F449135

General Info

Members Datasets Scaffolds Average Seq Length
463 206 926 138

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0101970|Ga0373955_0101970_38_508
Length 156
Sequence MESKETSMKRQRLLFAAAAVGLVTLAVAGMQITTSSTAYCAPKDEPKRVSPQTSQSKKSFKEDVMPIFVGRCVGCHQSGGEGTAKSGLDLTSYAGVMKGTKFGPMIIPGDPESSNLMLLLDWRASAELRMPHGMKQLNSCDRNDIRAWIREGAKDN

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
11 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.06
Stem 0
Stem Tuber 0
Unclassified 25.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0101970 3300035172 Bacteria 1649
2 2214800766 2209111006 Bacteria 10605
3 ARSoilYngRDRAFT_c00156 3300000042 Bacteria 11672
4 ARcpr5yngRDRAFT_c000049 3300000043 Bacteria 18697
5 ARSoilOldRDRAFT_c000098 3300000044 Bacteria 16580
6 ARCol0oldRDRAFT_c01054 3300000045 Bacteria 2071
7 ARCol0yngRDRAFT_1000072 3300000652 Bacteria 18771
8 JGI24737J22298_10038623 3300001990 Bacteria 1469
9 JGI24742J22300_10114454 3300002244 Unclassified 529
10 Ga0065717_1001945 3300005276 Bacteria 5957
11 Ga0065716_1000009 3300005277 Bacteria 8390
12 Ga0065704_10074892 3300005289 Bacteria 5930
13 Ga0065712_10484654 3300005290 Bacteria 660
14 Ga0065715_10595160 3300005293 Unclassified 711
15 Ga0065707_10094768 3300005295 Bacteria 3455
16 Ga0070660_100017753 3300005339 Bacteria 5190
17 Ga0070689_101785885 3300005340 Unclassified 560
18 Ga0070687_100047186 3300005343 Bacteria 2208
19 Ga0070692_10012628 3300005345 Bacteria 3917
20 Ga0070668_100034574 3300005347 Bacteria 3852
21 Ga0070688_100011650 3300005365 Bacteria 4894
22 Ga0070659_100025903 3300005366 Bacteria 4511
23 Ga0070709_10062299 3300005434 Bacteria 2378
24 Ga0070709_10746712 3300005434 Unclassified 764
25 Ga0070709_10813643 3300005434 Unclassified 734
26 Ga0070714_100303670 3300005435 Unclassified 1488
27 Ga0070714_101621865 3300005435 Bacteria 632
28 Ga0070713_100574523 3300005436 Unclassified 1069
29 Ga0070710_10491261 3300005437 Unclassified 839
30 Ga0070711_100399567 3300005439 Bacteria 1115
31 Ga0070694_100053327 3300005444 Bacteria 2736
32 Ga0070663_100108077 3300005455 Bacteria 2086
33 Ga0070662_100009731 3300005457 Bacteria 6292
34 Ga0068867_100025982 3300005459 Bacteria 4201
35 Ga0070707_100538804 3300005468 Bacteria 1129
36 Ga0070698_100475281 3300005471 Unclassified 1186
37 Ga0074259_12078122 3300005507 Bacteria 2449
38 Ga0070699_100000995 3300005518 Bacteria 26369
39 Ga0070679_100514960 3300005530 Bacteria 1140
40 Ga0068853_100510795 3300005539 Bacteria 1135
41 Ga0070672_100083081 3300005543 Bacteria 2570
42 Ga0070695_100020128 3300005545 Bacteria 4071
43 Ga0070696_100451466 3300005546 Unclassified 1014
44 Ga0070704_100007001 3300005549 Bacteria 6689
45 Ga0068856_101427632 3300005614 Unclassified 706
46 Ga0068852_100318696 3300005616 Bacteria 1509
47 Ga0068859_102134673 3300005617 Unclassified 618
48 Ga0068866_10028997 3300005718 Bacteria 2642
49 Ga0068866_10948577 3300005718 Unclassified 608
50 Ga0068861_100081893 3300005719 Bacteria 2528
51 Ga0068858_100558730 3300005842 Bacteria 1108
52 Ga0068862_100019680 3300005844 Bacteria 5636
53 Ga0081455_10000185 3300005937 Bacteria 78750
54 Ga0081455_10007799 3300005937 Bacteria 11212
55 Ga0081455_10136559 3300005937 Bacteria 1910
56 Ga0070717_10934168 3300006028 Bacteria 790
57 Ga0075432_10028244 3300006058 Bacteria 1935
58 Ga0070715_10313465 3300006163 Unclassified 844
59 Ga0070715_10411069 3300006163 Bacteria 754
60 Ga0070716_100043040 3300006173 Bacteria 2523
61 Ga0070712_100042495 3300006175 Bacteria 3126
62 Ga0075428_100109623 3300006844 Unclassified 3007
63 Ga0075428_100172066 3300006844 Bacteria 2347
64 Ga0075430_100018982 3300006846 Bacteria 5850
65 Ga0075430_100061939 3300006846 Unclassified 3143
66 Ga0075431_100048949 3300006847 Unclassified 4359
67 Ga0075431_100150250 3300006847 Bacteria 2399
68 Ga0075431_100555791 3300006847 Unclassified 1135
69 Ga0075434_101007066 3300006871 Unclassified 847
70 Ga0075429_100030930 3300006880 Bacteria 4652
71 Ga0075429_100124587 3300006880 Bacteria 2253
72 Ga0075429_101341292 3300006880 Unclassified 623
73 Ga0068865_100035493 3300006881 Bacteria 3354
74 Ga0097620_102134988 3300006931 Unclassified 618
75 Ga0075435_100738800 3300007076 Unclassified 856
76 Ga0111539_10198220 3300009094 Bacteria 2342
77 Ga0111539_10823383 3300009094 Bacteria 1080
78 Ga0105245_12056777 3300009098 Bacteria 625
79 Ga0114129_10002667 3300009147 Bacteria 24838
80 Ga0114129_10043168 3300009147 Bacteria 6344
81 Ga0114129_10116619 3300009147 Bacteria 3679
82 Ga0114129_10529437 3300009147 Bacteria 1535
83 Ga0157370_11126556 3300013104 Bacteria 709
84 Ga0182005_1164859 3300015265 Bacteria 651
85 Ga0213873_10190853 3300021358 Unclassified 632
86 Ga0207697_10039140 3300025315 Bacteria 1945
87 Ga0207642_10099592 3300025899 Bacteria 1456
88 Ga0207688_10525224 3300025901 Bacteria 743
89 Ga0207699_10083947 3300025906 Unclassified 1983
90 Ga0207693_10071274 3300025915 Bacteria 2720
91 Ga0207693_10342604 3300025915 Unclassified 1170
92 Ga0207663_10032150 3300025916 Bacteria 3113
93 Ga0207663_11083685 3300025916 Bacteria 644
94 Ga0207660_10256735 3300025917 Bacteria 1381
95 Ga0207652_11778489 3300025921 Unclassified 521
96 Ga0207659_10430626 3300025926 Unclassified 1108
97 Ga0207700_10186797 3300025928 Bacteria 1739
98 Ga0207700_10610540 3300025928 Bacteria 971
99 Ga0207664_10525089 3300025929 Bacteria 1061
100 Ga0207709_10135980 3300025935 Bacteria 1683
101 Ga0207665_10116508 3300025939 Bacteria 1883
102 Ga0207665_11196566 3300025939 Unclassified 606
103 Ga0207691_10124364 3300025940 Bacteria 2283
104 Ga0207712_10114215 3300025961 Bacteria 2031
105 Ga0207668_10025058 3300025972 Bacteria 3856
106 Ga0207658_10497011 3300025986 Unclassified 1086
107 Ga0207703_10782813 3300026035 Bacteria 910
108 Ga0207639_10255472 3300026041 Bacteria 1530
109 Ga0207678_10059081 3300026067 Bacteria 3299
110 Ga0207648_10041248 3300026089 Bacteria 4053
111 Ga0207675_100220614 3300026118 Bacteria 1827
112 Ga0207428_10000370 3300027907 Bacteria 57548
113 Ga0207428_10919977 3300027907 Unclassified 617
114 Ga0268265_10012434 3300028380 Bacteria 5768
115 Ga0265336_10236896 3300028666 Unclassified 542
116 Ga0265338_10011880 3300028800 Bacteria 10000
117 Ga0265338_10039303 3300028800 Bacteria 4466
118 Ga0265338_10130775 3300028800 Bacteria 1982
119 Ga0265338_10587483 3300028800 Unclassified 777
120 Ga0265330_10035701 3300031235 Bacteria 2217
121 Ga0265330_10068393 3300031235 Bacteria 1539
122 Ga0265330_10077106 3300031235 Bacteria 1438
123 Ga0265330_10222523 3300031235 Bacteria 796
124 Ga0265332_10022929 3300031238 Bacteria 2754
125 Ga0265325_10000493 3300031241 Bacteria 28650
126 Ga0265325_10008621 3300031241 Bacteria 6006
127 Ga0265325_10051975 3300031241 Bacteria 2105
128 Ga0265329_10062120 3300031242 Bacteria 1183
129 Ga0265340_10002545 3300031247 Bacteria 10362
130 Ga0265340_10002606 3300031247 Bacteria 10247
131 Ga0265340_10006345 3300031247 Bacteria 6519
132 Ga0265340_10061973 3300031247 Bacteria 1787
133 Ga0265339_10061002 3300031249 Bacteria 2031
134 Ga0265339_10212413 3300031249 Bacteria 950
135 Ga0265339_10243898 3300031249 Unclassified 872
136 Ga0265339_10335763 3300031249 Bacteria 714
137 Ga0265339_10462832 3300031249 Unclassified 588
138 Ga0265339_10463596 3300031249 Unclassified 587
139 Ga0265331_10037486 3300031250 Bacteria 2373
140 Ga0265316_10069562 3300031344 Unclassified 2717
141 Ga0265313_10154643 3300031595 Unclassified 977
142 Ga0265314_10312413 3300031711 Bacteria 877
143 Ga0265342_10025524 3300031712 Bacteria 3713
144 Ga0265342_10245510 3300031712 Unclassified 957
145 Ga0265342_10266093 3300031712 Bacteria 911
146 Ga0373934_0031038 3300035086 Bacteria 2091
147 Ga0373934_0263486 3300035086 Unclassified 713
148 Ga0373934_0292877 3300035086 Unclassified 675
149 Ga0373944_0337178 3300035089 Unclassified 572
150 Ga0373923_0018809 3300035111 Bacteria 2665
151 Ga0373923_0177798 3300035111 Bacteria 977
152 Ga0373936_0003975 3300035113 Bacteria 5572
153 Ga0373936_0022454 3300035113 Bacteria 2457
154 Ga0373936_0318498 3300035113 Unclassified 704
155 Ga0373939_0080334 3300035114 Unclassified 1081
156 Ga0373945_0181387 3300035116 Bacteria 867
157 Ga0373945_0510206 3300035116 Unclassified 536
158 Ga0373953_0052823 3300035117 Bacteria 1646
159 Ga0373953_0289366 3300035117 Unclassified 714
160 Ga0373954_0012439 3300035118 Bacteria 3783
161 Ga0373954_0047374 3300035118 Bacteria 2012
162 Ga0373954_0059529 3300035118 Unclassified 1800
163 Ga0373954_0279067 3300035118 Bacteria 824
164 Ga0373954_0294159 3300035118 Bacteria 801
165 Ga0373956_0063092 3300035119 Bacteria 1680
166 Ga0373956_0068022 3300035119 Unclassified 1622
167 Ga0373956_0110217 3300035119 Bacteria 1281
168 Ga0373956_0360390 3300035119 Bacteria 693
169 Ga0373957_0039846 3300035120 Bacteria 1764
170 Ga0373957_0094734 3300035120 Unclassified 1190
171 Ga0373943_0009014 3300035170 Bacteria 4473
172 Ga0373943_0009872 3300035170 Bacteria 4275
173 Ga0373943_0349644 3300035170 Bacteria 847
174 Ga0373946_0038416 3300035171 Bacteria 1949
175 Ga0373946_0082449 3300035171 Bacteria 1410
176 Ga0373946_0176761 3300035171 Unclassified 1011
177 Ga0373955_0001087 3300035172 Bacteria 11561
178 Ga0373955_0002415 3300035172 Bacteria 8139
179 Ga0373955_0102563 3300035172 Bacteria 1644
180 Ga0373955_0403946 3300035172 Bacteria 830
181 Ga0373924_0000808 3300035410 Bacteria 9783
182 Ga0373924_0023245 3300035410 Bacteria 2430
183 Ga0373924_0082135 3300035410 Bacteria 1372
184 Ga0373924_0122503 3300035410 Unclassified 1129
185 Ga0373924_0338497 3300035410 Bacteria 670
186 Ga0373935_0000075 3300035692 Bacteria 42723
187 Ga0373935_0136395 3300035692 Bacteria 1653
188 Ga0373927_0003176 3300035695 Bacteria 11852
189 Ga0373927_0008031 3300035695 Bacteria 7125
190 Ga0373927_0790232 3300035695 Unclassified 627
191 Ga0373927_1137247 3300035695 Unclassified 515
192 Ga0373933_0000105 3300035724 Bacteria 53488
193 Ga0373933_0003048 3300035724 Bacteria 9346
194 Ga0373933_0139609 3300035724 Bacteria 1529
195 Ga0373933_0158980 3300035724 Bacteria 1434
196 Ga0373933_0395269 3300035724 Unclassified 901
197 Ga0373933_0638013 3300035724 Unclassified 700
198 Ga0373947_0000138 3300035725 Bacteria 37713
199 Ga0373947_0297780 3300035725 Bacteria 1075
200 Ga0373947_0328593 3300035725 Bacteria 1023
201 Ga0373947_0436010 3300035725 Unclassified 886
202 Ga0373947_0665780 3300035725 Bacteria 710
203 Ga0373937_0003115 3300036401 Bacteria 13865
204 Ga0373937_0042048 3300036401 Bacteria 4170
205 Ga0373937_0068864 3300036401 Unclassified 3262
206 Ga0373937_0092831 3300036401 Bacteria 2798
207 Ga0373937_0130335 3300036401 Bacteria 2348
208 Ga0373937_0156194 3300036401 Bacteria 2138
209 Ga0373937_0211687 3300036401 Unclassified 1824
210 Ga0373937_0260791 3300036401 Bacteria 1634
211 Ga0373937_0650518 3300036401 Bacteria 999
212 Ga0373937_0766723 3300036401 Bacteria 912
213 Ga0373937_0801323 3300036401 Unclassified 890
214 Ga0373937_0885072 3300036401 Bacteria 842
215 Ga0373937_0967887 3300036401 Bacteria 800
216 Ga0373937_1467066 3300036401 Bacteria 630
217 Ga0373925_0000078 3300037068 Bacteria 105238
218 Ga0373925_0115997 3300037068 Unclassified 2074
219 Ga0373925_0152398 3300037068 Unclassified 1816
220 Ga0373925_0979377 3300037068 Bacteria 696
221 Ga0373925_1166881 3300037068 Unclassified 633
222 Ga0395901_0556181 3300038443 Bacteria 1162
223 Ga0436365_0328047 3300039437 Bacteria 942
224 Ga0436360_0142560 3300039438 Unclassified 607
225 Ga0436362_1175569 3300039453 Unclassified 871
226 Ga0439435_0005532 3300042436 Bacteria 2783
227 Ga0495592_0092269 3300046454 Unclassified 2170
228 Ga0495592_0119486 3300046454 Bacteria 1856
229 Ga0495592_0172468 3300046454 Bacteria 1480
230 Ga0495592_0187637 3300046454 Bacteria 1403
231 Ga0495592_0670614 3300046454 Unclassified 626
232 Ga0495603_0002636 3300046455 Bacteria 10584
233 Ga0495629_0009967 3300046459 Bacteria 6934
234 Ga0495629_0012540 3300046459 Bacteria 6138
235 Ga0495629_0038242 3300046459 Bacteria 3380
236 Ga0495629_0671774 3300046459 Bacteria 689
237 Ga0495641_0033243 3300046461 Bacteria 2450
238 Ga0495651_0001237 3300046462 Bacteria 19755
239 Ga0495651_0001489 3300046462 Bacteria 18122
240 Ga0495651_0006420 3300046462 Bacteria 8997
241 Ga0495651_0032475 3300046462 Bacteria 4071
242 Ga0495651_0258226 3300046462 Bacteria 1186
243 Ga0495651_0299507 3300046462 Unclassified 1079
244 Ga0495651_0309688 3300046462 Bacteria 1056
245 Ga0495651_0502255 3300046462 Bacteria 776
246 Ga0495653_0000464 3300046463 Bacteria 31572
247 Ga0495653_0010642 3300046463 Bacteria 7529
248 Ga0495653_0016666 3300046463 Bacteria 5979
249 Ga0495653_0057279 3300046463 Bacteria 2966
250 Ga0495653_0277942 3300046463 Unclassified 1100
251 Ga0495653_0360413 3300046463 Unclassified 933
252 Ga0495653_0942619 3300046463 Bacteria 513
253 Ga0495580_0245757 3300046472 Bacteria 1226
254 Ga0495582_0008297 3300046473 Bacteria 5733
255 Ga0495582_0219986 3300046473 Bacteria 1086
256 Ga0495662_0475367 3300046476 Unclassified 613
257 Ga0495662_0567665 3300046476 Bacteria 555
258 Ga0495664_0000023 3300046477 Bacteria 126807
259 Ga0495664_0002566 3300046477 Bacteria 9768
260 Ga0495664_0019393 3300046477 Bacteria 3910
261 Ga0495664_0542363 3300046477 Unclassified 693
262 Ga0495585_0066330 3300046492 Bacteria 1976
263 Ga0495594_0529917 3300046499 Unclassified 669
264 Ga0495608_0000030 3300046511 Bacteria 145828
265 Ga0495608_0097921 3300046511 Bacteria 1893
266 Ga0495608_0124004 3300046511 Bacteria 1655
267 Ga0495618_0000585 3300046514 Bacteria 25962
268 Ga0495618_0068843 3300046514 Bacteria 2250
269 Ga0495618_0357332 3300046514 Bacteria 899
270 Ga0495618_0782307 3300046514 Unclassified 557
271 Ga0495628_0000027 3300046516 Bacteria 126537
272 Ga0495628_0000736 3300046516 Bacteria 30361
273 Ga0495628_0106364 3300046516 Bacteria 2161
274 Ga0495628_0117069 3300046516 Bacteria 2046
275 Ga0495628_0658791 3300046516 Bacteria 743
276 Ga0495628_0790000 3300046516 Bacteria 665
277 Ga0495630_0004072 3300046517 Bacteria 10237
278 Ga0495630_0061485 3300046517 Bacteria 2820
279 Ga0495630_0499566 3300046517 Unclassified 933
280 Ga0495630_1275705 3300046517 Unclassified 554
281 Ga0495632_0222276 3300046519 Unclassified 854
282 Ga0495666_0005180 3300046526 Bacteria 6584
283 Ga0495666_0133794 3300046526 Unclassified 1158
284 Ga0495666_0201102 3300046526 Unclassified 916
285 Ga0495652_0000041 3300046529 Bacteria 126519
286 Ga0495652_0011314 3300046529 Bacteria 8073
287 Ga0495652_0048694 3300046529 Bacteria 3630
288 Ga0495652_0079596 3300046529 Bacteria 2709
289 Ga0495652_0099210 3300046529 Bacteria 2365
290 Ga0495652_0123131 3300046529 Bacteria 2064
291 Ga0495652_0134059 3300046529 Bacteria 1956
292 Ga0495665_0043539 3300046531 Bacteria 2387
293 Ga0495665_0435125 3300046531 Unclassified 664
294 Ga0495640_0000056 3300046533 Bacteria 62074
295 Ga0495640_0018072 3300046533 Bacteria 5239
296 Ga0495640_0032358 3300046533 Bacteria 3726
297 Ga0495640_0057663 3300046533 Bacteria 2650
298 Ga0495586_0059266 3300046535 Bacteria 2080
299 Ga0495586_0228166 3300046535 Bacteria 1059
300 Ga0495587_0000025 3300046536 Bacteria 147974
301 Ga0495587_0001398 3300046536 Bacteria 16059
302 Ga0495587_0006187 3300046536 Bacteria 7812
303 Ga0495587_0011493 3300046536 Bacteria 5608
304 Ga0495587_0109539 3300046536 Bacteria 1587
305 Ga0495645_0000001 3300046543 Bacteria 657910
306 Ga0495645_0025901 3300046543 Bacteria 4257
307 Ga0495622_0035570 3300046557 Bacteria 2322
308 Ga0495633_0122309 3300046558 Bacteria 1206
309 Ga0495633_0311678 3300046558 Bacteria 714
310 Ga0495667_0000001 3300046559 Bacteria 834831
311 Ga0495667_0004151 3300046559 Bacteria 9742
312 Ga0495667_0029546 3300046559 Bacteria 3689
313 Ga0495667_0043489 3300046559 Bacteria 2976
314 Ga0495667_0084105 3300046559 Unclassified 2066
315 Ga0495667_0880202 3300046559 Bacteria 550
316 Ga0495656_0125859 3300046615 Unclassified 1215
317 Ga0495634_0001628 3300046642 Bacteria 19537
318 Ga0495634_0071080 3300046642 Bacteria 2292
319 Ga0495634_0346420 3300046642 Bacteria 890
320 Ga0495611_0040914 3300046648 Bacteria 2067
321 Ga0495635_0000077 3300046663 Bacteria 60215
322 Ga0495635_0034876 3300046663 Unclassified 3490
323 Ga0495635_0049672 3300046663 Bacteria 2891
324 Ga0495635_0313026 3300046663 Bacteria 1051
325 Ga0495588_0298887 3300046674 Unclassified 848
326 Ga0495657_0000390 3300046675 Bacteria 40745
327 Ga0495657_0030049 3300046675 Unclassified 3807
328 Ga0495657_0063426 3300046675 Bacteria 2438
329 Ga0495657_0076521 3300046675 Bacteria 2173
330 Ga0495657_0111657 3300046675 Bacteria 1731
331 Ga0495657_0152409 3300046675 Bacteria 1434
332 Ga0495599_0000021 3300046678 Bacteria 127591
333 Ga0495599_0093539 3300046678 Bacteria 1875
334 Ga0495599_0104401 3300046678 Bacteria 1765
335 Ga0495599_0122224 3300046678 Unclassified 1618
336 Ga0495623_0001594 3300046679 Bacteria 15285
337 Ga0495623_0001981 3300046679 Bacteria 13744
338 Ga0495623_0099757 3300046679 Bacteria 1770
339 Ga0495623_0170132 3300046679 Bacteria 1273
340 Ga0495623_0482413 3300046679 Bacteria 656
341 Ga0495646_0000051 3300046680 Bacteria 60085
342 Ga0495646_0006351 3300046680 Bacteria 7495
343 Ga0495646_0019799 3300046680 Bacteria 4256
344 Ga0495646_0041891 3300046680 Bacteria 2812
345 Ga0495646_0233279 3300046680 Unclassified 991
346 Ga0495647_0162781 3300046681 Bacteria 962
347 Ga0495647_0217932 3300046681 Unclassified 841
348 Ga0495647_0236463 3300046681 Unclassified 810
349 Ga0495647_0316458 3300046681 Unclassified 706
350 Ga0495658_0221455 3300046683 Unclassified 1184
351 Ga0495658_0338322 3300046683 Unclassified 956
352 Ga0495658_0439859 3300046683 Unclassified 833
353 Ga0495658_0990379 3300046683 Bacteria 537
354 Ga0495613_0206861 3300046689 Bacteria 1381
355 Ga0495613_0217507 3300046689 Bacteria 1342
356 Ga0495613_0614589 3300046689 Unclassified 722
357 Ga0495613_0891413 3300046689 Bacteria 576
358 Ga0495624_0220897 3300046690 Bacteria 1149
359 Ga0495624_0408886 3300046690 Bacteria 814
360 Ga0495670_0242810 3300046691 Unclassified 959
361 Ga0495670_0313175 3300046691 Unclassified 842
362 Ga0495600_0000114 3300046809 Bacteria 44972
363 Ga0495600_0002868 3300046809 Bacteria 10040
364 Ga0495600_0007177 3300046809 Bacteria 6804
365 Ga0495600_0050379 3300046809 Bacteria 2717
366 Ga0495600_0272540 3300046809 Bacteria 1073
367 Ga0495600_0344991 3300046809 Bacteria 933
368 Ga0495581_0005632 3300047315 Bacteria 7261
369 Ga0495581_0024699 3300047315 Bacteria 3483
370 Ga0495581_0119027 3300047315 Bacteria 1537
371 Ga0495581_0274954 3300047315 Unclassified 985
372 Ga0495604_0000036 3300047317 Bacteria 126707
373 Ga0495604_0021192 3300047317 Bacteria 5188
374 Ga0495604_0103118 3300047317 Bacteria 2093
375 Ga0495604_0151632 3300047317 Bacteria 1646
376 Ga0495604_0178829 3300047317 Unclassified 1485
377 Ga0495604_0322873 3300047317 Bacteria 1031
378 Ga0495636_0482988 3300047318 Unclassified 598
379 Ga0495674_0000102 3300047319 Bacteria 62602
380 Ga0495674_0144912 3300047319 Bacteria 1994
381 Ga0495674_0149497 3300047319 Bacteria 1959
382 Ga0495674_0225681 3300047319 Bacteria 1547
383 Ga0495674_0646603 3300047319 Bacteria 834
384 Ga0495674_1016526 3300047319 Unclassified 635
385 Ga0495676_0041751 3300047321 Bacteria 3772
386 Ga0495676_0195269 3300047321 Bacteria 1409
387 Ga0495676_0664060 3300047321 Unclassified 676
388 Ga0495680_0001061 3300047322 Bacteria 30436
389 Ga0495680_0008723 3300047322 Bacteria 9186
390 Ga0495680_0031675 3300047322 Bacteria 4299
391 Ga0495680_0052976 3300047322 Bacteria 3160
392 Ga0495680_0543662 3300047322 Bacteria 784
393 Ga0495675_0000148 3300047444 Bacteria 49201
394 Ga0495675_0057111 3300047444 Bacteria 2474
395 Ga0495675_0135335 3300047444 Bacteria 1530
396 Ga0495675_0225128 3300047444 Bacteria 1133
397 Ga0495675_0601304 3300047444 Unclassified 623
398 Ga0495684_0000025 3300047471 Bacteria 127037
399 Ga0495684_0001757 3300047471 Bacteria 17411
400 Ga0495684_0087830 3300047471 Bacteria 2356
401 Ga0495684_0611095 3300047471 Unclassified 734
402 Ga0495684_0655391 3300047471 Unclassified 701
403 Ga0495593_0000708 3300047673 Bacteria 19277
404 Ga0495593_0045450 3300047673 Bacteria 2343
405 Ga0495593_0087940 3300047673 Bacteria 1602
406 Ga0495593_0114058 3300047673 Bacteria 1378
407 Ga0495602_0000230 3300048088 Bacteria 52313
408 Ga0495602_0000311 3300048088 Bacteria 44943
409 Ga0495602_0011182 3300048088 Bacteria 9285
410 Ga0495602_0031685 3300048088 Unclassified 4994
411 Ga0495602_0215857 3300048088 Bacteria 1452
412 Ga0495602_0388540 3300048088 Bacteria 998
413 Ga0496100_1629540 3300048903 Unclassified 510
414 Ga0496104_0000170 3300048907 Bacteria 57501
415 Ga0496105_0001192 3300048908 Bacteria 18094
416 Ga0496112_0000014 3300048915 Bacteria 210932
417 Ga0496113_0799138 3300048916 Bacteria 750
418 Ga0501071_0135391 3300049587 Unclassified 1833
419 Ga0501075_0916081 3300049591 Unclassified 666
420 Ga0501076_0080378 3300049592 Unclassified 2617
421 Ga0501077_0070214 3300049593 Unclassified 2220
422 Ga0501081_0066327 3300049743 Bacteria 2510
423 nmdc:mga05p37_113402_c1 3300050507 Bacteria 3333
424 nmdc:mga05p37_3516_c1 3300050507 Bacteria 18305
425 nmdc:mga09592_14391_c1 3300050508 Bacteria 6457
426 nmdc:mga0qj67_15702_c1 3300050509 Bacteria 5735
427 nmdc:mga0qj67_90693_c1 3300050509 Unclassified 2456
428 nmdc:mga06r32_38177_c1 3300050510 Unclassified 4548
429 nmdc:mga06r32_73678_c1 3300050510 Bacteria 3308
430 nmdc:mga08y16_430343_c1 3300050511 Bacteria 1348
431 nmdc:mga0n895_615689_c1 3300050512 Unclassified 1087
432 nmdc:mga08x19_50501_c1 3300050514 Bacteria 2669
433 Ga0495601_0000025 3300053077 Bacteria 127736
434 Ga0495601_0000964 3300053077 Bacteria 15726
435 Ga0495601_0002825 3300053077 Bacteria 9859
436 Ga0495601_0005395 3300053077 Bacteria 7448
437 Ga0495601_0055351 3300053077 Bacteria 2511
438 Ga0495601_0220945 3300053077 Unclassified 1237
439 Ga0495601_0273363 3300053077 Bacteria 1102
440 Ga0495612_0000046 3300053078 Bacteria 59912
441 Ga0495612_0001142 3300053078 Bacteria 10900
442 Ga0495595_0000054 3300053084 Bacteria 59828
443 Ga0495595_0000118 3300053084 Bacteria 33817
444 Ga0495595_0001613 3300053084 Bacteria 8812
445 Ga0495595_0009103 3300053084 Bacteria 4101
446 Ga0495595_0013855 3300053084 Unclassified 3412
447 Ga0495595_0029286 3300053084 Bacteria 2463
448 Ga0495595_0037088 3300053084 Bacteria 2215
449 Ga0495595_0595135 3300053084 Unclassified 565
450 Ga0495619_0000035 3300053085 Bacteria 126262
451 Ga0495619_0000307 3300053085 Bacteria 34556
452 Ga0495619_0002095 3300053085 Bacteria 13247
453 Ga0495619_0003647 3300053085 Bacteria 9921
454 Ga0495619_0080378 3300053085 Unclassified 2194
455 Ga0495619_0115521 3300053085 Bacteria 1837
456 Ga0495619_0132172 3300053085 Unclassified 1715
457 Ga0495619_0133593 3300053085 Bacteria 1706
458 Ga0495619_0252692 3300053085 Bacteria 1221
459 Ga0495619_0421081 3300053085 Unclassified 921
460 Ga0500590_061062 3300053148 Bacteria 1893
461 Ga0500636_0161700 3300053177 Bacteria 1220
462 Ga0500657_123345 3300053728 Unclassified 1021
463 Ga0501084_0016609 3300054114 Bacteria 6112
464 Ga0373955_0101970
465 2214800766
466 ARSoilYngRDRAFT_c00156
467 ARcpr5yngRDRAFT_c000049
468 ARSoilOldRDRAFT_c000098
469 ARCol0oldRDRAFT_c01054
470 ARCol0yngRDRAFT_1000072
471 JGI24737J22298_10038623
472 JGI24742J22300_10114454
473 Ga0065717_1001945
474 Ga0065716_1000009
475 Ga0065704_10074892
476 Ga0065712_10484654
477 Ga0065715_10595160
478 Ga0065707_10094768
479 Ga0070660_100017753
480 Ga0070689_101785885
481 Ga0070687_100047186
482 Ga0070692_10012628
483 Ga0070668_100034574
484 Ga0070688_100011650
485 Ga0070659_100025903
486 Ga0070709_10062299
487 Ga0070709_10746712
488 Ga0070709_10813643
489 Ga0070714_100303670
490 Ga0070714_101621865
491 Ga0070713_100574523
492 Ga0070710_10491261
493 Ga0070711_100399567
494 Ga0070694_100053327
495 Ga0070663_100108077
496 Ga0070662_100009731
497 Ga0068867_100025982
498 Ga0070707_100538804
499 Ga0070698_100475281
500 Ga0074259_12078122
501 Ga0070699_100000995
502 Ga0070679_100514960
503 Ga0068853_100510795
504 Ga0070672_100083081
505 Ga0070695_100020128
506 Ga0070696_100451466
507 Ga0070704_100007001
508 Ga0068856_101427632
509 Ga0068852_100318696
510 Ga0068859_102134673
511 Ga0068866_10028997
512 Ga0068866_10948577
513 Ga0068861_100081893
514 Ga0068858_100558730
515 Ga0068862_100019680
516 Ga0081455_10000185
517 Ga0081455_10007799
518 Ga0081455_10136559
519 Ga0070717_10934168
520 Ga0075432_10028244
521 Ga0070715_10313465
522 Ga0070715_10411069
523 Ga0070716_100043040
524 Ga0070712_100042495
525 Ga0075428_100109623
526 Ga0075428_100172066
527 Ga0075430_100018982
528 Ga0075430_100061939
529 Ga0075431_100048949
530 Ga0075431_100150250
531 Ga0075431_100555791
532 Ga0075434_101007066
533 Ga0075429_100030930
534 Ga0075429_100124587
535 Ga0075429_101341292
536 Ga0068865_100035493
537 Ga0097620_102134988
538 Ga0075435_100738800
539 Ga0111539_10198220
540 Ga0111539_10823383
541 Ga0105245_12056777
542 Ga0114129_10002667
543 Ga0114129_10043168
544 Ga0114129_10116619
545 Ga0114129_10529437
546 Ga0157370_11126556
547 Ga0182005_1164859
548 Ga0213873_10190853
549 Ga0207697_10039140
550 Ga0207642_10099592
551 Ga0207688_10525224
552 Ga0207699_10083947
553 Ga0207693_10071274
554 Ga0207693_10342604
555 Ga0207663_10032150
556 Ga0207663_11083685
557 Ga0207660_10256735
558 Ga0207652_11778489
559 Ga0207659_10430626
560 Ga0207700_10186797
561 Ga0207700_10610540
562 Ga0207664_10525089
563 Ga0207709_10135980
564 Ga0207665_10116508
565 Ga0207665_11196566
566 Ga0207691_10124364
567 Ga0207712_10114215
568 Ga0207668_10025058
569 Ga0207658_10497011
570 Ga0207703_10782813
571 Ga0207639_10255472
572 Ga0207678_10059081
573 Ga0207648_10041248
574 Ga0207675_100220614
575 Ga0207428_10000370
576 Ga0207428_10919977
577 Ga0268265_10012434
578 Ga0265336_10236896
579 Ga0265338_10011880
580 Ga0265338_10039303
581 Ga0265338_10130775
582 Ga0265338_10587483
583 Ga0265330_10035701
584 Ga0265330_10068393
585 Ga0265330_10077106
586 Ga0265330_10222523
587 Ga0265332_10022929
588 Ga0265325_10000493
589 Ga0265325_10008621
590 Ga0265325_10051975
591 Ga0265329_10062120
592 Ga0265340_10002545
593 Ga0265340_10002606
594 Ga0265340_10006345
595 Ga0265340_10061973
596 Ga0265339_10061002
597 Ga0265339_10212413
598 Ga0265339_10243898
599 Ga0265339_10335763
600 Ga0265339_10462832
601 Ga0265339_10463596
602 Ga0265331_10037486
603 Ga0265316_10069562
604 Ga0265313_10154643
605 Ga0265314_10312413
606 Ga0265342_10025524
607 Ga0265342_10245510
608 Ga0265342_10266093
609 Ga0373934_0031038
610 Ga0373934_0263486
611 Ga0373934_0292877
612 Ga0373944_0337178
613 Ga0373923_0018809
614 Ga0373923_0177798
615 Ga0373936_0003975
616 Ga0373936_0022454
617 Ga0373936_0318498
618 Ga0373939_0080334
619 Ga0373945_0181387
620 Ga0373945_0510206
621 Ga0373953_0052823
622 Ga0373953_0289366
623 Ga0373954_0012439
624 Ga0373954_0047374
625 Ga0373954_0059529
626 Ga0373954_0279067
627 Ga0373954_0294159
628 Ga0373956_0063092
629 Ga0373956_0068022
630 Ga0373956_0110217
631 Ga0373956_0360390
632 Ga0373957_0039846
633 Ga0373957_0094734
634 Ga0373943_0009014
635 Ga0373943_0009872
636 Ga0373943_0349644
637 Ga0373946_0038416
638 Ga0373946_0082449
639 Ga0373946_0176761
640 Ga0373955_0001087
641 Ga0373955_0002415
642 Ga0373955_0102563
643 Ga0373955_0403946
644 Ga0373924_0000808
645 Ga0373924_0023245
646 Ga0373924_0082135
647 Ga0373924_0122503
648 Ga0373924_0338497
649 Ga0373935_0000075
650 Ga0373935_0136395
651 Ga0373927_0003176
652 Ga0373927_0008031
653 Ga0373927_0790232
654 Ga0373927_1137247
655 Ga0373933_0000105
656 Ga0373933_0003048
657 Ga0373933_0139609
658 Ga0373933_0158980
659 Ga0373933_0395269
660 Ga0373933_0638013
661 Ga0373947_0000138
662 Ga0373947_0297780
663 Ga0373947_0328593
664 Ga0373947_0436010
665 Ga0373947_0665780
666 Ga0373937_0003115
667 Ga0373937_0042048
668 Ga0373937_0068864
669 Ga0373937_0092831
670 Ga0373937_0130335
671 Ga0373937_0156194
672 Ga0373937_0211687
673 Ga0373937_0260791
674 Ga0373937_0650518
675 Ga0373937_0766723
676 Ga0373937_0801323
677 Ga0373937_0885072
678 Ga0373937_0967887
679 Ga0373937_1467066
680 Ga0373925_0000078
681 Ga0373925_0115997
682 Ga0373925_0152398
683 Ga0373925_0979377
684 Ga0373925_1166881
685 Ga0395901_0556181
686 Ga0436365_0328047
687 Ga0436360_0142560
688 Ga0436362_1175569
689 Ga0439435_0005532
690 Ga0495592_0092269
691 Ga0495592_0119486
692 Ga0495592_0172468
693 Ga0495592_0187637
694 Ga0495592_0670614
695 Ga0495603_0002636
696 Ga0495629_0009967
697 Ga0495629_0012540
698 Ga0495629_0038242
699 Ga0495629_0671774
700 Ga0495641_0033243
701 Ga0495651_0001237
702 Ga0495651_0001489
703 Ga0495651_0006420
704 Ga0495651_0032475
705 Ga0495651_0258226
706 Ga0495651_0299507
707 Ga0495651_0309688
708 Ga0495651_0502255
709 Ga0495653_0000464
710 Ga0495653_0010642
711 Ga0495653_0016666
712 Ga0495653_0057279
713 Ga0495653_0277942
714 Ga0495653_0360413
715 Ga0495653_0942619
716 Ga0495580_0245757
717 Ga0495582_0008297
718 Ga0495582_0219986
719 Ga0495662_0475367
720 Ga0495662_0567665
721 Ga0495664_0000023
722 Ga0495664_0002566
723 Ga0495664_0019393
724 Ga0495664_0542363
725 Ga0495585_0066330
726 Ga0495594_0529917
727 Ga0495608_0000030
728 Ga0495608_0097921
729 Ga0495608_0124004
730 Ga0495618_0000585
731 Ga0495618_0068843
732 Ga0495618_0357332
733 Ga0495618_0782307
734 Ga0495628_0000027
735 Ga0495628_0000736
736 Ga0495628_0106364
737 Ga0495628_0117069
738 Ga0495628_0658791
739 Ga0495628_0790000
740 Ga0495630_0004072
741 Ga0495630_0061485
742 Ga0495630_0499566
743 Ga0495630_1275705
744 Ga0495632_0222276
745 Ga0495666_0005180
746 Ga0495666_0133794
747 Ga0495666_0201102
748 Ga0495652_0000041
749 Ga0495652_0011314
750 Ga0495652_0048694
751 Ga0495652_0079596
752 Ga0495652_0099210
753 Ga0495652_0123131
754 Ga0495652_0134059
755 Ga0495665_0043539
756 Ga0495665_0435125
757 Ga0495640_0000056
758 Ga0495640_0018072
759 Ga0495640_0032358
760 Ga0495640_0057663
761 Ga0495586_0059266
762 Ga0495586_0228166
763 Ga0495587_0000025
764 Ga0495587_0001398
765 Ga0495587_0006187
766 Ga0495587_0011493
767 Ga0495587_0109539
768 Ga0495645_0000001
769 Ga0495645_0025901
770 Ga0495622_0035570
771 Ga0495633_0122309
772 Ga0495633_0311678
773 Ga0495667_0000001
774 Ga0495667_0004151
775 Ga0495667_0029546
776 Ga0495667_0043489
777 Ga0495667_0084105
778 Ga0495667_0880202
779 Ga0495656_0125859
780 Ga0495634_0001628
781 Ga0495634_0071080
782 Ga0495634_0346420
783 Ga0495611_0040914
784 Ga0495635_0000077
785 Ga0495635_0034876
786 Ga0495635_0049672
787 Ga0495635_0313026
788 Ga0495588_0298887
789 Ga0495657_0000390
790 Ga0495657_0030049
791 Ga0495657_0063426
792 Ga0495657_0076521
793 Ga0495657_0111657
794 Ga0495657_0152409
795 Ga0495599_0000021
796 Ga0495599_0093539
797 Ga0495599_0104401
798 Ga0495599_0122224
799 Ga0495623_0001594
800 Ga0495623_0001981
801 Ga0495623_0099757
802 Ga0495623_0170132
803 Ga0495623_0482413
804 Ga0495646_0000051
805 Ga0495646_0006351
806 Ga0495646_0019799
807 Ga0495646_0041891
808 Ga0495646_0233279
809 Ga0495647_0162781
810 Ga0495647_0217932
811 Ga0495647_0236463
812 Ga0495647_0316458
813 Ga0495658_0221455
814 Ga0495658_0338322
815 Ga0495658_0439859
816 Ga0495658_0990379
817 Ga0495613_0206861
818 Ga0495613_0217507
819 Ga0495613_0614589
820 Ga0495613_0891413
821 Ga0495624_0220897
822 Ga0495624_0408886
823 Ga0495670_0242810
824 Ga0495670_0313175
825 Ga0495600_0000114
826 Ga0495600_0002868
827 Ga0495600_0007177
828 Ga0495600_0050379
829 Ga0495600_0272540
830 Ga0495600_0344991
831 Ga0495581_0005632
832 Ga0495581_0024699
833 Ga0495581_0119027
834 Ga0495581_0274954
835 Ga0495604_0000036
836 Ga0495604_0021192
837 Ga0495604_0103118
838 Ga0495604_0151632
839 Ga0495604_0178829
840 Ga0495604_0322873
841 Ga0495636_0482988
842 Ga0495674_0000102
843 Ga0495674_0144912
844 Ga0495674_0149497
845 Ga0495674_0225681
846 Ga0495674_0646603
847 Ga0495674_1016526
848 Ga0495676_0041751
849 Ga0495676_0195269
850 Ga0495676_0664060
851 Ga0495680_0001061
852 Ga0495680_0008723
853 Ga0495680_0031675
854 Ga0495680_0052976
855 Ga0495680_0543662
856 Ga0495675_0000148
857 Ga0495675_0057111
858 Ga0495675_0135335
859 Ga0495675_0225128
860 Ga0495675_0601304
861 Ga0495684_0000025
862 Ga0495684_0001757
863 Ga0495684_0087830
864 Ga0495684_0611095
865 Ga0495684_0655391
866 Ga0495593_0000708
867 Ga0495593_0045450
868 Ga0495593_0087940
869 Ga0495593_0114058
870 Ga0495602_0000230
871 Ga0495602_0000311
872 Ga0495602_0011182
873 Ga0495602_0031685
874 Ga0495602_0215857
875 Ga0495602_0388540
876 Ga0496100_1629540
877 Ga0496104_0000170
878 Ga0496105_0001192
879 Ga0496112_0000014
880 Ga0496113_0799138
881 Ga0501071_0135391
882 Ga0501075_0916081
883 Ga0501076_0080378
884 Ga0501077_0070214
885 Ga0501081_0066327
886 nmdc:mga05p37_113402_c1
887 nmdc:mga05p37_3516_c1
888 nmdc:mga09592_14391_c1
889 nmdc:mga0qj67_15702_c1
890 nmdc:mga0qj67_90693_c1
891 nmdc:mga06r32_38177_c1
892 nmdc:mga06r32_73678_c1
893 nmdc:mga08y16_430343_c1
894 nmdc:mga0n895_615689_c1
895 nmdc:mga08x19_50501_c1
896 Ga0495601_0000025
897 Ga0495601_0000964
898 Ga0495601_0002825
899 Ga0495601_0005395
900 Ga0495601_0055351
901 Ga0495601_0220945
902 Ga0495601_0273363
903 Ga0495612_0000046
904 Ga0495612_0001142
905 Ga0495595_0000054
906 Ga0495595_0000118
907 Ga0495595_0001613
908 Ga0495595_0009103
909 Ga0495595_0013855
910 Ga0495595_0029286
911 Ga0495595_0037088
912 Ga0495595_0595135
913 Ga0495619_0000035
914 Ga0495619_0000307
915 Ga0495619_0002095
916 Ga0495619_0003647
917 Ga0495619_0080378
918 Ga0495619_0115521
919 Ga0495619_0132172
920 Ga0495619_0133593
921 Ga0495619_0252692
922 Ga0495619_0421081
923 Ga0500590_061062
924 Ga0500636_0161700
925 Ga0500657_123345
926 Ga0501084_0016609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07635

PSCyt1

Planctomycete cytochrome C

72

132

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ohl-assembly1.cif.gz_A catalytic domain of stromelysin-1 in complex with n-hydroxy-2-(4-methoxy-n-(pyridine-3-ylmethyl)phenylsulfonamido)acetamide 0.4805 103 126
3s5o-assembly1.cif.gz_A crystal structure of human 4-hydroxy-2-oxoglutarate aldolase bound to pyruvate 0.3822 87 131
6cun-assembly1.cif.gz_A engineered cytochrome c from rhodothermus marinus (rma tde) bound to carbene intermediate (1-ethoxy-1-oxopropan-2-ylidene) 0.2985 45 130
6cun-assembly1.cif.gz_A engineered cytochrome c from rhodothermus marinus (rma tde) bound to carbene intermediate (1-ethoxy-1-oxopropan-2-ylidene) 0.2233 45 130
7vz6-assembly1.cif.gz_A the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp-glucose 0.202 97 135
ID Description Score Start End Superfamily
1d9yA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5479 106 133 3.40.190.10
af_Q9VC98_62_294_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.5326 103 129 3.40.390.10
af_Q55EN5_204_390_1.10.1070.11 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain 0.4215 95 131 1.10.1070.11
3s5oA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.3822 87 131 3.20.20.70
2ee5A01 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase; Chain A;Rho GTPase activation protein 0.3631 89 130 1.10.555.10
ID Description Score Start End GO Terms
AF-A0A7C6RVV2-F1-model_v4 Cytochrome C Planctomycete-type domain-containing protein 0.9165 34 135 GO:0009055
GO:0020037
AF-A0A3M1M1H0-F1-model_v4 Cytochrome C Planctomycete-type domain-containing protein 0.9127 44 135 GO:0009055
GO:0020037
AF-A0A3M1M1H0-F1-model_v4 Cytochrome C Planctomycete-type domain-containing protein 0.8946 44 135 GO:0009055
GO:0020037
AF-A0A7K4ESE1-F1-model_v4 deleted 0.8935 36 135
AF-A0A7X2PQ56-F1-model_v4 Cytochrome C Planctomycete-type domain-containing protein 0.888 36 135 GO:0009055
GO:0020037

Map