_10329102 3300006178 Bacteria 963
112 Ga0097621_100367576 3300006237 Bacteria 1283
113 Ga0097621_100748727 3300006237 Bacteria 902
114 Ga0068871_100003441 3300006358 Bacteria 10883
115 Ga0068871_101578310 3300006358 Unclassified 621
116 Ga0068865_100007395 3300006881 Bacteria 6758
117 Ga0068865_101193681 3300006881 Bacteria 673
118 Ga0097620_100345040 3300006931 Bacteria 1583
119 Ga0105240_10005888 3300009093 Bacteria 18156
120 Ga0105240_10030235 3300009093 Bacteria 7041
121 Ga0105240_10066501 3300009093 Bacteria 4471
122 Ga0105240_10754144 3300009093 Bacteria 1058
123 Ga0105240_10959500 3300009093 Bacteria 917
124 Ga0105240_11458994 3300009093 Bacteria 718
125 Ga0105240_12583776 3300009093 Bacteria 525
126 Ga0111539_10364821 3300009094 Unclassified 1681
127 Ga0105245_10046568 3300009098 Bacteria 3875
128 Ga0105245_10227884 3300009098 Bacteria 1801
129 Ga0105245_10827975 3300009098 Bacteria 965
130 Ga0105243_10000441 3300009148 Bacteria 43295
131 Ga0105243_10005663 3300009148 Bacteria 9723
132 Ga0105243_10545061 3300009148 Bacteria 1107
133 Ga0105243_10729919 3300009148 Bacteria 969
134 Ga0105241_10069788 3300009174 Bacteria 2725
135 Ga0105241_10122086 3300009174 Bacteria 2099
136 Ga0105242_10000155 3300009176 Bacteria 50755
137 Ga0105242_11942527 3300009176 Unclassified 630
138 Ga0105248_10059666 3300009177 Bacteria 4285
139 Ga0105248_10242079 3300009177 Bacteria 2031
140 Ga0105237_10011817 3300009545 Bacteria 9235
141 Ga0105237_10079484 3300009545 Bacteria 3269
142 Ga0105237_10219015 3300009545 Bacteria 1904
143 Ga0105238_10107389 3300009551 Bacteria 2772
144 Ga0105238_12214332 3300009551 Bacteria 584
145 Ga0105249_13142598 3300009553 Bacteria 531
146 Ga0105035_123174 3300009988 Bacteria 595
147 Ga0105239_10164816 3300010375 Bacteria 2478
148 Ga0105246_10016822 3300011119 Bacteria 4640
149 Ga0105246_10025537 3300011119 Bacteria 3851
150 Ga0105246_10077487 3300011119 Bacteria 2358
151 Ga0157373_10074357 3300013100 Bacteria 2397
152 Ga0157373_10572405 3300013100 Bacteria 821
153 Ga0157373_10793043 3300013100 Bacteria 698
154 Ga0157373_11218846 3300013100 Unclassified 568
155 Ga0157371_10029476 3300013102 Bacteria 3968
156 Ga0157371_10196966 3300013102 Bacteria 1443
157 Ga0157371_10610881 3300013102 Bacteria 812
158 Ga0157370_10037013 3300013104 Bacteria 4733
159 Ga0157370_10059007 3300013104 Bacteria 3647
160 Ga0157370_10118401 3300013104 Bacteria 2474
161 Ga0157370_10280180 3300013104 Bacteria 1540
162 Ga0157370_10482739 3300013104 Bacteria 1139
163 Ga0157370_11116292 3300013104 Bacteria 712
164 Ga0157369_10000201 3300013105 Bacteria 82836
165 Ga0157369_10001623 3300013105 Bacteria 27487
166 Ga0157369_10001890 3300013105 Bacteria 25252
167 Ga0157369_10003926 3300013105 Bacteria 17636
168 Ga0157369_10021630 3300013105 Bacteria 7193
169 Ga0157369_10088801 3300013105 Bacteria 3300
170 Ga0157369_10634632 3300013105 Bacteria 1102
171 Ga0157369_11028408 3300013105 Bacteria 843
172 Ga0157369_11258526 3300013105 Bacteria 755
173 Ga0157374_10001402 3300013296 Bacteria 20438
174 Ga0157378_10000451 3300013297 Bacteria 39296
175 Ga0157378_10357318 3300013297 Bacteria 1429
176 Ga0157378_11462622 3300013297 Bacteria 727
177 Ga0163162_10099039 3300013306 Bacteria 3005
178 Ga0157372_10001845 3300013307 Bacteria 22966
179 Ga0157372_10004582 3300013307 Bacteria 14700
180 Ga0157372_10388112 3300013307 Bacteria 1627
181 Ga0157372_10418289 3300013307 Bacteria 1562
182 Ga0157372_10973474 3300013307 Bacteria 983
183 Ga0157375_10001434 3300013308 Bacteria 20527
184 Ga0157375_10692962 3300013308 Bacteria 1173
185 Ga0157377_10199940 3300014745 Bacteria 1268
186 Ga0157376_10006033 3300014969 Bacteria 8519
187 Ga0157376_13003724 3300014969 Bacteria 511
188 Ga0163161_10058762 3300017792 Bacteria 2795
189 Ga0213872_10086445 3300021361 Bacteria 1405
190 Ga0213876_10405686 3300021384 Bacteria 725
191 Ga0209674_104276 3300025226 Bacteria 2357
192 Ga0209674_113417 3300025226 Bacteria 762
193 Ga0207427_101613 3300025231 Bacteria 7672
194 Ga0209677_106742 3300025253 Bacteria 2633
195 Ga0209677_114298 3300025253 Bacteria 1088
196 Ga0209148_1000011 3300025254 Bacteria 1196503
197 Ga0209233_1000041 3300025261 Bacteria 515463
198 Ga0209233_1034251 3300025261 Bacteria 1158
199 Ga0209455_1000006 3300025272 Bacteria 1196503
200 Ga0207673_1032765 3300025290 Unclassified 722
201 Ga0209758_1000001 3300025297 Bacteria 1981790
202 Ga0209257_1009116 3300025304 Bacteria 5416
203 Ga0209257_1034200 3300025304 Bacteria 1589
204 Ga0207697_10000093 3300025315 Bacteria 40647
205 Ga0207713_1094698 3300025735 Bacteria 1042
206 Ga0207688_10000061 3300025901 Bacteria 39296
207 Ga0207688_10283688 3300025901 Bacteria 1009
208 Ga0207647_10000393 3300025904 Bacteria 35865
209 Ga0207647_10029375 3300025904 Bacteria 3559
210 Ga0207647_10042722 3300025904 Bacteria 2841
211 Ga0207647_10061867 3300025904 Bacteria 2282
212 Ga0207647_10627682 3300025904 Unclassified 591
213 Ga0207645_10006527 3300025907 Bacteria 8355
214 Ga0207645_10565603 3300025907 Bacteria 771
215 Ga0207645_10713183 3300025907 Bacteria 682
216 Ga0207705_10000022 3300025909 Bacteria 302232
217 Ga0207705_10000888 3300025909 Bacteria 24464
218 Ga0207705_10002504 3300025909 Bacteria 14159
219 Ga0207705_10018814 3300025909 Bacteria 4941
220 Ga0207705_10020838 3300025909 Bacteria 4680
221 Ga0207705_10231202 3300025909 Bacteria 1406
222 Ga0207705_10239036 3300025909 Bacteria 1383
223 Ga0207705_10395039 3300025909 Bacteria 1069
224 Ga0207705_11007260 3300025909 Bacteria 643
225 Ga0207705_11314302 3300025909 Bacteria 552
226 Ga0207654_10289587 3300025911 Bacteria 1110
227 Ga0207707_11399964 3300025912 Bacteria 558
228 Ga0207695_10004085 3300025913 Bacteria 20052
229 Ga0207695_10009747 3300025913 Bacteria 11821
230 Ga0207695_10111540 3300025913 Bacteria 2714
231 Ga0207695_10120020 3300025913 Bacteria 2599
232 Ga0207695_10617764 3300025913 Bacteria 965
233 Ga0207695_10640642 3300025913 Bacteria 944
234 Ga0207695_10777644 3300025913 Bacteria 837
235 Ga0207671_10006317 3300025914 Bacteria 10579
236 Ga0207671_10901133 3300025914 Bacteria 699
237 Ga0207660_11182358 3300025917 Bacteria 622
238 Ga0207662_11034501 3300025918 Unclassified 583
239 Ga0207657_10000437 3300025919 Bacteria 44331
240 Ga0207657_10077367 3300025919 Bacteria 2804
241 Ga0207657_10358765 3300025919 Bacteria 1149
242 Ga0207649_10000077 3300025920 Bacteria 83350
243 Ga0207649_10000927 3300025920 Bacteria 18447
244 Ga0207649_10227766 3300025920 Bacteria 1331
245 Ga0207649_10259957 3300025920 Bacteria 1254
246 Ga0207649_10477580 3300025920 Bacteria 945
247 Ga0207649_10547540 3300025920 Bacteria 885
248 Ga0207649_10808725 3300025920 Bacteria 732
249 Ga0207649_11153980 3300025920 Bacteria 612
250 Ga0207652_10000340 3300025921 Bacteria 48581
251 Ga0207694_10308483 3300025924 Bacteria 1304
252 Ga0207694_10432622 3300025924 Bacteria 1097
253 Ga0207659_10394159 3300025926 Bacteria 1157
254 Ga0207659_10527585 3300025926 Bacteria 1002
255 Ga0207687_10140177 3300025927 Bacteria 1833
256 Ga0207687_10248910 3300025927 Bacteria 1412
257 Ga0207690_10001140 3300025932 Bacteria 16917
258 Ga0207690_10348236 3300025932 Bacteria 1171
259 Ga0207706_10000185 3300025933 Bacteria 69659
260 Ga0207686_10000528 3300025934 Bacteria 24751
261 Ga0207709_10000093 3300025935 Bacteria 139110
262 Ga0207709_10003311 3300025935 Bacteria 9649
263 Ga0207709_10449378 3300025935 Bacteria 996
264 Ga0207709_10506126 3300025935 Bacteria 943
265 Ga0207669_10000200 3300025937 Bacteria 27331
266 Ga0207691_10016347 3300025940 Bacteria 7043
267 Ga0207691_10368649 3300025940 Bacteria 1227
268 Ga0207711_10000784 3300025941 Bacteria 31210
269 Ga0207711_10442938 3300025941 Bacteria 1209
270 Ga0207689_10000014 3300025942 Bacteria 122534
271 Ga0207679_10106324 3300025945 Bacteria 2206
272 Ga0207667_10000071 3300025949 Bacteria 178355
273 Ga0207667_10000220 3300025949 Bacteria 80179
274 Ga0207667_10003476 3300025949 Bacteria 19447
275 Ga0207667_10006015 3300025949 Bacteria 14767
276 Ga0207667_10071047 3300025949 Bacteria 3621
277 Ga0207667_10077749 3300025949 Bacteria 3440
278 Ga0207667_10081859 3300025949 Bacteria 3344
279 Ga0207667_11436578 3300025949 Bacteria 662
280 Ga0207667_12238174 3300025949 Bacteria 503
281 Ga0207651_10000001 3300025960 Bacteria 516823
282 Ga0207651_10005682 3300025960 Bacteria 6433
283 Ga0207651_10674549 3300025960 Bacteria 909
284 Ga0207640_10073242 3300025981 Bacteria 2314
285 Ga0207640_10092457 3300025981 Bacteria 2098
286 Ga0207640_10095050 3300025981 Bacteria 2074
287 Ga0207640_10442775 3300025981 Bacteria 1069
288 Ga0207640_10779866 3300025981 Bacteria 826
289 Ga0207658_10007495 3300025986 Bacteria 7434
290 Ga0207703_10000686 3300026035 Bacteria 33490
291 Ga0207703_10001589 3300026035 Bacteria 20561
292 Ga0207703_10002625 3300026035 Bacteria 15510
293 Ga0207639_10000267 3300026041 Bacteria 37378
294 Ga0207639_10000381 3300026041 Bacteria 30545
295 Ga0207639_10125386 3300026041 Bacteria 2117
296 Ga0207639_10298320 3300026041 Bacteria 1424
297 Ga0207639_10743139 3300026041 Unclassified 912
298 Ga0207678_10014433 3300026067 Bacteria 6946
299 Ga0207678_10033658 3300026067 Bacteria 4464
300 Ga0207678_10186916 3300026067 Bacteria 1770
301 Ga0207678_10398773 3300026067 Bacteria 1191
302 Ga0207702_10000211 3300026078 Bacteria 69152
303 Ga0207702_10002141 3300026078 Bacteria 18987
304 Ga0207702_10053042 3300026078 Bacteria 3433
305 Ga0207702_10763326 3300026078 Bacteria 955
306 Ga0207702_11586089 3300026078 Bacteria 648
307 Ga0207641_10323395 3300026088 Bacteria 1463
308 Ga0207648_10002352 3300026089 Bacteria 20407
309 Ga0207648_10436984 3300026089 Bacteria 1190
310 Ga0207648_10591676 3300026089 Bacteria 1022
311 Ga0207676_10006948 3300026095 Bacteria 8021
312 Ga0207674_10003948 3300026116 Bacteria 18040
313 Ga0207674_10189254 3300026116 Bacteria 2008
314 Ga0207674_11349712 3300026116 Bacteria 682
315 Ga0207675_100084460 3300026118 Bacteria 2979
316 Ga0207683_10000370 3300026121 Bacteria 41260
317 Ga0207698_10091944 3300026142 Bacteria 2485
318 Ga0207698_10155033 3300026142 Bacteria 1994
319 Ga0207698_10374661 3300026142 Bacteria 1352
320 Ga0207698_11856450 3300026142 Bacteria 618
321 Ga0209974_10428035 3300027876 Bacteria 523
322 Ga0268266_10000002 3300028379 Bacteria 3059047
323 Ga0268265_11478431 3300028380 Unclassified 683
324 Ga0307517_10033374 3300028786 Bacteria 5913
325 Ga0314311_1113016 3300030733 Bacteria 806
326 Ga0307408_100446962 3300031548 Bacteria 1120
327 Ga0265314_10084231 3300031711 Bacteria 2088
328 Ga0307405_10000144 3300031731 Bacteria 27364
329 Ga0307405_10017898 3300031731 Bacteria 3899
330 Ga0307405_11210996 3300031731 Bacteria 653
331 Ga0307406_12130808 3300031901 Bacteria 503
332 Ga0307412_10012529 3300031911 Bacteria 4947
333 Ga0307412_10074055 3300031911 Bacteria 2332
334 Ga0307412_10099625 3300031911 Bacteria 2052
335 Ga0307412_10605665 3300031911 Bacteria 928
336 Ga0307409_100312863 3300031995 Bacteria 1466
337 Ga0307416_100303526 3300032002 Bacteria 1588
338 Ga0307414_10032236 3300032004 Bacteria 3447
339 Ga0307414_10158682 3300032004 Bacteria 1794
340 Ga0307411_10516357 3300032005 Bacteria 1013
341 Ga0307510_10006809 3300033180 Bacteria 13632
342 Ga0307510_10011300 3300033180 Bacteria 10609
343 Ga0315911_1000026 3300033442 Bacteria 88844
344 Ga0395899_0000503 3300037312 Bacteria 43549
345 Ga0395899_0002028 3300037312 Bacteria 16671
346 Ga0395899_0048511 3300037312 Bacteria 3160
347 Ga0395899_0128777 3300037312 Bacteria 1809
348 Ga0395899_0175108 3300037312 Bacteria 1509
349 Ga0395899_0294095 3300037312 Bacteria 1101
350 Ga0395899_0331705 3300037312 Bacteria 1022
351 Ga0395899_0342685 3300037312 Bacteria 1002
352 Ga0395900_0000130 3300037418 Bacteria 126231
353 Ga0395900_0000545 3300037418 Bacteria 52739
354 Ga0395900_0006310 3300037418 Bacteria 12366
355 Ga0395900_0021321 3300037418 Bacteria 6624
356 Ga0395900_0124495 3300037418 Bacteria 2644
357 Ga0395900_0183005 3300037418 Bacteria 2128
358 Ga0395900_0190791 3300037418 Bacteria 2078
359 Ga0395900_0196517 3300037418 Unclassified 2043
360 Ga0395900_0243000 3300037418 Bacteria 1805
361 Ga0395900_0291076 3300037418 Bacteria 1622
362 Ga0395900_0343768 3300037418 Bacteria 1467
363 Ga0395900_0640886 3300037418 Bacteria 1000
364 Ga0395900_1311124 3300037418 Bacteria 638
365 Ga0395900_1444709 3300037418 Unclassified 600
366 Ga0395900_1606153 3300037418 Bacteria 562
367 Ga0395898_0000315 3300037466 Bacteria 111811
368 Ga0395898_0000618 3300037466 Bacteria 65182
369 Ga0395898_0003840 3300037466 Bacteria 16653
370 Ga0395898_0010115 3300037466 Bacteria 9874
371 Ga0395898_0106797 3300037466 Bacteria 2685
372 Ga0395898_0152348 3300037466 Bacteria 2212
373 Ga0395898_0402990 3300037466 Unclassified 1304
374 Ga0395898_0475525 3300037466 Bacteria 1189
375 Ga0395905_0000005 3300037471 Bacteria 557808
376 Ga0395905_0000366 3300037471 Bacteria 64169
377 Ga0395905_0013396 3300037471 Bacteria 7857
378 Ga0395905_0105330 3300037471 Bacteria 2648
379 Ga0395905_0113545 3300037471 Bacteria 2545
380 Ga0395905_0127900 3300037471 Bacteria 2389
381 Ga0395905_0191599 3300037471 Bacteria 1918
382 Ga0395905_0269003 3300037471 Bacteria 1590
383 Ga0395905_0454223 3300037471 Unclassified 1179
384 Ga0395905_0530936 3300037471 Bacteria 1077
385 Ga0395905_0786480 3300037471 Unclassified 854
386 Ga0395905_1019508 3300037471 Bacteria 731
387 Ga0395905_1383604 3300037471 Bacteria 608
388 Ga0395901_0000242 3300038443 Bacteria 68210
389 Ga0395901_0000613 3300038443 Bacteria 41465
390 Ga0395901_0001921 3300038443 Bacteria 21401
391 Ga0395901_0021882 3300038443 Bacteria 6553
392 Ga0395901_0036551 3300038443 Bacteria 5078
393 Ga0395901_0128904 3300038443 Bacteria 2659
394 Ga0395901_0176508 3300038443 Bacteria 2241
395 Ga0395901_0355269 3300038443 Bacteria 1512
396 Ga0395901_0566735 3300038443 Bacteria 1149
397 Ga0395901_1082839 3300038443 Unclassified 773
398 Ga0395901_1105264 3300038443 Bacteria 763
399 Ga0436365_0289234 3300039437 Bacteria 737
400 Ga0436365_0525660 3300039437 Bacteria 710
401 Ga0436360_1041238 3300039438 Bacteria 2216
402 Ga0436361_0627452 3300039447 Bacteria 7876
403 Ga0439445_0077420 3300042004 Bacteria 926
404 Ga0439448_0036838 3300042005 Bacteria 1570
405 Ga0439462_0003622 3300042015 Bacteria 3718
406 Ga0466966_0000019 3300044684 Bacteria 120521
407 Ga0466959_0464320 3300045049 Bacteria 858
408 Ga0466967_1123195 3300045976 Bacteria 783
409 Ga0495584_0500382 3300046491 Bacteria 619
410 Ga0495583_0085937 3300046506 Bacteria 1361
411 Ga0495606_0001772 3300046507 Bacteria 27645
412 Ga0495606_0005057 3300046507 Bacteria 12837
413 Ga0495637_0182045 3300046520 Bacteria 779
414 Ga0495643_0000332 3300046522 Bacteria 64478
415 Ga0495643_0464599 3300046522 Bacteria 549
416 Ga0495648_0074501 3300046524 Bacteria 1955
417 Ga0495597_0153921 3300046542 Bacteria 942
418 Ga0495668_0323376 3300046616 Bacteria 846
419 Ga0495611_0012478 3300046648 Bacteria 3612
420 Ga0495625_0157191 3300046660 Bacteria 1525
421 Ga0495686_0000808 3300047472 Bacteria 40566
422 Ga0495686_0001037 3300047472 Bacteria 33361
423 Ga0495686_0005769 3300047472 Bacteria 9673
424 Ga0495686_0243177 3300047472 Bacteria 1014
425 Ga0495626_0001229 3300048091 Bacteria 21051
426 Ga0496102_0650560 3300048905 Bacteria 977
427 Ga0496111_0178604 3300048914 Bacteria 1578
428 Ga0496115_0730490 3300048918 Bacteria 776
429 Ga0496116_0001227 3300048919 Bacteria 29879
430 Ga0496117_0015197 3300048920 Bacteria 6584
431 Ga0496118_0132302 3300048921 Bacteria 1599
432 Ga0496118_0185415 3300048921 Bacteria 1251
433 Ga0496118_0231811 3300048921 Bacteria 1065
434 Ga0496121_0000190 3300048924 Bacteria 136607
435 Ga0496121_0003943 3300048924 Bacteria 20528
436 Ga0496121_0007984 3300048924 Bacteria 12637
437 Ga0496121_0033933 3300048924 Bacteria 4605
438 Ga0496122_0033770 3300048925 Bacteria 4201
439 Ga0496122_0082072 3300048925 Bacteria 2241
440 Ga0496122_0516720 3300048925 Bacteria 577
441 Ga0496123_0060872 3300048926 Bacteria 2431
442 Ga0496123_0075395 3300048926 Bacteria 2082
443 Ga0496123_0105617 3300048926 Bacteria 1625
444 Ga0496124_0000188 3300048927 Bacteria 122361
445 Ga0496124_0000590 3300048927 Bacteria 61136
446 Ga0496124_0115323 3300048927 Bacteria 2156
447 Ga0496125_0003553 3300048928 Bacteria 18780
448 Ga0496126_0058552 3300048929 Bacteria 3472
449 Ga0501047_0644309 3300049581 Bacteria 879
450 Ga0501044_0020888 3300049823 Bacteria 6990
451 Ga0501044_0045912 3300049823 Bacteria 4525
452 nmdc:mga0yw44_13017_c2 3300050492 Bacteria 4066
453 nmdc:mga06z11_580685_c1 3300050494 Bacteria 681
454 nmdc:mga07m45_367904_c1 3300050496 Bacteria 835
455 nmdc:mga08y16_58341_c1 3300050511 Bacteria 4033
456 Ga0500610_0000042 3300053079 Bacteria 41981
457 Ga0500643_011255 3300053087 Bacteria 3274
458 Ga0500566_0000595 3300053094 Bacteria 20247
459 Ga0500556_0059784 3300053104 Bacteria 1401
460 Ga0500568_0312711 3300053139 Bacteria 570
461 Ga0500573_0000036 3300053140 Bacteria 110394
462 Ga0500645_000034 3300053730 Bacteria 116363
463 Ga0500596_000424 3300053735 Bacteria 7777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_367904_c1 nmdc:mga07m45_367904_c1_221_583 95
2 3300045976 Ga0466967_1123195 Ga0466967_1123195_239_553 103
3 3300025304 Ga0209257_1034200 Ga0209257_10342004 104
4 3300030733 Ga0314311_1113016 Ga0314311_11130162 104
5 3300048919 Ga0496116_0001227 Ga0496116_0001227_26156_26488 104
6 3300001979 JGI24740J21852_10001302 JGI24740J21852_1000130216 105
7 3300001989 JGI24739J22299_10009315 JGI24739J22299_100093155 105
8 3300001990 JGI24737J22298_10012661 JGI24737J22298_100126615 105
9 3300001990 JGI24737J22298_10081996 JGI24737J22298_100819962 105
10 3300001991 JGI24743J22301_10005961 JGI24743J22301_100059615 105
11 3300002067 JGI24735J21928_10008753 JGI24735J21928_100087535 105
12 3300002075 JGI24738J21930_10000757 JGI24738J21930_1000075713 105
13 3300002076 JGI24749J21850_1030117 JGI24749J21850_10301171 105
14 3300003215 JGI25153J46596_10000005 JGI25153J46596_1000000516 105
15 3300003322 rootL2_10011494 rootL2_100114944 105
16 3300003322 rootL2_10066562 rootL2_100665623 105
17 3300003752 Ga0055539_1019345 Ga0055539_10193451 105
18 3300003756 Ga0055533_1019550 Ga0055533_10195501 105
19 3300005262 Ga0065165_1009740 Ga0065165_10097403 105
20 3300005327 Ga0070658_10000149 Ga0070658_1000014935 105
21 3300005327 Ga0070658_10004086 Ga0070658_100040862 105
22 3300005327 Ga0070658_10047389 Ga0070658_100473892 105
23 3300005327 Ga0070658_10277362 Ga0070658_102773621 105
24 3300005327 Ga0070658_10457169 Ga0070658_104571691 105
25 3300005328 Ga0070676_10039410 Ga0070676_100394101 105
26 3300005328 Ga0070676_10121558 Ga0070676_101215583 105
27 3300005329 Ga0070683_100952705 Ga0070683_1009527051 105
28 3300005331 Ga0070670_100840284 Ga0070670_1008402841 105
29 3300005333 Ga0070677_10295863 Ga0070677_102958632 105
30 3300005334 Ga0068869_100043435 Ga0068869_1000434353 105
31 3300005335 Ga0070666_10114186 Ga0070666_101141862 105
32 3300005338 Ga0068868_100023987 Ga0068868_1000239876 105
33 3300005339 Ga0070660_100212622 Ga0070660_1002126223 105
34 3300005339 Ga0070660_100400665 Ga0070660_1004006651 105
35 3300005339 Ga0070660_100850608 Ga0070660_1008506081 105
36 3300005343 Ga0070687_100285153 Ga0070687_1002851531 105
37 3300005344 Ga0070661_100004976 Ga0070661_1000049767 105
38 3300005344 Ga0070661_100161612 Ga0070661_1001616122 105
39 3300005344 Ga0070661_100369230 Ga0070661_1003692302 105
40 3300005344 Ga0070661_100486734 Ga0070661_1004867341 105
41 3300005344 Ga0070661_100545605 Ga0070661_1005456051 105
42 3300005347 Ga0070668_100045788 Ga0070668_1000457884 105
43 3300005353 Ga0070669_100000916 Ga0070669_1000009162 105
44 3300005354 Ga0070675_100371554 Ga0070675_1003715541 105
45 3300005356 Ga0070674_100000169 Ga0070674_10000016910 105
46 3300005356 Ga0070674_100295321 Ga0070674_1002953211 105
47 3300005364 Ga0070673_100000020 Ga0070673_10000002034 105
48 3300005364 Ga0070673_100008792 Ga0070673_1000087929 105
49 3300005365 Ga0070688_101072526 Ga0070688_1010725261 105
50 3300005366 Ga0070659_100000240 Ga0070659_10000024044 105
51 3300005366 Ga0070659_100261451 Ga0070659_1002614512 105
52 3300005366 Ga0070659_101763441 Ga0070659_1017634411 105
53 3300005367 Ga0070667_100074896 Ga0070667_1000748962 105
54 3300005455 Ga0070663_100036157 Ga0070663_1000361577 105
55 3300005455 Ga0070663_100314397 Ga0070663_1003143971 105
56 3300005455 Ga0070663_101793824 Ga0070663_1017938242 105
57 3300005456 Ga0070678_100000077 Ga0070678_10000007710 105
58 3300005456 Ga0070678_101092154 Ga0070678_1010921541 105
59 3300005457 Ga0070662_100047932 Ga0070662_1000479322 105
60 3300005458 Ga0070681_11993040 Ga0070681_119930401 105
61 3300005459 Ga0068867_100000660 Ga0068867_1000006602 105
62 3300005459 Ga0068867_100000863 Ga0068867_10000086313 105
63 3300005459 Ga0068867_100398435 Ga0068867_1003984352 105
64 3300005535 Ga0070684_100731121 Ga0070684_1007311212 105
65 3300005539 Ga0068853_100000281 Ga0068853_10000028125 105
66 3300005539 Ga0068853_100006894 Ga0068853_1000068942 105
67 3300005539 Ga0068853_100026730 Ga0068853_1000267301 105
68 3300005539 Ga0068853_100836618 Ga0068853_1008366181 105
69 3300005539 Ga0068853_101678887 Ga0068853_1016788871 105
70 3300005543 Ga0070672_100058159 Ga0070672_1000581594 105
71 3300005543 Ga0070672_100096740 Ga0070672_1000967404 105
72 3300005547 Ga0070693_100728483 Ga0070693_1007284831 105
73 3300005548 Ga0070665_100000051 Ga0070665_10000005173 105
74 3300005563 Ga0068855_100000062 Ga0068855_10000006256 105
75 3300005563 Ga0068855_100003517 Ga0068855_10000351717 105
76 3300005563 Ga0068855_100046926 Ga0068855_1000469262 105
77 3300005563 Ga0068855_100196688 Ga0068855_1001966884 105
78 3300005563 Ga0068855_100307387 Ga0068855_1003073873 105
79 3300005563 Ga0068855_100326580 Ga0068855_1003265801 105
80 3300005563 Ga0068855_101625270 Ga0068855_1016252702 105
81 3300005564 Ga0070664_100066829 Ga0070664_1000668292 105
82 3300005577 Ga0068857_100007852 Ga0068857_1000078522 105
83 3300005578 Ga0068854_100204079 Ga0068854_1002040792 105
84 3300005578 Ga0068854_100266857 Ga0068854_1002668572 105
85 3300005614 Ga0068856_100002482 Ga0068856_10000248210 105
86 3300005614 Ga0068856_100003049 Ga0068856_10000304916 105
87 3300005614 Ga0068856_101148556 Ga0068856_1011485561 105
88 3300005615 Ga0070702_100553223 Ga0070702_1005532231 105
89 3300005616 Ga0068852_100600759 Ga0068852_1006007592 105
90 3300005616 Ga0068852_100610886 Ga0068852_1006108863 105
91 3300005616 Ga0068852_100924861 Ga0068852_1009248611 105
92 3300005617 Ga0068859_100345043 Ga0068859_1003450432 105
93 3300005618 Ga0068864_100643905 Ga0068864_1006439052 105
94 3300005719 Ga0068861_100964586 Ga0068861_1009645862 105
95 3300005841 Ga0068863_100008045 Ga0068863_1000080452 105
96 3300005842 Ga0068858_100000769 Ga0068858_10000076911 105
97 3300005842 Ga0068858_100004175 Ga0068858_10000417519 105
98 3300005842 Ga0068858_100006004 Ga0068858_1000060043 105
99 3300005843 Ga0068860_100755035 Ga0068860_1007550351 105
100 3300005844 Ga0068862_100097199 Ga0068862_1000971994 105
101 3300005937 Ga0081455_10017127 Ga0081455_100171271 105
102 3300006028 Ga0070717_10068448 Ga0070717_100684482 105
103 3300006237 Ga0097621_100367576 Ga0097621_1003675762 105
104 3300006237 Ga0097621_100748727 Ga0097621_1007487271 105
105 3300006358 Ga0068871_100003441 Ga0068871_1000034419 105
106 3300006358 Ga0068871_101578310 Ga0068871_1015783101 105
107 3300006881 Ga0068865_100007395 Ga0068865_1000073952 105
108 3300006881 Ga0068865_101193681 Ga0068865_1011936811 105
109 3300006931 Ga0097620_100345040 Ga0097620_1003450402 105
110 3300009093 Ga0105240_10005888 Ga0105240_100058881 105
111 3300009093 Ga0105240_10754144 Ga0105240_107541443 105
112 3300009093 Ga0105240_10959500 Ga0105240_109595001 105
113 3300009093 Ga0105240_11458994 Ga0105240_114589941 105
114 3300009093 Ga0105240_12583776 Ga0105240_125837762 105
115 3300009094 Ga0111539_10364821 Ga0111539_103648211 105
116 3300009098 Ga0105245_10227884 Ga0105245_102278842 105
117 3300009098 Ga0105245_10827975 Ga0105245_108279751 105
118 3300009148 Ga0105243_10000441 Ga0105243_1000044112 105
119 3300009148 Ga0105243_10005663 Ga0105243_100056632 105
120 3300009148 Ga0105243_10545061 Ga0105243_105450612 105
121 3300009148 Ga0105243_10729919 Ga0105243_107299192 105
122 3300009174 Ga0105241_10069788 Ga0105241_100697882 105
123 3300009174 Ga0105241_10122086 Ga0105241_101220863 105
124 3300009176 Ga0105242_10000155 Ga0105242_100001555 105
125 3300009176 Ga0105242_11942527 Ga0105242_119425272 105
126 3300009177 Ga0105248_10059666 Ga0105248_100596663 105
127 3300009545 Ga0105237_10011817 Ga0105237_100118173 105
128 3300009545 Ga0105237_10079484 Ga0105237_100794844 105
129 3300009545 Ga0105237_10219015 Ga0105237_102190152 105
130 3300009551 Ga0105238_10107389 Ga0105238_101073893 105
131 3300009551 Ga0105238_12214332 Ga0105238_122143322 105
132 3300010375 Ga0105239_10164816 Ga0105239_101648161 105
133 3300011119 Ga0105246_10016822 Ga0105246_100168222 105
134 3300011119 Ga0105246_10025537 Ga0105246_100255375 105
135 3300013100 Ga0157373_10074357 Ga0157373_100743573 105
136 3300013100 Ga0157373_10572405 Ga0157373_105724052 105
137 3300013100 Ga0157373_10793043 Ga0157373_107930431 105
138 3300013100 Ga0157373_11218846 Ga0157373_112188461 105
139 3300013102 Ga0157371_10029476 Ga0157371_100294764 105
140 3300013102 Ga0157371_10196966 Ga0157371_101969662 105
141 3300013102 Ga0157371_10610881 Ga0157371_106108812 105
142 3300013104 Ga0157370_10037013 Ga0157370_100370134 105
143 3300013104 Ga0157370_10059007 Ga0157370_100590073 105
144 3300013104 Ga0157370_10280180 Ga0157370_102801802 105
145 3300013104 Ga0157370_10482739 Ga0157370_104827392 105
146 3300013104 Ga0157370_11116292 Ga0157370_111162922 105
147 3300013105 Ga0157369_10000201 Ga0157369_1000020122 105
148 3300013105 Ga0157369_10001623 Ga0157369_100016239 105
149 3300013105 Ga0157369_10003926 Ga0157369_1000392611 105
150 3300013105 Ga0157369_10021630 Ga0157369_100216305 105
151 3300013105 Ga0157369_10088801 Ga0157369_100888014 105
152 3300013105 Ga0157369_10634632 Ga0157369_106346322 105
153 3300013105 Ga0157369_11028408 Ga0157369_110284081 105
154 3300013105 Ga0157369_11258526 Ga0157369_112585261 105
155 3300013296 Ga0157374_10001402 Ga0157374_1000140212 105
156 3300013297 Ga0157378_10357318 Ga0157378_103573181 105
157 3300013297 Ga0157378_11462622 Ga0157378_114626221 105
158 3300013306 Ga0163162_10099039 Ga0163162_100990394 105
159 3300013307 Ga0157372_10001845 Ga0157372_1000184521 105
160 3300013307 Ga0157372_10388112 Ga0157372_103881121 105
161 3300013307 Ga0157372_10418289 Ga0157372_104182892 105
162 3300013307 Ga0157372_10973474 Ga0157372_109734741 105
163 3300013308 Ga0157375_10001434 Ga0157375_1000143415 105
164 3300013308 Ga0157375_10692962 Ga0157375_106929622 105
165 3300014745 Ga0157377_10199940 Ga0157377_101999402 105
166 3300014969 Ga0157376_10006033 Ga0157376_100060335 105
167 3300014969 Ga0157376_13003724 Ga0157376_130037241 105
168 3300021384 Ga0213876_10405686 Ga0213876_104056861 105
169 3300025226 Ga0209674_104276 Ga0209674_1042761 105
170 3300025226 Ga0209674_113417 Ga0209674_1134172 105
171 3300025231 Ga0207427_101613 Ga0207427_1016138 105
172 3300025253 Ga0209677_106742 Ga0209677_1067422 105
173 3300025253 Ga0209677_114298 Ga0209677_1142982 105
174 3300025261 Ga0209233_1000041 Ga0209233_1000041431 105
175 3300025290 Ga0207673_1032765 Ga0207673_10327651 105
176 3300025297 Ga0209758_1000001 Ga0209758_100000116 105
177 3300025315 Ga0207697_10000093 Ga0207697_1000009342 105
178 3300025901 Ga0207688_10000061 Ga0207688_100000612 105
179 3300025901 Ga0207688_10283688 Ga0207688_102836881 105
180 3300025904 Ga0207647_10000393 Ga0207647_100003933 105
181 3300025904 Ga0207647_10029375 Ga0207647_100293751 105
182 3300025904 Ga0207647_10042722 Ga0207647_100427224 105
183 3300025904 Ga0207647_10061867 Ga0207647_100618673 105
184 3300025904 Ga0207647_10627682 Ga0207647_106276821 105
185 3300025907 Ga0207645_10006527 Ga0207645_100065278 105
186 3300025907 Ga0207645_10565603 Ga0207645_105656031 105
187 3300025907 Ga0207645_10713183 Ga0207645_107131832 105
188 3300025909 Ga0207705_10000022 Ga0207705_10000022149 105
189 3300025909 Ga0207705_10000888 Ga0207705_1000088815 105
190 3300025909 Ga0207705_10018814 Ga0207705_100188145 105
191 3300025909 Ga0207705_10020838 Ga0207705_100208387 105
192 3300025909 Ga0207705_10231202 Ga0207705_102312021 105
193 3300025909 Ga0207705_10239036 Ga0207705_102390361 105
194 3300025909 Ga0207705_10395039 Ga0207705_103950392 105
195 3300025909 Ga0207705_11314302 Ga0207705_113143021 105
196 3300025911 Ga0207654_10289587 Ga0207654_102895872 105
197 3300025912 Ga0207707_11399964 Ga0207707_113999642 105
198 3300025913 Ga0207695_10004085 Ga0207695_100040857 105
199 3300025913 Ga0207695_10009747 Ga0207695_100097471 105
200 3300025913 Ga0207695_10120020 Ga0207695_101200203 105
201 3300025913 Ga0207695_10640642 Ga0207695_106406421 105
202 3300025913 Ga0207695_10777644 Ga0207695_107776443 105
203 3300025914 Ga0207671_10006317 Ga0207671_1000631711 105
204 3300025914 Ga0207671_10901133 Ga0207671_109011333 105
205 3300025917 Ga0207660_11182358 Ga0207660_111823581 105
206 3300025918 Ga0207662_11034501 Ga0207662_110345011 105
207 3300025919 Ga0207657_10000437 Ga0207657_100004373 105
208 3300025919 Ga0207657_10077367 Ga0207657_100773673 105
209 3300025919 Ga0207657_10358765 Ga0207657_103587653 105
210 3300025920 Ga0207649_10000927 Ga0207649_100009277 105
211 3300025920 Ga0207649_10259957 Ga0207649_102599571 105
212 3300025920 Ga0207649_10477580 Ga0207649_104775801 105
213 3300025920 Ga0207649_10547540 Ga0207649_105475403 105
214 3300025920 Ga0207649_10808725 Ga0207649_108087251 105
215 3300025920 Ga0207649_11153980 Ga0207649_111539801 105
216 3300025924 Ga0207694_10308483 Ga0207694_103084832 105
217 3300025924 Ga0207694_10432622 Ga0207694_104326222 105
218 3300025926 Ga0207659_10394159 Ga0207659_103941592 105
219 3300025926 Ga0207659_10527585 Ga0207659_105275852 105
220 3300025927 Ga0207687_10140177 Ga0207687_101401772 105
221 3300025927 Ga0207687_10248910 Ga0207687_102489101 105
222 3300025932 Ga0207690_10001140 Ga0207690_1000114023 105
223 3300025932 Ga0207690_10348236 Ga0207690_103482362 105
224 3300025933 Ga0207706_10000185 Ga0207706_1000018546 105
225 3300025934 Ga0207686_10000528 Ga0207686_1000052816 105
226 3300025935 Ga0207709_10000093 Ga0207709_1000009312 105
227 3300025935 Ga0207709_10003311 Ga0207709_1000331110 105
228 3300025935 Ga0207709_10449378 Ga0207709_104493782 105
229 3300025935 Ga0207709_10506126 Ga0207709_105061262 105
230 3300025937 Ga0207669_10000200 Ga0207669_1000020020 105
231 3300025940 Ga0207691_10016347 Ga0207691_100163472 105
232 3300025940 Ga0207691_10368649 Ga0207691_103686492 105
233 3300025941 Ga0207711_10000784 Ga0207711_100007841 105
234 3300025942 Ga0207689_10000014 Ga0207689_100000142 105
235 3300025949 Ga0207667_10000071 Ga0207667_10000071122 105
236 3300025949 Ga0207667_10000220 Ga0207667_100002203 105
237 3300025949 Ga0207667_10003476 Ga0207667_1000347618 105
238 3300025949 Ga0207667_10006015 Ga0207667_100060151 105
239 3300025949 Ga0207667_10071047 Ga0207667_100710474 105
240 3300025949 Ga0207667_10077749 Ga0207667_100777494 105
241 3300025949 Ga0207667_10081859 Ga0207667_100818594 105
242 3300025949 Ga0207667_11436578 Ga0207667_114365782 105
243 3300025949 Ga0207667_12238174 Ga0207667_122381741 105
244 3300025960 Ga0207651_10000001 Ga0207651_1000000133 105
245 3300025960 Ga0207651_10005682 Ga0207651_100056829 105
246 3300025960 Ga0207651_10674549 Ga0207651_106745492 105
247 3300025981 Ga0207640_10073242 Ga0207640_100732421 105
248 3300025981 Ga0207640_10095050 Ga0207640_100950502 105
249 3300025981 Ga0207640_10442775 Ga0207640_104427752 105
250 3300025986 Ga0207658_10007495 Ga0207658_100074956 105
251 3300026035 Ga0207703_10000686 Ga0207703_1000068623 105
252 3300026035 Ga0207703_10001589 Ga0207703_100015892 105
253 3300026035 Ga0207703_10002625 Ga0207703_1000262513 105
254 3300026041 Ga0207639_10000267 Ga0207639_1000026724 105
255 3300026041 Ga0207639_10000381 Ga0207639_100003811 105
256 3300026041 Ga0207639_10743139 Ga0207639_107431392 105
257 3300026067 Ga0207678_10014433 Ga0207678_100144336 105
258 3300026067 Ga0207678_10033658 Ga0207678_100336584 105
259 3300026067 Ga0207678_10186916 Ga0207678_101869162 105
260 3300026067 Ga0207678_10398773 Ga0207678_103987732 105
261 3300026078 Ga0207702_10002141 Ga0207702_1000214112 105
262 3300026078 Ga0207702_10053042 Ga0207702_100530425 105
263 3300026078 Ga0207702_10763326 Ga0207702_107633263 105
264 3300026078 Ga0207702_11586089 Ga0207702_115860893 105
265 3300026088 Ga0207641_10323395 Ga0207641_103233952 105
266 3300026089 Ga0207648_10002352 Ga0207648_100023527 105
267 3300026089 Ga0207648_10436984 Ga0207648_104369841 105
268 3300026089 Ga0207648_10591676 Ga0207648_105916762 105
269 3300026095 Ga0207676_10006948 Ga0207676_100069489 105
270 3300026116 Ga0207674_10003948 Ga0207674_100039482 105
271 3300026116 Ga0207674_10189254 Ga0207674_101892544 105
272 3300026116 Ga0207674_11349712 Ga0207674_113497121 105
273 3300026118 Ga0207675_100084460 Ga0207675_1000844601 105
274 3300026121 Ga0207683_10000370 Ga0207683_100003708 105
275 3300026142 Ga0207698_10091944 Ga0207698_100919442 105
276 3300026142 Ga0207698_10374661 Ga0207698_103746611 105
277 3300026142 Ga0207698_11856450 Ga0207698_118564501 105
278 3300028379 Ga0268266_10000002 Ga0268266_100000022713 105
279 3300028380 Ga0268265_11478431 Ga0268265_114784311 105
280 3300031731 Ga0307405_11210996 Ga0307405_112109961 105
281 3300031911 Ga0307412_10074055 Ga0307412_100740553 105
282 3300031995 Ga0307409_100312863 Ga0307409_1003128632 105
283 3300032002 Ga0307416_100303526 Ga0307416_1003035264 105
284 3300032004 Ga0307414_10032236 Ga0307414_100322365 105
285 3300032004 Ga0307414_10158682 Ga0307414_101586822 105
286 3300032005 Ga0307411_10516357 Ga0307411_105163571 105
287 3300033180 Ga0307510_10006809 Ga0307510_1000680913 105
288 3300037312 Ga0395899_0000503 Ga0395899_0000503_37214_37534 105
289 3300037312 Ga0395899_0002028 Ga0395899_0002028_1851_2171 105
290 3300037312 Ga0395899_0048511 Ga0395899_0048511_1082_1423 105
291 3300037312 Ga0395899_0128777 Ga0395899_0128777_599_919 105
292 3300037312 Ga0395899_0175108 Ga0395899_0175108_295_615 105
293 3300037312 Ga0395899_0294095 Ga0395899_0294095_288_608 105
294 3300037312 Ga0395899_0331705 Ga0395899_0331705_407_727 105
295 3300037312 Ga0395899_0342685 Ga0395899_0342685_665_985 105
296 3300037418 Ga0395900_0000130 Ga0395900_0000130_17002_17322 105
297 3300037418 Ga0395900_0000545 Ga0395900_0000545_35871_36191 105
298 3300037418 Ga0395900_0006310 Ga0395900_0006310_7411_7731 105
299 3300037418 Ga0395900_0021321 Ga0395900_0021321_4117_4458 105
300 3300037418 Ga0395900_0124495 Ga0395900_0124495_986_1306 105
301 3300037418 Ga0395900_0183005 Ga0395900_0183005_618_938 105
302 3300037418 Ga0395900_0190791 Ga0395900_0190791_238_558 105
303 3300037418 Ga0395900_0196517 Ga0395900_0196517_978_1298 105
304 3300037418 Ga0395900_0243000 Ga0395900_0243000_592_966 105
305 3300037418 Ga0395900_0291076 Ga0395900_0291076_570_890 105
306 3300037418 Ga0395900_0343768 Ga0395900_0343768_425_745 105
307 3300037418 Ga0395900_0640886 Ga0395900_0640886_57_377 105
308 3300037418 Ga0395900_1444709 Ga0395900_1444709_201_521 105
309 3300037418 Ga0395900_1606153 Ga0395900_1606153_101_421 105
310 3300037466 Ga0395898_0000315 Ga0395898_0000315_37245_37565 105
311 3300037466 Ga0395898_0000618 Ga0395898_0000618_48903_49223 105
312 3300037466 Ga0395898_0003840 Ga0395898_0003840_13433_13753 105
313 3300037466 Ga0395898_0010115 Ga0395898_0010115_3665_3985 105
314 3300037466 Ga0395898_0106797 Ga0395898_0106797_2210_2551 105
315 3300037466 Ga0395898_0152348 Ga0395898_0152348_166_486 105
316 3300037466 Ga0395898_0402990 Ga0395898_0402990_620_940 105
317 3300037466 Ga0395898_0475525 Ga0395898_0475525_100_420 105
318 3300037471 Ga0395905_0000005 Ga0395905_0000005_398019_398339 105
319 3300037471 Ga0395905_0000366 Ga0395905_0000366_48903_49223 105
320 3300037471 Ga0395905_0013396 Ga0395905_0013396_3588_3908 105
321 3300037471 Ga0395905_0105330 Ga0395905_0105330_16_336 105
322 3300037471 Ga0395905_0113545 Ga0395905_0113545_1707_2027 105
323 3300037471 Ga0395905_0127900 Ga0395905_0127900_734_1054 105
324 3300037471 Ga0395905_0191599 Ga0395905_0191599_1521_1841 105
325 3300037471 Ga0395905_0269003 Ga0395905_0269003_31_357 105
326 3300037471 Ga0395905_0454223 Ga0395905_0454223_27_347 105
327 3300037471 Ga0395905_0530936 Ga0395905_0530936_655_975 105
328 3300037471 Ga0395905_0786480 Ga0395905_0786480_247_567 105
329 3300037471 Ga0395905_1019508 Ga0395905_1019508_171_491 105
330 3300037471 Ga0395905_1383604 Ga0395905_1383604_101_421 105
331 3300038443 Ga0395901_0000242 Ga0395901_0000242_35236_35556 105
332 3300038443 Ga0395901_0000613 Ga0395901_0000613_8627_8947 105
333 3300038443 Ga0395901_0001921 Ga0395901_0001921_17555_17875 105
334 3300038443 Ga0395901_0021882 Ga0395901_0021882_4461_4781 105
335 3300038443 Ga0395901_0036551 Ga0395901_0036551_67_387 105
336 3300038443 Ga0395901_0128904 Ga0395901_0128904_901_1221 105
337 3300038443 Ga0395901_0176508 Ga0395901_0176508_1867_2187 105
338 3300038443 Ga0395901_0355269 Ga0395901_0355269_1016_1336 105
339 3300038443 Ga0395901_0566735 Ga0395901_0566735_787_1107 105
340 3300038443 Ga0395901_1082839 Ga0395901_1082839_98_418 105
341 3300038443 Ga0395901_1105264 Ga0395901_1105264_71_391 105
342 3300039437 Ga0436365_0289234 Ga0436365_0289234_175_495 105
343 3300042005 Ga0439448_0036838 Ga0439448_0036838_822_1142 105
344 3300044684 Ga0466966_0000019 Ga0466966_0000019_28136_28456 105
345 3300045049 Ga0466959_0464320 Ga0466959_0464320_405_725 105
346 3300046491 Ga0495584_0500382 Ga0495584_0500382_133_453 105
347 3300046507 Ga0495606_0001772 Ga0495606_0001772_14029_14349 105
348 3300046507 Ga0495606_0005057 Ga0495606_0005057_12485_12805 105
349 3300046520 Ga0495637_0182045 Ga0495637_0182045_87_404 105
350 3300046522 Ga0495643_0000332 Ga0495643_0000332_63438_63767 105
351 3300046542 Ga0495597_0153921 Ga0495597_0153921_102_422 105
352 3300046648 Ga0495611_0012478 Ga0495611_0012478_53_373 105
353 3300046660 Ga0495625_0157191 Ga0495625_0157191_308_625 105
354 3300047472 Ga0495686_0001037 Ga0495686_0001037_10245_10634 105
355 3300047472 Ga0495686_0005769 Ga0495686_0005769_1330_1650 105
356 3300047472 Ga0495686_0243177 Ga0495686_0243177_322_642 105
357 3300048914 Ga0496111_0178604 Ga0496111_0178604_1172_1492 105
358 3300048920 Ga0496117_0015197 Ga0496117_0015197_6254_6571 105
359 3300048921 Ga0496118_0132302 Ga0496118_0132302_15_332 105
360 3300048921 Ga0496118_0231811 Ga0496118_0231811_118_438 105
361 3300048924 Ga0496121_0007984 Ga0496121_0007984_1205_1525 105
362 3300048924 Ga0496121_0033933 Ga0496121_0033933_3010_3327 105
363 3300048925 Ga0496122_0033770 Ga0496122_0033770_1045_1365 105
364 3300048925 Ga0496122_0516720 Ga0496122_0516720_233_550 105
365 3300048926 Ga0496123_0075395 Ga0496123_0075395_1244_1564 105
366 3300048926 Ga0496123_0105617 Ga0496123_0105617_13_330 105
367 3300048927 Ga0496124_0000590 Ga0496124_0000590_23864_24184 105
368 3300050511 nmdc:mga08y16_58341_c1 nmdc:mga08y16_58341_c1_2094_2414 105
369 3300053079 Ga0500610_0000042 Ga0500610_0000042_25180_25500 105
370 3300053094 Ga0500566_0000595 Ga0500566_0000595_4215_4535 105
371 3300053104 Ga0500556_0059784 Ga0500556_0059784_83_403 105
372 3300053140 Ga0500573_0000036 Ga0500573_0000036_20709_21029 105
373 3300053730 Ga0500645_000034 Ga0500645_000034_61774_62094 105
374 3300053735 Ga0500596_000424 Ga0500596_000424_7399_7719 105
375 3300002067 JGI24735J21928_10004667 JGI24735J21928_100046676 106
376 3300003762 Ga0055542_1000115 Ga0055542_100011579 106
377 3300003763 Ga0055529_1000052 Ga0055529_1000052104 106
378 3300005262 Ga0065165_1055254 Ga0065165_10552541 106
379 3300005539 Ga0068853_100333415 Ga0068853_1003334153 106
380 3300005564 Ga0070664_100168652 Ga0070664_1001686524 106
381 3300005578 Ga0068854_100857050 Ga0068854_1008570502 106
382 3300005614 Ga0068856_100854591 Ga0068856_1008545912 106
383 3300005616 Ga0068852_100099192 Ga0068852_1000991922 106
384 3300006178 Ga0075367_10329102 Ga0075367_103291021 106
385 3300009093 Ga0105240_10030235 Ga0105240_100302357 106
386 3300009098 Ga0105245_10046568 Ga0105245_100465684 106
387 3300009177 Ga0105248_10242079 Ga0105248_102420793 106
388 3300009553 Ga0105249_13142598 Ga0105249_131425981 106
389 3300009988 Ga0105035_123174 Ga0105035_1231741 106
390 3300011119 Ga0105246_10077487 Ga0105246_100774873 106
391 3300013104 Ga0157370_10118401 Ga0157370_101184013 106
392 3300013297 Ga0157378_10000451 Ga0157378_1000045144 106
393 3300017792 Ga0163161_10058762 Ga0163161_100587624 106
394 3300021361 Ga0213872_10086445 Ga0213872_100864452 106
395 3300025254 Ga0209148_1000011 Ga0209148_1000011445 106
396 3300025261 Ga0209233_1034251 Ga0209233_10342512 106
397 3300025272 Ga0209455_1000006 Ga0209455_1000006749 106
398 3300025304 Ga0209257_1009116 Ga0209257_10091162 106
399 3300025735 Ga0207713_1094698 Ga0207713_10946981 106
400 3300025909 Ga0207705_10002504 Ga0207705_100025044 106
401 3300025909 Ga0207705_11007260 Ga0207705_110072601 106
402 3300025913 Ga0207695_10111540 Ga0207695_101115404 106
403 3300025920 Ga0207649_10000077 Ga0207649_1000007729 106
404 3300025920 Ga0207649_10227766 Ga0207649_102277662 106
405 3300025921 Ga0207652_10000340 Ga0207652_1000034016 106
406 3300025941 Ga0207711_10442938 Ga0207711_104429381 106
407 3300025945 Ga0207679_10106324 Ga0207679_101063243 106
408 3300025981 Ga0207640_10779866 Ga0207640_107798661 106
409 3300026041 Ga0207639_10125386 Ga0207639_101253861 106
410 3300026041 Ga0207639_10298320 Ga0207639_102983203 106
411 3300026078 Ga0207702_10000211 Ga0207702_1000021123 106
412 3300026142 Ga0207698_10155033 Ga0207698_101550332 106
413 3300027876 Ga0209974_10428035 Ga0209974_104280351 106
414 3300028786 Ga0307517_10033374 Ga0307517_100333744 106
415 3300031548 Ga0307408_100446962 Ga0307408_1004469623 106
416 3300031711 Ga0265314_10084231 Ga0265314_100842311 106
417 3300031731 Ga0307405_10000144 Ga0307405_100001447 106
418 3300031731 Ga0307405_10017898 Ga0307405_100178985 106
419 3300031901 Ga0307406_12130808 Ga0307406_121308081 106
420 3300031911 Ga0307412_10012529 Ga0307412_100125293 106
421 3300031911 Ga0307412_10099625 Ga0307412_100996253 106
422 3300031911 Ga0307412_10605665 Ga0307412_106056651 106
423 3300033180 Ga0307510_10011300 Ga0307510_1001130012 106
424 3300033442 Ga0315911_1000026 Ga0315911_100002631 106
425 3300037418 Ga0395900_1311124 Ga0395900_1311124_266_589 106
426 3300039437 Ga0436365_0525660 Ga0436365_0525660_100_423 106
427 3300039438 Ga0436360_1041238 Ga0436360_1041238_1549_1872 106
428 3300039447 Ga0436361_0627452 Ga0436361_0627452_876_1199 106
429 3300042004 Ga0439445_0077420 Ga0439445_0077420_592_915 106
430 3300042015 Ga0439462_0003622 Ga0439462_0003622_132_455 106
431 3300046506 Ga0495583_0085937 Ga0495583_0085937_545_865 106
432 3300046522 Ga0495643_0464599 Ga0495643_0464599_172_492 106
433 3300046524 Ga0495648_0074501 Ga0495648_0074501_613_933 106
434 3300046616 Ga0495668_0323376 Ga0495668_0323376_211_531 106
435 3300047472 Ga0495686_0000808 Ga0495686_0000808_6196_6516 106
436 3300048091 Ga0495626_0001229 Ga0495626_0001229_19086_19406 106
437 3300048905 Ga0496102_0650560 Ga0496102_0650560_385_708 106
438 3300048918 Ga0496115_0730490 Ga0496115_0730490_319_642 106
439 3300048921 Ga0496118_0185415 Ga0496118_0185415_732_1055 106
440 3300048924 Ga0496121_0000190 Ga0496121_0000190_91064_91387 106
441 3300048924 Ga0496121_0003943 Ga0496121_0003943_19989_20309 106
442 3300048925 Ga0496122_0082072 Ga0496122_0082072_1221_1541 106
443 3300048926 Ga0496123_0060872 Ga0496123_0060872_1550_1870 106
444 3300048927 Ga0496124_0000188 Ga0496124_0000188_113604_113924 106
445 3300048927 Ga0496124_0115323 Ga0496124_0115323_602_922 106
446 3300048928 Ga0496125_0003553 Ga0496125_0003553_5780_6100 106
447 3300048929 Ga0496126_0058552 Ga0496126_0058552_1214_1537 106
448 3300049581 Ga0501047_0644309 Ga0501047_0644309_322_645 106
449 3300049823 Ga0501044_0020888 Ga0501044_0020888_5995_6318 106
450 3300049823 Ga0501044_0045912 Ga0501044_0045912_3788_4111 106
451 3300050492 nmdc:mga0yw44_13017_c2 nmdc:mga0yw44_13017_c2_3140_3463 106
452 3300050494 nmdc:mga06z11_580685_c1 nmdc:mga06z11_580685_c1_81_404 106
453 3300053087 Ga0500643_011255 Ga0500643_011255_2537_2857 106
454 3300053139 Ga0500568_0312711 Ga0500568_0312711_164_484 106
455 3300001979 JGI24740J21852_10000687 JGI24740J21852_100006877 107
456 3300001989 JGI24739J22299_10001673 JGI24739J22299_100016736 107
457 3300005327 Ga0070658_10855700 Ga0070658_108557002 107
458 3300005578 Ga0068854_100003389 Ga0068854_1000033896 107
459 3300009093 Ga0105240_10066501 Ga0105240_100665017 107
460 3300013105 Ga0157369_10001890 Ga0157369_1000189026 107
461 3300013307 Ga0157372_10004582 Ga0157372_1000458219 107
462 3300025913 Ga0207695_10617764 Ga0207695_106177641 107
463 3300025981 Ga0207640_10092457 Ga0207640_100924574 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05284

DUF736

Protein of unknown function (DUF736)

26

128

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g79-assembly1.cif.gz_A-2 structure a c. elegans sas-6 variant 0.5202 14 86
3pyi-assembly1.cif.gz_A structure of the n-terminal domain of c. elegans sas-6 0.5151 29 89
4gex-assembly1.cif.gz_A structure of a stabilised cesas-6 dimer, second crystal form 0.5095 29 89
4gfa-assembly1.cif.gz_C n-terminal coiled-coil dimer of c.elegans sas-6, crystal form a 0.5088 29 89
4geu-assembly2.cif.gz_C structure of a stabilised cesas-6 dimer 0.5085 29 89
ID Description Score Start End Superfamily
af_P32807_339_451_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.5795 63 105 2.40.290.10
af_Q2FXK1_322_455_3.30.1330.90 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;D-3-phosphoglycerate dehydrogenase; domain 3 0.5549 62 105 3.30.1330.90
af_B6SUS2_106_186_2.20.25.80 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;WRKY domain 0.5459 53 103 2.20.25.80
af_P38995_643_763_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.5411 2 52 3.40.1110.10
af_Q23414_175_325_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.519 43 77 3.40.630.90
ID Description Score Start End GO Terms
AF-A0A440Y3V5-F1-model_v4 DUF736 family protein 0.9869 14 87
AF-A0A846MVJ2-F1-model_v4 Uncharacterized protein (DUF736 family) 0.9754 1 107
AF-A0A440Y3V5-F1-model_v4 DUF736 family protein 0.9737 14 87
AF-A0A530QZT3-F1-model_v4 DUF736 family protein 0.9734 16 107
AF-A0A0L0DUX2-F1-model_v4 Helix-turn-helix domain-containing protein 0.9713 1 105

Feature Viewer

pLDDT pTM Quality
86.98 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map