F448936

General Info

Members Datasets Scaffolds Average Seq Length
462 239 459 371

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10226946|Ga0265316_102269461
Length 362
Sequence MSLADQALPYVRAISAYQPGKPITELARETGIPVDKIVKLASNENPLGMSPKAKKAVEAAISGVERYPDQFDLIKAVAAKAGVEQSQVVLGNGSNDVLDLIARVFLAPGRSAVFAQHAFAVYPLATLSIGGELIVTPAKNYGHDLDAMRAAIRPDTRIVWIANPNNPTGNFVPYPEVRAFLEAVPKDVVVVLDEAYNEYLPPAERVDVAGWIKDFPNLVVCRTMSKIYGLAGLRIGYALASAEVADLMNRVRQPFNVNNLALAGALAALDDDEFLQASYELNRRGMLQIVTGLEKLGLEYIKPHGNFVTFKVGDGAGINQKLLNLGVIVRPIGGYGLPEWLRVTIGTEAENARLLEALELVI

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
149 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
150 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
151 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
152 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
153 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
239 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.3
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100023318 3300005330 Bacteria 3795
2 Ga0070690_100042097 3300005330 Bacteria 2892
3 Ga0070670_100034318 3300005331 Bacteria 4366
4 Ga0070677_10002463 3300005333 Bacteria 5924
5 Ga0070666_10004998 3300005335 Bacteria 8112
6 Ga0068868_100079706 3300005338 Bacteria 2623
7 Ga0068868_100112852 3300005338 Bacteria 2210
8 Ga0070689_100048619 3300005340 Bacteria 3271
9 Ga0070691_10064085 3300005341 Bacteria 1773
10 Ga0070687_100016203 3300005343 Bacteria 3392
11 Ga0070687_100046055 3300005343 Bacteria 2231
12 Ga0070692_10015816 3300005345 Bacteria 3577
13 Ga0070692_10023653 3300005345 Bacteria 3012
14 Ga0070669_100318838 3300005353 Bacteria 1254
15 Ga0070675_100091675 3300005354 Bacteria 2546
16 Ga0070675_100290232 3300005354 Bacteria 1439
17 Ga0070671_100041992 3300005355 Bacteria 3801
18 Ga0070674_100022812 3300005356 Bacteria 4039
19 Ga0070673_100127573 3300005364 Bacteria 2130
20 Ga0070659_100188873 3300005366 Bacteria 1693
21 Ga0070667_100071764 3300005367 Bacteria 2949
22 Ga0070714_100001917 3300005435 Bacteria 15177
23 Ga0070705_100038490 3300005440 Bacteria 2706
24 Ga0070700_100002980 3300005441 Bacteria 8688
25 Ga0070700_100007202 3300005441 Bacteria 5992
26 Ga0070700_100020323 3300005441 Bacteria 3844
27 Ga0070700_100069946 3300005441 Bacteria 2236
28 Ga0070694_100078555 3300005444 Bacteria 2289
29 Ga0070662_100078967 3300005457 Bacteria 2446
30 Ga0070681_10000685 3300005458 Bacteria 28045
31 Ga0070681_10008164 3300005458 Bacteria 10249
32 Ga0068867_100002134 3300005459 Bacteria 13894
33 Ga0068867_100002723 3300005459 Bacteria 12466
34 Ga0068867_100034081 3300005459 Bacteria 3689
35 Ga0068867_100041867 3300005459 Bacteria 3348
36 Ga0068867_100072530 3300005459 Bacteria 2578
37 Ga0070684_100007846 3300005535 Bacteria 8324
38 Ga0070697_100114902 3300005536 Bacteria 2247
39 Ga0070697_100160548 3300005536 Bacteria 1899
40 Ga0070697_100222734 3300005536 Bacteria 1608
41 Ga0070686_100000425 3300005544 Bacteria 26563
42 Ga0070695_100034487 3300005545 Bacteria 3173
43 Ga0070695_100035637 3300005545 Bacteria 3126
44 Ga0070695_100041189 3300005545 Bacteria 2927
45 Ga0070695_100222703 3300005545 Bacteria 1360
46 Ga0070696_100004260 3300005546 Bacteria 9540
47 Ga0070696_100022721 3300005546 Bacteria 4263
48 Ga0070704_100007675 3300005549 Bacteria 6430
49 Ga0070704_100008861 3300005549 Bacteria 6056
50 Ga0070704_100052864 3300005549 Bacteria 2868
51 Ga0070704_100063605 3300005549 Bacteria 2649
52 Ga0068856_100114452 3300005614 Bacteria 2697
53 Ga0070702_100000216 3300005615 Bacteria 19242
54 Ga0070702_100027021 3300005615 Bacteria 3092
55 Ga0068859_100022141 3300005617 Bacteria 6373
56 Ga0068859_100070211 3300005617 Bacteria 3538
57 Ga0068859_100262819 3300005617 Bacteria 1817
58 Ga0068859_100279434 3300005617 Bacteria 1762
59 Ga0068864_100024494 3300005618 Bacteria 5078
60 Ga0068866_10000880 3300005718 Bacteria 13251
61 Ga0068866_10101064 3300005718 Bacteria 1591
62 Ga0068861_100000406 3300005719 Bacteria 24917
63 Ga0068861_100391074 3300005719 Bacteria 1231
64 Ga0068858_100053346 3300005842 Bacteria 3740
65 Ga0068862_100255738 3300005844 Bacteria 1597
66 Ga0070715_10009063 3300006163 Bacteria 3493
67 Ga0097621_100035601 3300006237 Bacteria 3979
68 Ga0068871_100000638 3300006358 Bacteria 24082
69 Ga0068871_100002996 3300006358 Bacteria 11587
70 Ga0068871_100143006 3300006358 Bacteria 2035
71 Ga0075428_100039788 3300006844 Bacteria 5175
72 Ga0075428_100131389 3300006844 Bacteria 2723
73 Ga0075428_100204237 3300006844 Bacteria 2135
74 Ga0075428_100270073 3300006844 Bacteria 1830
75 Ga0075428_100287315 3300006844 Bacteria 1769
76 Ga0075430_100005230 3300006846 Bacteria 10943
77 Ga0075430_100008533 3300006846 Bacteria 8654
78 Ga0075430_100104450 3300006846 Bacteria 2365
79 Ga0075430_100251478 3300006846 Bacteria 1464
80 Ga0075431_100005453 3300006847 Bacteria 12568
81 Ga0075434_100000017 3300006871 Bacteria 74154
82 Ga0075434_100063439 3300006871 Bacteria 3677
83 Ga0075429_100000003 3300006880 Bacteria 130377
84 Ga0075429_100011652 3300006880 Bacteria 7624
85 Ga0075429_100025516 3300006880 Bacteria 5129
86 Ga0075429_100042611 3300006880 Bacteria 3950
87 Ga0068865_100001425 3300006881 Bacteria 13951
88 Ga0068865_100005462 3300006881 Bacteria 7709
89 Ga0068865_100115988 3300006881 Bacteria 1983
90 Ga0075436_100012475 3300006914 Bacteria 5824
91 Ga0075436_100041119 3300006914 Bacteria 3190
92 Ga0075436_100045861 3300006914 Bacteria 3015
93 Ga0097620_100022140 3300006931 Bacteria 6373
94 Ga0097620_100070216 3300006931 Bacteria 3538
95 Ga0097620_100262828 3300006931 Bacteria 1817
96 Ga0097620_100279444 3300006931 Bacteria 1762
97 Ga0075435_100025665 3300007076 Bacteria 4589
98 Ga0075435_100074129 3300007076 Bacteria 2783
99 Ga0075435_100085143 3300007076 Bacteria 2602
100 Ga0099795_10035999 3300007788 Bacteria 1734
101 Ga0105240_10333289 3300009093 Bacteria 1726
102 Ga0111539_10002346 3300009094 Bacteria 25210
103 Ga0111539_10006612 3300009094 Bacteria 14934
104 Ga0111539_10024928 3300009094 Bacteria 7332
105 Ga0111539_10103982 3300009094 Bacteria 3332
106 Ga0111539_10177880 3300009094 Unclassified 2485
107 Ga0111539_10253607 3300009094 Bacteria 2049
108 Ga0111539_10423426 3300009094 Bacteria 1551
109 Ga0105245_10000182 3300009098 Bacteria 59361
110 Ga0105245_10081271 3300009098 Bacteria 2962
111 Ga0105245_10140385 3300009098 Bacteria 2275
112 Ga0105247_10190728 3300009101 Bacteria 1372
113 Ga0114129_10009603 3300009147 Bacteria 13798
114 Ga0114129_10317022 3300009147 Bacteria 2074
115 Ga0105243_10009415 3300009148 Bacteria 7444
116 Ga0105243_10016134 3300009148 Bacteria 5650
117 Ga0105243_10024968 3300009148 Bacteria 4563
118 Ga0105243_10082140 3300009148 Bacteria 2633
119 Ga0105242_10001174 3300009176 Bacteria 20608
120 Ga0105242_10011877 3300009176 Bacteria 6702
121 Ga0105242_10098157 3300009176 Bacteria 2478
122 Ga0105248_10125845 3300009177 Bacteria 2891
123 Ga0105249_10010145 3300009553 Bacteria 8270
124 Ga0105249_10072623 3300009553 Bacteria 3181
125 Ga0105239_10230970 3300010375 Bacteria 2075
126 Ga0105246_10125542 3300011119 Bacteria 1908
127 Ga0157370_10021267 3300013104 Bacteria 6468
128 Ga0157374_10186185 3300013296 Bacteria 2030
129 Ga0157374_10419827 3300013296 Bacteria 1336
130 Ga0157378_10001114 3300013297 Bacteria 24462
131 Ga0157378_10066853 3300013297 Bacteria 3220
132 Ga0163162_10055505 3300013306 Bacteria 3988
133 Ga0157372_10098937 3300013307 Bacteria 3327
134 Ga0157375_10021483 3300013308 Bacteria 5920
135 Ga0157375_10049269 3300013308 Bacteria 4126
136 Ga0157375_10179947 3300013308 Bacteria 2265
137 Ga0157375_10202428 3300013308 Bacteria 2141
138 Ga0163163_10181247 3300014325 Bacteria 2153
139 Ga0157380_10073176 3300014326 Bacteria 2778
140 Ga0157380_10132790 3300014326 Bacteria 2127
141 Ga0157379_10020793 3300014968 Bacteria 5808
142 Ga0157379_10111670 3300014968 Bacteria 2455
143 Ga0157379_10142277 3300014968 Unclassified 2162
144 Ga0157376_10035597 3300014969 Bacteria 4028
145 Ga0207697_10001747 3300025315 Bacteria 11677
146 Ga0207682_10033701 3300025893 Bacteria 2062
147 Ga0207642_10016651 3300025899 Bacteria 2775
148 Ga0207645_10005279 3300025907 Bacteria 9406
149 Ga0207643_10012125 3300025908 Bacteria 4658
150 Ga0207643_10059823 3300025908 Bacteria 2174
151 Ga0207707_10096785 3300025912 Bacteria 2579
152 Ga0207695_10114354 3300025913 Bacteria 2674
153 Ga0207660_10039252 3300025917 Bacteria 3309
154 Ga0207660_10209247 3300025917 Bacteria 1527
155 Ga0207662_10039783 3300025918 Bacteria 2760
156 Ga0207662_10074111 3300025918 Bacteria 2066
157 Ga0207649_10042514 3300025920 Bacteria 2773
158 Ga0207652_10028471 3300025921 Bacteria 4662
159 Ga0207681_10004318 3300025923 Bacteria 8772
160 Ga0207650_10066192 3300025925 Bacteria 2709
161 Ga0207659_10019165 3300025926 Bacteria 4497
162 Ga0207659_10168004 3300025926 Bacteria 1728
163 Ga0207687_10077940 3300025927 Bacteria 2385
164 Ga0207664_10045874 3300025929 Bacteria 3429
165 Ga0207690_10163614 3300025932 Bacteria 1661
166 Ga0207706_10007327 3300025933 Bacteria 10202
167 Ga0207686_10003193 3300025934 Bacteria 8817
168 Ga0207686_10018944 3300025934 Bacteria 3905
169 Ga0207686_10029917 3300025934 Bacteria 3219
170 Ga0207686_10030074 3300025934 Bacteria 3212
171 Ga0207709_10136348 3300025935 Bacteria 1681
172 Ga0207670_10008966 3300025936 Bacteria 5676
173 Ga0207704_10004505 3300025938 Bacteria 6368
174 Ga0207704_10005103 3300025938 Bacteria 6044
175 Ga0207711_10169356 3300025941 Bacteria 1981
176 Ga0207689_10000074 3300025942 Bacteria 80723
177 Ga0207689_10013398 3300025942 Bacteria 6999
178 Ga0207661_10101870 3300025944 Bacteria 2413
179 Ga0207661_10171123 3300025944 Bacteria 1891
180 Ga0207679_10092639 3300025945 Bacteria 2341
181 Ga0207712_10012958 3300025961 Bacteria 5338
182 Ga0207712_10013238 3300025961 Bacteria 5286
183 Ga0207668_10082189 3300025972 Bacteria 2339
184 Ga0207677_10037738 3300026023 Unclassified 3160
185 Ga0207677_10147625 3300026023 Bacteria 1809
186 Ga0207678_10101866 3300026067 Bacteria 2451
187 Ga0207708_10001899 3300026075 Bacteria 15444
188 Ga0207708_10011421 3300026075 Bacteria 6613
189 Ga0207708_10019279 3300026075 Bacteria 5139
190 Ga0207708_10093899 3300026075 Bacteria 2315
191 Ga0207708_10189724 3300026075 Bacteria 1635
192 Ga0207702_10067349 3300026078 Bacteria 3073
193 Ga0207702_10140825 3300026078 Bacteria 2182
194 Ga0207641_10163820 3300026088 Bacteria 2024
195 Ga0207648_10000059 3300026089 Bacteria 103580
196 Ga0207648_10004249 3300026089 Bacteria 14794
197 Ga0207648_10009053 3300026089 Bacteria 9578
198 Ga0207648_10035402 3300026089 Bacteria 4398
199 Ga0207648_10089096 3300026089 Bacteria 2695
200 Ga0207676_10119120 3300026095 Bacteria 2223
201 Ga0207674_10089786 3300026116 Bacteria 3065
202 Ga0207675_100000261 3300026118 Bacteria 50218
203 Ga0207675_100008426 3300026118 Bacteria 9718
204 Ga0207675_100013344 3300026118 Bacteria 7667
205 Ga0207683_10008821 3300026121 Bacteria 8600
206 Ga0207683_10017212 3300026121 Bacteria 6157
207 Ga0209969_1001748 3300027360 Bacteria 2996
208 Ga0209969_1008401 3300027360 Unclassified 1464
209 Ga0210000_1000583 3300027462 Bacteria 4992
210 Ga0209995_1004293 3300027471 Bacteria 2279
211 Ga0209999_1000354 3300027543 Bacteria 6959
212 Ga0209999_1006448 3300027543 Bacteria 2107
213 Ga0209983_1003592 3300027665 Bacteria 3291
214 Ga0207428_10022384 3300027907 Bacteria 5335
215 Ga0207428_10072469 3300027907 Bacteria 2704
216 Ga0268266_10052173 3300028379 Bacteria 3512
217 Ga0268265_10000957 3300028380 Bacteria 26523
218 Ga0268265_10185065 3300028380 Bacteria 1793
219 Ga0268265_10321810 3300028380 Bacteria 1401
220 Ga0265318_10002659 3300028577 Bacteria 9408
221 Ga0265330_10003509 3300031235 Bacteria 8174
222 Ga0265332_10001156 3300031238 Bacteria 15284
223 Ga0265328_10002609 3300031239 Bacteria 8056
224 Ga0265331_10000012 3300031250 Bacteria 297201
225 Ga0265331_10006686 3300031250 Bacteria 6771
226 Ga0265331_10007252 3300031250 Bacteria 6430
227 Ga0265331_10020603 3300031250 Bacteria 3383
228 Ga0265327_10000173 3300031251 Bacteria 138925
229 Ga0265327_10000458 3300031251 Bacteria 73095
230 Ga0265327_10004140 3300031251 Bacteria 13084
231 Ga0265327_10058894 3300031251 Bacteria 1969
232 Ga0265316_10004417 3300031344 Bacteria 14012
233 Ga0265316_10020215 3300031344 Bacteria 5674
234 Ga0265316_10226946 3300031344 Bacteria 1376
235 Ga0265314_10000450 3300031711 Bacteria 54942
236 Ga0265342_10026131 3300031712 Bacteria 3663
237 Ga0307406_10166407 3300031901 Bacteria 1591
238 Ga0307412_10052963 3300031911 Bacteria 2689
239 Ga0307412_10228696 3300031911 Bacteria 1431
240 Ga0307416_100055008 3300032002 Bacteria 3202
241 Ga0307416_100261449 3300032002 Bacteria 1692
242 Ga0307415_100076163 3300032126 Bacteria 2378
243 Ga0373934_0039407 3300035086 Bacteria 1863
244 Ga0373952_0000876 3300035092 Bacteria 5482
245 Ga0373936_0061266 3300035113 Bacteria 1536
246 Ga0373954_0000072 3300035118 Bacteria 35827
247 Ga0373954_0000934 3300035118 Bacteria 11358
248 Ga0373954_0007933 3300035118 Bacteria 4651
249 Ga0373956_0000005 3300035119 Bacteria 69067
250 Ga0373957_0006999 3300035120 Bacteria 3586
251 Ga0373955_0002156 3300035172 Bacteria 8508
252 Ga0373955_0101107 3300035172 Bacteria 1655
253 Ga0373924_0015595 3300035410 Bacteria 2890
254 Ga0373924_0023103 3300035410 Bacteria 2435
255 Ga0373931_0017533 3300035691 Bacteria 3545
256 Ga0373935_0011122 3300035692 Bacteria 5403
257 Ga0373935_0194780 3300035692 Bacteria 1398
258 Ga0373933_0003113 3300035724 Bacteria 9250
259 Ga0373933_0003169 3300035724 Bacteria 9187
260 Ga0373933_0004028 3300035724 Bacteria 8103
261 Ga0373937_0001775 3300036401 Bacteria 18120
262 Ga0373937_0058619 3300036401 Bacteria 3537
263 Ga0373925_0040181 3300037068 Bacteria 3463
264 Ga0395900_0061165 3300037418 Bacteria 3873
265 Ga0436361_0480295 3300039447 Bacteria 1448
266 Ga0451843_1618263 3300041509 Bacteria 1868
267 Ga0439441_006814 3300042001 Bacteria 1822
268 Ga0439443_003563 3300042003 Bacteria 1972
269 Ga0439443_004496 3300042003 Bacteria 1819
270 Ga0439456_016244 3300042013 Bacteria 1557
271 Ga0439435_0000164 3300042436 Bacteria 9201
272 Ga0439435_0000651 3300042436 Bacteria 5720
273 Ga0439444_0008763 3300042437 Bacteria 1581
274 Ga0439460_0000630 3300042461 Bacteria 7729
275 Ga0466965_0063300 3300044683 Bacteria 1851
276 Ga0453684_0004586 3300044712 Bacteria 28810
277 Ga0451576_0026308 3300045051 Bacteria 6259
278 Ga0466967_0003407 3300045976 Bacteria 10366
279 Ga0495592_0006887 3300046454 Bacteria 8487
280 Ga0495592_0013182 3300046454 Bacteria 6290
281 Ga0495651_0002160 3300046462 Bacteria 15218
282 Ga0495651_0020407 3300046462 Bacteria 5144
283 Ga0495580_0041365 3300046472 Bacteria 3286
284 Ga0495582_0067939 3300046473 Bacteria 1970
285 Ga0495639_0023166 3300046475 Bacteria 2727
286 Ga0495662_0007694 3300046476 Bacteria 5310
287 Ga0495608_0052775 3300046511 Bacteria 2690
288 Ga0495628_0013602 3300046516 Bacteria 6843
289 Ga0495628_0015463 3300046516 Bacteria 6372
290 Ga0495630_0001395 3300046517 Bacteria 16694
291 Ga0495630_0007934 3300046517 Bacteria 7616
292 Ga0495666_0007640 3300046526 Bacteria 5410
293 Ga0495652_0010394 3300046529 Bacteria 8436
294 Ga0495665_0023516 3300046531 Bacteria 3310
295 Ga0495640_0004081 3300046533 Bacteria 11683
296 Ga0495640_0188046 3300046533 Bacteria 1314
297 Ga0495586_0003437 3300046535 Bacteria 8486
298 Ga0495586_0035239 3300046535 Bacteria 2688
299 Ga0495587_0023883 3300046536 Bacteria 3753
300 Ga0495587_0097391 3300046536 Bacteria 1696
301 Ga0495645_0000958 3300046543 Bacteria 19749
302 Ga0495667_0016672 3300046559 Bacteria 4960
303 Ga0495667_0059553 3300046559 Bacteria 2506
304 Ga0495634_0049922 3300046642 Bacteria 2811
305 Ga0495634_0116185 3300046642 Bacteria 1716
306 Ga0495635_0023691 3300046663 Bacteria 4277
307 Ga0495635_0029362 3300046663 Bacteria 3823
308 Ga0495635_0086847 3300046663 Bacteria 2140
309 Ga0495657_0050206 3300046675 Bacteria 2805
310 Ga0495599_0002184 3300046678 Bacteria 11358
311 Ga0495599_0013048 3300046678 Bacteria 5129
312 Ga0495647_0000295 3300046681 Bacteria 13928
313 Ga0495658_0007328 3300046683 Bacteria 5454
314 Ga0495613_0007991 3300046689 Bacteria 7868
315 Ga0495613_0034147 3300046689 Bacteria 3778
316 Ga0495624_0027976 3300046690 Bacteria 3686
317 Ga0495624_0038222 3300046690 Bacteria 3084
318 Ga0495581_0152275 3300047315 Bacteria 1351
319 Ga0495604_0007589 3300047317 Bacteria 8585
320 Ga0495604_0062390 3300047317 Bacteria 2847
321 Ga0495604_0201499 3300047317 Bacteria 1380
322 Ga0495636_0015431 3300047318 Bacteria 3045
323 Ga0495674_0002146 3300047319 Bacteria 19384
324 Ga0495680_0078475 3300047322 Bacteria 2498
325 Ga0495684_0126819 3300047471 Bacteria 1919
326 Ga0495614_0022973 3300048089 Bacteria 2690
327 Ga0496108_0083693 3300048911 Bacteria 2706
328 Ga0496108_0173908 3300048911 Bacteria 1864
329 Ga0496109_0109415 3300048912 Bacteria 2569
330 Ga0496109_0244088 3300048912 Bacteria 1691
331 Ga0496114_0001990 3300048917 Bacteria 15553
332 Ga0496114_0032170 3300048917 Bacteria 4316
333 Ga0501031_0011595 3300049568 Bacteria 5748
334 Ga0501031_0024467 3300049568 Bacteria 3936
335 Ga0501032_0004102 3300049569 Bacteria 11037
336 Ga0501032_0006442 3300049569 Bacteria 8637
337 Ga0501032_0126742 3300049569 Bacteria 1686
338 Ga0501033_0002315 3300049570 Bacteria 16251
339 Ga0501033_0002794 3300049570 Bacteria 14620
340 Ga0501033_0020969 3300049570 Bacteria 4934
341 Ga0501033_0110400 3300049570 Bacteria 2002
342 Ga0501034_0000487 3300049571 Bacteria 64548
343 Ga0501036_0032254 3300049572 Bacteria 4426
344 Ga0501036_0050848 3300049572 Bacteria 3509
345 Ga0501036_0166291 3300049572 Bacteria 1859
346 Ga0501036_0279849 3300049572 Bacteria 1396
347 Ga0501037_0009510 3300049573 Bacteria 7132
348 Ga0501037_0027666 3300049573 Bacteria 4190
349 Ga0501037_0153638 3300049573 Bacteria 1644
350 Ga0501038_0003775 3300049574 Bacteria 14090
351 Ga0501038_0005751 3300049574 Bacteria 11488
352 Ga0501038_0010300 3300049574 Bacteria 8553
353 Ga0501039_0008865 3300049575 Bacteria 7664
354 Ga0501039_0024155 3300049575 Bacteria 4668
355 Ga0501039_0027129 3300049575 Bacteria 4404
356 Ga0501039_0053257 3300049575 Bacteria 3131
357 Ga0501039_0065750 3300049575 Bacteria 2813
358 Ga0501040_0002876 3300049576 Bacteria 11122
359 Ga0501040_0005878 3300049576 Bacteria 7943
360 Ga0501040_0014676 3300049576 Bacteria 5167
361 Ga0501040_0084559 3300049576 Bacteria 2201
362 Ga0501040_0214038 3300049576 Bacteria 1370
363 Ga0501041_0005283 3300049577 Bacteria 7549
364 Ga0501041_0021859 3300049577 Bacteria 3832
365 Ga0501041_0042902 3300049577 Bacteria 2749
366 Ga0501041_0198269 3300049577 Bacteria 1258
367 Ga0501042_0045296 3300049578 Bacteria 3135
368 Ga0501042_0088037 3300049578 Bacteria 2228
369 Ga0501043_0001775 3300049579 Bacteria 18543
370 Ga0501043_0002706 3300049579 Bacteria 14854
371 Ga0501043_0027679 3300049579 Bacteria 4450
372 Ga0501043_0037705 3300049579 Bacteria 3801
373 Ga0501046_0010030 3300049580 Bacteria 8158
374 Ga0501046_0087149 3300049580 Bacteria 2406
375 Ga0501047_0011008 3300049581 Bacteria 8560
376 Ga0501048_0001726 3300049582 Bacteria 16642
377 Ga0501048_0066328 3300049582 Bacteria 2552
378 Ga0501048_0120060 3300049582 Bacteria 1857
379 Ga0501067_0060061 3300049583 Bacteria 2104
380 Ga0501068_0000783 3300049584 Bacteria 16418
381 Ga0501068_0005521 3300049584 Bacteria 6929
382 Ga0501068_0042398 3300049584 Bacteria 2737
383 Ga0501068_0143833 3300049584 Bacteria 1496
384 Ga0501070_0021847 3300049586 Bacteria 5362
385 Ga0501071_0003552 3300049587 Bacteria 9761
386 Ga0501072_0009015 3300049588 Bacteria 7582
387 Ga0501072_0012944 3300049588 Bacteria 6382
388 Ga0501072_0042872 3300049588 Bacteria 3555
389 Ga0501073_0002905 3300049589 Bacteria 12860
390 Ga0501074_0025968 3300049590 Bacteria 4248
391 Ga0501075_0000841 3300049591 Bacteria 19343
392 Ga0501075_0007617 3300049591 Bacteria 7511
393 Ga0501075_0011495 3300049591 Bacteria 6267
394 Ga0501075_0054664 3300049591 Bacteria 3004
395 Ga0501076_0000166 3300049592 Bacteria 38261
396 Ga0501076_0003381 3300049592 Bacteria 11203
397 Ga0501079_0003440 3300049741 Bacteria 11629
398 Ga0501079_0203317 3300049741 Bacteria 1547
399 Ga0501080_0002322 3300049742 Bacteria 16602
400 Ga0501080_0035646 3300049742 Bacteria 4643
401 Ga0501080_0050197 3300049742 Bacteria 3884
402 Ga0501081_0003318 3300049743 Bacteria 10229
403 Ga0501081_0024336 3300049743 Bacteria 4065
404 Ga0501081_0044594 3300049743 Bacteria 3044
405 Ga0501081_0064468 3300049743 Bacteria 2545
406 Ga0501083_0008073 3300049744 Bacteria 7445
407 Ga0501280_002327 3300049776 Bacteria 3205
408 Ga0501035_0001382 3300049822 Bacteria 24950
409 Ga0501035_0033451 3300049822 Bacteria 4676
410 Ga0501035_0054170 3300049822 Bacteria 3584
411 Ga0501044_0000066 3300049823 Bacteria 128533
412 Ga0501044_0005140 3300049823 Bacteria 14594
413 Ga0501044_0012269 3300049823 Bacteria 9276
414 Ga0501044_0038871 3300049823 Bacteria 4968
415 Ga0501044_0268104 3300049823 Bacteria 1644
416 Ga0501045_0024666 3300049824 Bacteria 4318
417 Ga0501045_0067210 3300049824 Bacteria 2632
418 Ga0501045_0080856 3300049824 Bacteria 2396
419 nmdc:mga05p37_181328_c1 3300050507 Bacteria 2561
420 nmdc:mga05p37_486948_c1 3300050507 Bacteria 1419
421 nmdc:mga09592_29450_c1 3300050508 Bacteria 4567
422 nmdc:mga09592_3138_c1 3300050508 Bacteria 13418
423 nmdc:mga09592_35684_c1 3300050508 Bacteria 4163
424 nmdc:mga09592_93988_c1 3300050508 Bacteria 2564
425 nmdc:mga0qj67_101628_c1 3300050509 Bacteria 2318
426 nmdc:mga0qj67_23511_c1 3300050509 Bacteria 4743
427 nmdc:mga0qj67_29222_c1 3300050509 Bacteria 4281
428 nmdc:mga0qj67_2922_c1 3300050509 Bacteria 12269
429 nmdc:mga0qj67_54054_c1 3300050509 Bacteria 3180
430 nmdc:mga0qj67_70280_c1 3300050509 Bacteria 2793
431 nmdc:mga06r32_133774_c1 3300050510 Bacteria 2454
432 nmdc:mga06r32_157066_c1 3300050510 Bacteria 2256
433 nmdc:mga06r32_19344_c1 3300050510 Bacteria 6248
434 nmdc:mga06r32_291882_c1 3300050510 Bacteria 1617
435 nmdc:mga06r32_34661_c1 3300050510 Bacteria 4761
436 nmdc:mga08y16_536705_c1 3300050511 Bacteria 1185
437 nmdc:mga08y16_5382_c1 3300050511 Bacteria 13389
438 nmdc:mga08y16_583170_c1 3300050511 Bacteria 1129
439 nmdc:mga08y16_77693_c1 3300050511 Bacteria 3461
440 nmdc:mga08y16_79758_c1 3300050511 Bacteria 3412
441 nmdc:mga0n895_151_c1 3300050512 Bacteria 42739
442 nmdc:mga0n895_8493_c1 3300050512 Bacteria 8896
443 nmdc:mga0rr50_18966_c1 3300050513 Bacteria 4633
444 nmdc:mga0rr50_56319_c1 3300050513 Bacteria 2937
445 nmdc:mga08x19_139749_c1 3300050514 Bacteria 1635
446 nmdc:mga08x19_150166_c1 3300050514 Bacteria 1577
447 nmdc:mga08x19_29876_c1 3300050514 Bacteria 3420
448 nmdc:mga08x19_68200_c1 3300050514 Bacteria 2315
449 Ga0495601_0002012 3300053077 Bacteria 11407
450 Ga0495619_0024402 3300053085 Bacteria 3879
451 Ga0495619_0090629 3300053085 Bacteria 2070
452 Ga0501084_0023906 3300054114 Bacteria 5098
453 Ga0501084_0082600 3300054114 Bacteria 2696
454 Ga0501084_0089179 3300054114 Bacteria 2589
455 Ga0501082_0004974 3300060353 Bacteria 11604
456 Ga0501082_0011950 3300060353 Bacteria 7466
457 Ga0501082_0296738 3300060353 Bacteria 1407
458 Ga0530510_0000956 3300061734 Bacteria 19075
459 Ga0530510_0053854 3300061734 Bacteria 2907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100188873 Ga0070659_1001888731 335
2 3300050511 nmdc:mga08y16_583170_c1 nmdc:mga08y16_583170_c1_32_1114 337
3 3300027360 Ga0209969_1008401 Ga0209969_10084012 342
4 3300031911 Ga0307412_10228696 Ga0307412_102286962 357
5 3300042003 Ga0439443_003563 Ga0439443_003563_871_1944 357
6 3300050511 nmdc:mga08y16_536705_c1 nmdc:mga08y16_536705_c1_12_1085 357
7 3300049571 Ga0501034_0000487 Ga0501034_0000487_3942_5078 358
8 3300049588 Ga0501072_0009015 Ga0501072_0009015_1574_2710 358
9 3300031250 Ga0265331_10020603 Ga0265331_100206033 359
10 3300031251 Ga0265327_10004140 Ga0265327_100041407 359
11 iso_pu_bacteria 2891633521 2891634054 361
12 iso_pu_bacteria 639633007 639786198 361
13 3300031344 Ga0265316_10020215 Ga0265316_100202154 362
14 3300031344 Ga0265316_10226946 Ga0265316_102269461 362
15 3300041509 Ga0451843_1618263 Ga0451843_1618263_426_1514 362
16 3300044712 Ga0453684_0004586 Ga0453684_0004586_20844_21932 362
17 3300045051 Ga0451576_0026308 Ga0451576_0026308_2350_3438 362
18 iso_pu_bacteria 2574179768 2574431009 362
19 3300005435 Ga0070714_100001917 Ga0070714_10000191713 364
20 3300005536 Ga0070697_100114902 Ga0070697_1001149022 364
21 3300005536 Ga0070697_100160548 Ga0070697_1001605482 364
22 3300005545 Ga0070695_100222703 Ga0070695_1002227031 364
23 3300005549 Ga0070704_100052864 Ga0070704_1000528642 364
24 3300007788 Ga0099795_10035999 Ga0099795_100359992 364
25 3300013104 Ga0157370_10021267 Ga0157370_100212675 364
26 3300025929 Ga0207664_10045874 Ga0207664_100458743 364
27 3300035113 Ga0373936_0061266 Ga0373936_0061266_213_1313 364
28 3300035118 Ga0373954_0000934 Ga0373954_0000934_9077_10177 364
29 3300035120 Ga0373957_0006999 Ga0373957_0006999_1044_2144 364
30 3300035410 Ga0373924_0015595 Ga0373924_0015595_1173_2273 364
31 3300035692 Ga0373935_0011122 Ga0373935_0011122_2821_3921 364
32 3300036401 Ga0373937_0058619 Ga0373937_0058619_892_1992 364
33 3300037068 Ga0373925_0040181 Ga0373925_0040181_1526_2626 364
34 3300046454 Ga0495592_0013182 Ga0495592_0013182_3063_4163 364
35 3300046462 Ga0495651_0020407 Ga0495651_0020407_2418_3518 364
36 3300046472 Ga0495580_0041365 Ga0495580_0041365_735_1835 364
37 3300046475 Ga0495639_0023166 Ga0495639_0023166_1487_2587 364
38 3300046511 Ga0495608_0052775 Ga0495608_0052775_1123_2223 364
39 3300046516 Ga0495628_0015463 Ga0495628_0015463_2044_3144 364
40 3300046517 Ga0495630_0001395 Ga0495630_0001395_180_1280 364
41 3300046526 Ga0495666_0007640 Ga0495666_0007640_3769_4869 364
42 3300046529 Ga0495652_0010394 Ga0495652_0010394_6722_7822 364
43 3300046531 Ga0495665_0023516 Ga0495665_0023516_666_1766 364
44 3300046535 Ga0495586_0035239 Ga0495586_0035239_1456_2556 364
45 3300046536 Ga0495587_0097391 Ga0495587_0097391_287_1387 364
46 3300046543 Ga0495645_0000958 Ga0495645_0000958_15733_16833 364
47 3300046642 Ga0495634_0049922 Ga0495634_0049922_269_1369 364
48 3300046663 Ga0495635_0086847 Ga0495635_0086847_219_1319 364
49 3300046678 Ga0495599_0002184 Ga0495599_0002184_3894_4994 364
50 3300046678 Ga0495599_0013048 Ga0495599_0013048_2593_3693 364
51 3300046681 Ga0495647_0000295 Ga0495647_0000295_11218_12318 364
52 3300046689 Ga0495613_0034147 Ga0495613_0034147_1485_2585 364
53 3300046690 Ga0495624_0027976 Ga0495624_0027976_377_1477 364
54 3300047317 Ga0495604_0062390 Ga0495604_0062390_1443_2543 364
55 3300047319 Ga0495674_0002146 Ga0495674_0002146_3606_4706 364
56 3300047322 Ga0495680_0078475 Ga0495680_0078475_317_1417 364
57 3300047471 Ga0495684_0126819 Ga0495684_0126819_468_1568 364
58 3300048089 Ga0495614_0022973 Ga0495614_0022973_1033_2133 364
59 3300050514 nmdc:mga08x19_139749_c1 nmdc:mga08x19_139749_c1_294_1394 364
60 3300053077 Ga0495601_0002012 Ga0495601_0002012_3366_4466 364
61 3300005617 Ga0068859_100279434 Ga0068859_1002794341 365
62 3300006846 Ga0075430_100104450 Ga0075430_1001044502 365
63 3300006847 Ga0075431_100005453 Ga0075431_1000054533 365
64 3300006931 Ga0097620_100279444 Ga0097620_1002794442 365
65 3300009093 Ga0105240_10333289 Ga0105240_103332892 365
66 3300009094 Ga0111539_10253607 Ga0111539_102536072 365
67 3300011119 Ga0105246_10125542 Ga0105246_101255422 365
68 3300014325 Ga0163163_10181247 Ga0163163_101812472 365
69 3300025913 Ga0207695_10114354 Ga0207695_101143542 365
70 3300026078 Ga0207702_10140825 Ga0207702_101408252 365
71 3300031901 Ga0307406_10166407 Ga0307406_101664072 365
72 3300032002 Ga0307416_100261449 Ga0307416_1002614491 365
73 3300032126 Ga0307415_100076163 Ga0307415_1000761632 365
74 3300049570 Ga0501033_0002315 Ga0501033_0002315_5984_7090 365
75 3300049572 Ga0501036_0166291 Ga0501036_0166291_83_1180 365
76 3300049573 Ga0501037_0027666 Ga0501037_0027666_782_1888 365
77 3300049574 Ga0501038_0005751 Ga0501038_0005751_6844_7950 365
78 3300049575 Ga0501039_0008865 Ga0501039_0008865_5835_6932 365
79 3300049575 Ga0501039_0053257 Ga0501039_0053257_616_1722 365
80 3300049576 Ga0501040_0014676 Ga0501040_0014676_2845_3942 365
81 3300049577 Ga0501041_0005283 Ga0501041_0005283_1688_2785 365
82 3300049579 Ga0501043_0027679 Ga0501043_0027679_994_2100 365
83 3300049579 Ga0501043_0037705 Ga0501043_0037705_2081_3178 365
84 3300049580 Ga0501046_0087149 Ga0501046_0087149_43_1140 365
85 3300049581 Ga0501047_0011008 Ga0501047_0011008_5022_6128 365
86 3300049588 Ga0501072_0042872 Ga0501072_0042872_113_1210 365
87 3300049591 Ga0501075_0011495 Ga0501075_0011495_1283_2380 365
88 3300049592 Ga0501076_0003381 Ga0501076_0003381_6400_7497 365
89 3300049741 Ga0501079_0003440 Ga0501079_0003440_4197_5294 365
90 3300049742 Ga0501080_0050197 Ga0501080_0050197_1999_3096 365
91 3300049743 Ga0501081_0003318 Ga0501081_0003318_4210_5307 365
92 3300049776 Ga0501280_002327 Ga0501280_002327_1280_2377 365
93 3300049822 Ga0501035_0033451 Ga0501035_0033451_1715_2821 365
94 3300049823 Ga0501044_0000066 Ga0501044_0000066_16714_17820 365
95 3300049823 Ga0501044_0012269 Ga0501044_0012269_3641_4747 365
96 3300050509 nmdc:mga0qj67_29222_c1 nmdc:mga0qj67_29222_c1_2251_3348 365
97 3300050510 nmdc:mga06r32_34661_c1 nmdc:mga06r32_34661_c1_3274_4371 365
98 3300054114 Ga0501084_0023906 Ga0501084_0023906_595_1692 365
99 3300060353 Ga0501082_0011950 Ga0501082_0011950_105_1202 365
100 3300061734 Ga0530510_0053854 Ga0530510_0053854_845_1942 365
101 3300005545 Ga0070695_100041189 Ga0070695_1000411892 366
102 3300005614 Ga0068856_100114452 Ga0068856_1001144522 366
103 3300006914 Ga0075436_100012475 Ga0075436_1000124752 366
104 3300007076 Ga0075435_100074129 Ga0075435_1000741292 366
105 3300009094 Ga0111539_10002346 Ga0111539_1000234618 366
106 3300009094 Ga0111539_10006612 Ga0111539_100066125 366
107 3300009094 Ga0111539_10177880 Ga0111539_101778803 366
108 3300013308 Ga0157375_10049269 Ga0157375_100492693 366
109 3300014968 Ga0157379_10142277 Ga0157379_101422772 366
110 3300014969 Ga0157376_10035597 Ga0157376_100355973 366
111 3300025932 Ga0207690_10163614 Ga0207690_101636142 366
112 3300026067 Ga0207678_10101866 Ga0207678_101018662 366
113 3300026078 Ga0207702_10067349 Ga0207702_100673493 366
114 3300027360 Ga0209969_1001748 Ga0209969_10017483 366
115 3300027462 Ga0210000_1000583 Ga0210000_10005832 366
116 3300027543 Ga0209999_1000354 Ga0209999_10003543 366
117 3300027907 Ga0207428_10072469 Ga0207428_100724692 366
118 3300031251 Ga0265327_10000458 Ga0265327_1000045850 366
119 3300035092 Ga0373952_0000876 Ga0373952_0000876_775_1926 366
120 3300035118 Ga0373954_0007933 Ga0373954_0007933_816_1934 366
121 3300035119 Ga0373956_0000005 Ga0373956_0000005_17959_19077 366
122 3300035172 Ga0373955_0101107 Ga0373955_0101107_423_1541 366
123 3300035724 Ga0373933_0003169 Ga0373933_0003169_5031_6149 366
124 3300036401 Ga0373937_0001775 Ga0373937_0001775_5110_6228 366
125 3300037418 Ga0395900_0061165 Ga0395900_0061165_1026_2222 366
126 3300046462 Ga0495651_0002160 Ga0495651_0002160_5009_6127 366
127 3300046559 Ga0495667_0059553 Ga0495667_0059553_540_1658 366
128 3300046675 Ga0495657_0050206 Ga0495657_0050206_1374_2492 366
129 3300048911 Ga0496108_0083693 Ga0496108_0083693_1469_2638 366
130 3300048911 Ga0496108_0173908 Ga0496108_0173908_584_1774 366
131 3300048912 Ga0496109_0109415 Ga0496109_0109415_126_1322 366
132 3300048917 Ga0496114_0001990 Ga0496114_0001990_13759_14949 366
133 3300048917 Ga0496114_0032170 Ga0496114_0032170_2946_4115 366
134 3300049568 Ga0501031_0011595 Ga0501031_0011595_2347_3471 366
135 3300049568 Ga0501031_0024467 Ga0501031_0024467_2532_3656 366
136 3300049569 Ga0501032_0004102 Ga0501032_0004102_6363_7487 366
137 3300049569 Ga0501032_0006442 Ga0501032_0006442_1134_2258 366
138 3300049570 Ga0501033_0002794 Ga0501033_0002794_9985_11109 366
139 3300049570 Ga0501033_0020969 Ga0501033_0020969_3564_4688 366
140 3300049572 Ga0501036_0050848 Ga0501036_0050848_1194_2318 366
141 3300049573 Ga0501037_0009510 Ga0501037_0009510_2458_3582 366
142 3300049573 Ga0501037_0153638 Ga0501037_0153638_168_1346 366
143 3300049574 Ga0501038_0003775 Ga0501038_0003775_11127_12251 366
144 3300049574 Ga0501038_0010300 Ga0501038_0010300_4820_5944 366
145 3300049575 Ga0501039_0024155 Ga0501039_0024155_1164_2288 366
146 3300049575 Ga0501039_0065750 Ga0501039_0065750_498_1622 366
147 3300049576 Ga0501040_0002876 Ga0501040_0002876_4925_6049 366
148 3300049579 Ga0501043_0001775 Ga0501043_0001775_9085_10209 366
149 3300049579 Ga0501043_0002706 Ga0501043_0002706_12050_13174 366
150 3300049580 Ga0501046_0010030 Ga0501046_0010030_5156_6280 366
151 3300049582 Ga0501048_0001726 Ga0501048_0001726_5236_6360 366
152 3300049584 Ga0501068_0005521 Ga0501068_0005521_3544_4668 366
153 3300049822 Ga0501035_0001382 Ga0501035_0001382_10670_11794 366
154 3300049822 Ga0501035_0054170 Ga0501035_0054170_780_1904 366
155 3300049823 Ga0501044_0005140 Ga0501044_0005140_9919_11043 366
156 3300049823 Ga0501044_0038871 Ga0501044_0038871_1188_2312 366
157 3300049823 Ga0501044_0268104 Ga0501044_0268104_299_1477 366
158 3300049824 Ga0501045_0024666 Ga0501045_0024666_3076_4200 366
159 3300049824 Ga0501045_0080856 Ga0501045_0080856_1252_2376 366
160 3300050508 nmdc:mga09592_35684_c1 nmdc:mga09592_35684_c1_2785_3885 366
161 3300050509 nmdc:mga0qj67_101628_c1 nmdc:mga0qj67_101628_c1_684_1784 366
162 3300050510 nmdc:mga06r32_291882_c1 nmdc:mga06r32_291882_c1_488_1588 366
163 3300050511 nmdc:mga08y16_5382_c1 nmdc:mga08y16_5382_c1_3827_4996 366
164 3300050514 nmdc:mga08x19_150166_c1 nmdc:mga08x19_150166_c1_243_1364 366
165 3300005338 Ga0068868_100112852 Ga0068868_1001128522 367
166 3300005341 Ga0070691_10064085 Ga0070691_100640852 367
167 3300005343 Ga0070687_100016203 Ga0070687_1000162033 367
168 3300005345 Ga0070692_10023653 Ga0070692_100236532 367
169 3300005440 Ga0070705_100038490 Ga0070705_1000384903 367
170 3300005441 Ga0070700_100007202 Ga0070700_1000072025 367
171 3300005444 Ga0070694_100078555 Ga0070694_1000785552 367
172 3300005459 Ga0068867_100002134 Ga0068867_1000021343 367
173 3300005459 Ga0068867_100072530 Ga0068867_1000725302 367
174 3300005544 Ga0070686_100000425 Ga0070686_1000004256 367
175 3300005545 Ga0070695_100034487 Ga0070695_1000344871 367
176 3300005546 Ga0070696_100004260 Ga0070696_1000042609 367
177 3300005549 Ga0070704_100007675 Ga0070704_1000076755 367
178 3300005549 Ga0070704_100063605 Ga0070704_1000636051 367
179 3300005615 Ga0070702_100000216 Ga0070702_10000021614 367
180 3300005617 Ga0068859_100022141 Ga0068859_1000221411 367
181 3300005617 Ga0068859_100070211 Ga0068859_1000702113 367
182 3300005718 Ga0068866_10000880 Ga0068866_1000088011 367
183 3300005719 Ga0068861_100000406 Ga0068861_10000040624 367
184 3300006358 Ga0068871_100002996 Ga0068871_1000029965 367
185 3300006844 Ga0075428_100039788 Ga0075428_1000397885 367
186 3300006880 Ga0075429_100000003 Ga0075429_1000000034 367
187 3300006881 Ga0068865_100001425 Ga0068865_1000014253 367
188 3300006931 Ga0097620_100022140 Ga0097620_1000221401 367
189 3300006931 Ga0097620_100070216 Ga0097620_1000702163 367
190 3300007076 Ga0075435_100085143 Ga0075435_1000851433 367
191 3300009094 Ga0111539_10024928 Ga0111539_100249282 367
192 3300009098 Ga0105245_10000182 Ga0105245_1000018224 367
193 3300009101 Ga0105247_10190728 Ga0105247_101907282 367
194 3300009147 Ga0114129_10009603 Ga0114129_100096036 367
195 3300009148 Ga0105243_10009415 Ga0105243_100094154 367
196 3300009176 Ga0105242_10001174 Ga0105242_1000117416 367
197 3300009553 Ga0105249_10010145 Ga0105249_100101452 367
198 3300009553 Ga0105249_10072623 Ga0105249_100726233 367
199 3300010375 Ga0105239_10230970 Ga0105239_102309702 367
200 3300013297 Ga0157378_10001114 Ga0157378_1000111417 367
201 3300013308 Ga0157375_10202428 Ga0157375_102024282 367
202 3300014326 Ga0157380_10073176 Ga0157380_100731762 367
203 3300014968 Ga0157379_10020793 Ga0157379_100207933 367
204 3300025899 Ga0207642_10016651 Ga0207642_100166513 367
205 3300025918 Ga0207662_10074111 Ga0207662_100741112 367
206 3300025934 Ga0207686_10018944 Ga0207686_100189441 367
207 3300025934 Ga0207686_10029917 Ga0207686_100299173 367
208 3300025936 Ga0207670_10008966 Ga0207670_100089663 367
209 3300025938 Ga0207704_10005103 Ga0207704_100051034 367
210 3300025942 Ga0207689_10000074 Ga0207689_1000007468 367
211 3300025961 Ga0207712_10013238 Ga0207712_100132385 367
212 3300026023 Ga0207677_10147625 Ga0207677_101476252 367
213 3300026075 Ga0207708_10001899 Ga0207708_1000189912 367
214 3300026089 Ga0207648_10000059 Ga0207648_1000005965 367
215 3300026089 Ga0207648_10089096 Ga0207648_100890962 367
216 3300026118 Ga0207675_100000261 Ga0207675_10000026119 367
217 3300027543 Ga0209999_1006448 Ga0209999_10064482 367
218 3300028379 Ga0268266_10052173 Ga0268266_100521733 367
219 3300028380 Ga0268265_10185065 Ga0268265_101850652 367
220 3300028380 Ga0268265_10321810 Ga0268265_103218102 367
221 3300031239 Ga0265328_10002609 Ga0265328_100026095 367
222 3300031250 Ga0265331_10000012 Ga0265331_1000001219 367
223 3300031251 Ga0265327_10000173 Ga0265327_10000173115 367
224 3300042013 Ga0439456_016244 Ga0439456_016244_333_1436 367
225 3300042436 Ga0439435_0000164 Ga0439435_0000164_3993_5108 367
226 3300046454 Ga0495592_0006887 Ga0495592_0006887_50_1153 367
227 3300046476 Ga0495662_0007694 Ga0495662_0007694_85_1188 367
228 3300046516 Ga0495628_0013602 Ga0495628_0013602_142_1245 367
229 3300046517 Ga0495630_0007934 Ga0495630_0007934_6315_7418 367
230 3300046533 Ga0495640_0004081 Ga0495640_0004081_4927_6030 367
231 3300046535 Ga0495586_0003437 Ga0495586_0003437_5052_6155 367
232 3300046536 Ga0495587_0023883 Ga0495587_0023883_18_1121 367
233 3300046559 Ga0495667_0016672 Ga0495667_0016672_3808_4911 367
234 3300046642 Ga0495634_0116185 Ga0495634_0116185_383_1486 367
235 3300046663 Ga0495635_0029362 Ga0495635_0029362_2206_3309 367
236 3300046689 Ga0495613_0007991 Ga0495613_0007991_2981_4084 367
237 3300046690 Ga0495624_0038222 Ga0495624_0038222_1937_3040 367
238 3300047315 Ga0495581_0152275 Ga0495581_0152275_167_1270 367
239 3300047317 Ga0495604_0007589 Ga0495604_0007589_507_1610 367
240 3300049578 Ga0501042_0088037 Ga0501042_0088037_568_1671 367
241 3300050508 nmdc:mga09592_3138_c1 nmdc:mga09592_3138_c1_7460_8563 367
242 3300050510 nmdc:mga06r32_19344_c1 nmdc:mga06r32_19344_c1_1746_2849 367
243 3300050511 nmdc:mga08y16_77693_c1 nmdc:mga08y16_77693_c1_2305_3408 367
244 3300053085 Ga0495619_0024402 Ga0495619_0024402_957_2060 367
245 3300005330 Ga0070690_100042097 Ga0070690_1000420973 368
246 3300005331 Ga0070670_100034318 Ga0070670_1000343183 368
247 3300005333 Ga0070677_10002463 Ga0070677_100024632 368
248 3300005335 Ga0070666_10004998 Ga0070666_100049983 368
249 3300005338 Ga0068868_100079706 Ga0068868_1000797063 368
250 3300005340 Ga0070689_100048619 Ga0070689_1000486193 368
251 3300005343 Ga0070687_100046055 Ga0070687_1000460552 368
252 3300005354 Ga0070675_100290232 Ga0070675_1002902321 368
253 3300005355 Ga0070671_100041992 Ga0070671_1000419924 368
254 3300005356 Ga0070674_100022812 Ga0070674_1000228123 368
255 3300005364 Ga0070673_100127573 Ga0070673_1001275732 368
256 3300005367 Ga0070667_100071764 Ga0070667_1000717642 368
257 3300005441 Ga0070700_100020323 Ga0070700_1000203232 368
258 3300005441 Ga0070700_100069946 Ga0070700_1000699462 368
259 3300005458 Ga0070681_10008164 Ga0070681_100081648 368
260 3300005459 Ga0068867_100034081 Ga0068867_1000340812 368
261 3300005459 Ga0068867_100041867 Ga0068867_1000418672 368
262 3300005536 Ga0070697_100222734 Ga0070697_1002227342 368
263 3300005615 Ga0070702_100027021 Ga0070702_1000270212 368
264 3300005617 Ga0068859_100262819 Ga0068859_1002628192 368
265 3300005618 Ga0068864_100024494 Ga0068864_1000244944 368
266 3300005718 Ga0068866_10101064 Ga0068866_101010642 368
267 3300005842 Ga0068858_100053346 Ga0068858_1000533463 368
268 3300005844 Ga0068862_100255738 Ga0068862_1002557382 368
269 3300006163 Ga0070715_10009063 Ga0070715_100090632 368
270 3300006237 Ga0097621_100035601 Ga0097621_1000356013 368
271 3300006358 Ga0068871_100143006 Ga0068871_1001430062 368
272 3300006844 Ga0075428_100287315 Ga0075428_1002873152 368
273 3300006880 Ga0075429_100011652 Ga0075429_1000116525 368
274 3300006881 Ga0068865_100115988 Ga0068865_1001159882 368
275 3300006931 Ga0097620_100262828 Ga0097620_1002628282 368
276 3300009094 Ga0111539_10103982 Ga0111539_101039822 368
277 3300009098 Ga0105245_10081271 Ga0105245_100812713 368
278 3300009098 Ga0105245_10140385 Ga0105245_101403852 368
279 3300009147 Ga0114129_10317022 Ga0114129_103170222 368
280 3300009148 Ga0105243_10024968 Ga0105243_100249683 368
281 3300009148 Ga0105243_10082140 Ga0105243_100821403 368
282 3300009176 Ga0105242_10011877 Ga0105242_100118774 368
283 3300009176 Ga0105242_10098157 Ga0105242_100981572 368
284 3300009177 Ga0105248_10125845 Ga0105248_101258452 368
285 3300013296 Ga0157374_10186185 Ga0157374_101861852 368
286 3300013296 Ga0157374_10419827 Ga0157374_104198271 368
287 3300013297 Ga0157378_10066853 Ga0157378_100668533 368
288 3300013307 Ga0157372_10098937 Ga0157372_100989373 368
289 3300013308 Ga0157375_10021483 Ga0157375_100214832 368
290 3300013308 Ga0157375_10179947 Ga0157375_101799472 368
291 3300014326 Ga0157380_10132790 Ga0157380_101327902 368
292 3300014968 Ga0157379_10111670 Ga0157379_101116702 368
293 3300025315 Ga0207697_10001747 Ga0207697_100017476 368
294 3300025893 Ga0207682_10033701 Ga0207682_100337012 368
295 3300025907 Ga0207645_10005279 Ga0207645_100052793 368
296 3300025908 Ga0207643_10012125 Ga0207643_100121252 368
297 3300025917 Ga0207660_10039252 Ga0207660_100392523 368
298 3300025918 Ga0207662_10039783 Ga0207662_100397832 368
299 3300025920 Ga0207649_10042514 Ga0207649_100425142 368
300 3300025925 Ga0207650_10066192 Ga0207650_100661922 368
301 3300025926 Ga0207659_10019165 Ga0207659_100191653 368
302 3300025927 Ga0207687_10077940 Ga0207687_100779401 368
303 3300025933 Ga0207706_10007327 Ga0207706_100073276 368
304 3300025934 Ga0207686_10003193 Ga0207686_100031935 368
305 3300025934 Ga0207686_10030074 Ga0207686_100300743 368
306 3300025935 Ga0207709_10136348 Ga0207709_101363482 368
307 3300025941 Ga0207711_10169356 Ga0207711_101693562 368
308 3300025942 Ga0207689_10013398 Ga0207689_100133985 368
309 3300025944 Ga0207661_10171123 Ga0207661_101711232 368
310 3300025945 Ga0207679_10092639 Ga0207679_100926392 368
311 3300026023 Ga0207677_10037738 Ga0207677_100377382 368
312 3300026075 Ga0207708_10011421 Ga0207708_100114215 368
313 3300026075 Ga0207708_10093899 Ga0207708_100938992 368
314 3300026088 Ga0207641_10163820 Ga0207641_101638202 368
315 3300026089 Ga0207648_10004249 Ga0207648_100042495 368
316 3300026089 Ga0207648_10035402 Ga0207648_100354023 368
317 3300026095 Ga0207676_10119120 Ga0207676_101191202 368
318 3300026116 Ga0207674_10089786 Ga0207674_100897862 368
319 3300026118 Ga0207675_100008426 Ga0207675_1000084265 368
320 3300026121 Ga0207683_10008821 Ga0207683_100088213 368
321 3300026121 Ga0207683_10017212 Ga0207683_100172123 368
322 3300027907 Ga0207428_10022384 Ga0207428_100223844 368
323 3300028577 Ga0265318_10002659 Ga0265318_100026595 368
324 3300031235 Ga0265330_10003509 Ga0265330_100035094 368
325 3300031238 Ga0265332_10001156 Ga0265332_100011567 368
326 3300031250 Ga0265331_10006686 Ga0265331_100066862 368
327 3300031250 Ga0265331_10007252 Ga0265331_100072524 368
328 3300031251 Ga0265327_10058894 Ga0265327_100588942 368
329 3300031344 Ga0265316_10004417 Ga0265316_100044179 368
330 3300031711 Ga0265314_10000450 Ga0265314_1000045045 368
331 3300031712 Ga0265342_10026131 Ga0265342_100261312 368
332 3300031911 Ga0307412_10052963 Ga0307412_100529633 368
333 3300035691 Ga0373931_0017533 Ga0373931_0017533_2055_3173 368
334 3300039447 Ga0436361_0480295 Ga0436361_0480295_307_1416 368
335 3300046683 Ga0495658_0007328 Ga0495658_0007328_318_1442 368
336 3300048912 Ga0496109_0244088 Ga0496109_0244088_127_1251 368
337 3300049569 Ga0501032_0126742 Ga0501032_0126742_529_1662 368
338 3300049584 Ga0501068_0000783 Ga0501068_0000783_11530_12663 368
339 3300049586 Ga0501070_0021847 Ga0501070_0021847_3336_4469 368
340 3300049589 Ga0501073_0002905 Ga0501073_0002905_11421_12554 368
341 3300049590 Ga0501074_0025968 Ga0501074_0025968_2424_3557 368
342 3300049742 Ga0501080_0002322 Ga0501080_0002322_11456_12589 368
343 3300049744 Ga0501083_0008073 Ga0501083_0008073_3462_4595 368
344 3300050507 nmdc:mga05p37_181328_c1 nmdc:mga05p37_181328_c1_958_2064 368
345 3300050510 nmdc:mga06r32_157066_c1 nmdc:mga06r32_157066_c1_392_1498 368
346 3300050513 nmdc:mga0rr50_56319_c1 nmdc:mga0rr50_56319_c1_1451_2557 368
347 3300005330 Ga0070690_100023318 Ga0070690_1000233181 369
348 3300005345 Ga0070692_10015816 Ga0070692_100158162 369
349 3300005353 Ga0070669_100318838 Ga0070669_1003188381 369
350 3300005354 Ga0070675_100091675 Ga0070675_1000916753 369
351 3300005441 Ga0070700_100002980 Ga0070700_1000029805 369
352 3300005457 Ga0070662_100078967 Ga0070662_1000789673 369
353 3300005458 Ga0070681_10000685 Ga0070681_1000068525 369
354 3300005459 Ga0068867_100002723 Ga0068867_1000027235 369
355 3300005535 Ga0070684_100007846 Ga0070684_1000078465 369
356 3300005545 Ga0070695_100035637 Ga0070695_1000356373 369
357 3300005546 Ga0070696_100022721 Ga0070696_1000227213 369
358 3300005549 Ga0070704_100008861 Ga0070704_1000088614 369
359 3300005719 Ga0068861_100391074 Ga0068861_1003910741 369
360 3300006358 Ga0068871_100000638 Ga0068871_10000063815 369
361 3300006844 Ga0075428_100131389 Ga0075428_1001313893 369
362 3300006844 Ga0075428_100204237 Ga0075428_1002042372 369
363 3300006844 Ga0075428_100270073 Ga0075428_1002700732 369
364 3300006846 Ga0075430_100005230 Ga0075430_1000052305 369
365 3300006846 Ga0075430_100008533 Ga0075430_1000085335 369
366 3300006846 Ga0075430_100251478 Ga0075430_1002514782 369
367 3300006871 Ga0075434_100000017 Ga0075434_10000001713 369
368 3300006871 Ga0075434_100063439 Ga0075434_1000634393 369
369 3300006880 Ga0075429_100025516 Ga0075429_1000255162 369
370 3300006880 Ga0075429_100042611 Ga0075429_1000426113 369
371 3300006881 Ga0068865_100005462 Ga0068865_1000054625 369
372 3300006914 Ga0075436_100041119 Ga0075436_1000411192 369
373 3300006914 Ga0075436_100045861 Ga0075436_1000458613 369
374 3300007076 Ga0075435_100025665 Ga0075435_1000256652 369
375 3300009094 Ga0111539_10423426 Ga0111539_104234261 369
376 3300009148 Ga0105243_10016134 Ga0105243_100161343 369
377 3300013306 Ga0163162_10055505 Ga0163162_100555053 369
378 3300025908 Ga0207643_10059823 Ga0207643_100598232 369
379 3300025912 Ga0207707_10096785 Ga0207707_100967852 369
380 3300025917 Ga0207660_10209247 Ga0207660_102092472 369
381 3300025921 Ga0207652_10028471 Ga0207652_100284713 369
382 3300025923 Ga0207681_10004318 Ga0207681_100043184 369
383 3300025926 Ga0207659_10168004 Ga0207659_101680042 369
384 3300025938 Ga0207704_10004505 Ga0207704_100045053 369
385 3300025944 Ga0207661_10101870 Ga0207661_101018702 369
386 3300025961 Ga0207712_10012958 Ga0207712_100129582 369
387 3300025972 Ga0207668_10082189 Ga0207668_100821892 369
388 3300026075 Ga0207708_10019279 Ga0207708_100192795 369
389 3300026075 Ga0207708_10189724 Ga0207708_101897242 369
390 3300026089 Ga0207648_10009053 Ga0207648_100090535 369
391 3300026118 Ga0207675_100013344 Ga0207675_1000133444 369
392 3300027471 Ga0209995_1004293 Ga0209995_10042932 369
393 3300027665 Ga0209983_1003592 Ga0209983_10035923 369
394 3300028380 Ga0268265_10000957 Ga0268265_1000095727 369
395 3300032002 Ga0307416_100055008 Ga0307416_1000550082 369
396 3300035086 Ga0373934_0039407 Ga0373934_0039407_631_1740 369
397 3300035118 Ga0373954_0000072 Ga0373954_0000072_3656_4765 369
398 3300035172 Ga0373955_0002156 Ga0373955_0002156_529_1638 369
399 3300035410 Ga0373924_0023103 Ga0373924_0023103_1027_2136 369
400 3300035692 Ga0373935_0194780 Ga0373935_0194780_211_1320 369
401 3300035724 Ga0373933_0003113 Ga0373933_0003113_2817_3926 369
402 3300035724 Ga0373933_0004028 Ga0373933_0004028_4589_5698 369
403 3300042001 Ga0439441_006814 Ga0439441_006814_456_1565 369
404 3300042003 Ga0439443_004496 Ga0439443_004496_334_1443 369
405 3300042436 Ga0439435_0000651 Ga0439435_0000651_4132_5241 369
406 3300042437 Ga0439444_0008763 Ga0439444_0008763_175_1284 369
407 3300042461 Ga0439460_0000630 Ga0439460_0000630_4371_5480 369
408 3300044683 Ga0466965_0063300 Ga0466965_0063300_255_1364 369
409 3300045976 Ga0466967_0003407 Ga0466967_0003407_4117_5226 369
410 3300046473 Ga0495582_0067939 Ga0495582_0067939_111_1220 369
411 3300046533 Ga0495640_0188046 Ga0495640_0188046_32_1141 369
412 3300046663 Ga0495635_0023691 Ga0495635_0023691_494_1603 369
413 3300047317 Ga0495604_0201499 Ga0495604_0201499_183_1292 369
414 3300047318 Ga0495636_0015431 Ga0495636_0015431_753_1862 369
415 3300049570 Ga0501033_0110400 Ga0501033_0110400_443_1564 369
416 3300049572 Ga0501036_0032254 Ga0501036_0032254_2071_3180 369
417 3300049572 Ga0501036_0279849 Ga0501036_0279849_135_1244 369
418 3300049575 Ga0501039_0027129 Ga0501039_0027129_1699_2808 369
419 3300049576 Ga0501040_0005878 Ga0501040_0005878_1873_2982 369
420 3300049576 Ga0501040_0084559 Ga0501040_0084559_895_2004 369
421 3300049576 Ga0501040_0214038 Ga0501040_0214038_121_1230 369
422 3300049577 Ga0501041_0021859 Ga0501041_0021859_689_1798 369
423 3300049577 Ga0501041_0042902 Ga0501041_0042902_1318_2439 369
424 3300049577 Ga0501041_0198269 Ga0501041_0198269_130_1239 369
425 3300049578 Ga0501042_0045296 Ga0501042_0045296_1844_2953 369
426 3300049582 Ga0501048_0066328 Ga0501048_0066328_520_1629 369
427 3300049582 Ga0501048_0120060 Ga0501048_0120060_306_1415 369
428 3300049583 Ga0501067_0060061 Ga0501067_0060061_407_1516 369
429 3300049584 Ga0501068_0042398 Ga0501068_0042398_230_1339 369
430 3300049584 Ga0501068_0143833 Ga0501068_0143833_131_1240 369
431 3300049587 Ga0501071_0003552 Ga0501071_0003552_5157_6266 369
432 3300049588 Ga0501072_0012944 Ga0501072_0012944_3928_5037 369
433 3300049591 Ga0501075_0000841 Ga0501075_0000841_16304_17413 369
434 3300049591 Ga0501075_0007617 Ga0501075_0007617_4593_5702 369
435 3300049591 Ga0501075_0054664 Ga0501075_0054664_1805_2914 369
436 3300049592 Ga0501076_0000166 Ga0501076_0000166_23924_25033 369
437 3300049741 Ga0501079_0203317 Ga0501079_0203317_178_1287 369
438 3300049742 Ga0501080_0035646 Ga0501080_0035646_169_1278 369
439 3300049743 Ga0501081_0024336 Ga0501081_0024336_2031_3140 369
440 3300049743 Ga0501081_0044594 Ga0501081_0044594_242_1351 369
441 3300049743 Ga0501081_0064468 Ga0501081_0064468_917_2026 369
442 3300049824 Ga0501045_0067210 Ga0501045_0067210_1420_2529 369
443 3300050507 nmdc:mga05p37_486948_c1 nmdc:mga05p37_486948_c1_67_1176 369
444 3300050508 nmdc:mga09592_29450_c1 nmdc:mga09592_29450_c1_2941_4050 369
445 3300050508 nmdc:mga09592_93988_c1 nmdc:mga09592_93988_c1_580_1701 369
446 3300050509 nmdc:mga0qj67_23511_c1 nmdc:mga0qj67_23511_c1_667_1776 369
447 3300050509 nmdc:mga0qj67_2922_c1 nmdc:mga0qj67_2922_c1_4097_5206 369
448 3300050509 nmdc:mga0qj67_54054_c1 nmdc:mga0qj67_54054_c1_240_1349 369
449 3300050509 nmdc:mga0qj67_70280_c1 nmdc:mga0qj67_70280_c1_734_1843 369
450 3300050510 nmdc:mga06r32_133774_c1 nmdc:mga06r32_133774_c1_586_1695 369
451 3300050511 nmdc:mga08y16_79758_c1 nmdc:mga08y16_79758_c1_87_1208 369
452 3300050512 nmdc:mga0n895_151_c1 nmdc:mga0n895_151_c1_39501_40610 369
453 3300050512 nmdc:mga0n895_8493_c1 nmdc:mga0n895_8493_c1_3391_4500 369
454 3300050513 nmdc:mga0rr50_18966_c1 nmdc:mga0rr50_18966_c1_231_1340 369
455 3300050514 nmdc:mga08x19_29876_c1 nmdc:mga08x19_29876_c1_1544_2653 369
456 3300050514 nmdc:mga08x19_68200_c1 nmdc:mga08x19_68200_c1_716_1825 369
457 3300053085 Ga0495619_0090629 Ga0495619_0090629_58_1167 369
458 3300054114 Ga0501084_0082600 Ga0501084_0082600_1037_2146 369
459 3300054114 Ga0501084_0089179 Ga0501084_0089179_1038_2147 369
460 3300060353 Ga0501082_0004974 Ga0501082_0004974_7147_8256 369
461 3300060353 Ga0501082_0296738 Ga0501082_0296738_87_1196 369
462 3300061734 Ga0530510_0000956 Ga0530510_0000956_15051_16160 369

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

35

358

0.95

PF00266

Aminotran_5

Aminotransferase class-V

72

247

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ly1-assembly1.cif.gz_B crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution 0.9376 39 363
1lc7-assembly1.cif.gz_A crystal structure of l-threonine-o-3-phosphate decarboxylase from s. enterica complexed with a substrate 0.9195 19 363
3ffh-assembly1.cif.gz_A the crystal structure of histidinol-phosphate aminotransferase from listeria innocua clip11262. 0.9169 15 365
4wbt-assembly2.cif.gz_B-3 crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate 0.9135 13 368
3ftb-assembly2.cif.gz_E the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum 0.9123 39 368
ID Description Score Start End Superfamily
af_Q2G087_68_261_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9749 78 269 3.40.640.10
4r5zC02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9666 53 274 3.40.640.10
3ffhA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9611 76 274 3.40.640.10
af_Q2G087_68_261_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9601 78 269 3.40.640.10
af_P9WML5_24_353_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9535 40 369 3.50.50.60
ID Description Score Start End GO Terms
AF-F1VZB7-F1-model_v4 Putative histidinol-phosphate aminotransferase protein 0.9772 193 367 GO:0008483
GO:0009058
GO:0030170
AF-A0A382NAJ8-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9771 114 365 GO:0008483
GO:0009058
GO:0030170
AF-A0A7V1K5B9-F1-model_v4 deleted 0.9743 114 369
AF-A0A1Q7RDV9-F1-model_v4 Histidinol-phosphate transaminase 0.974 53 368 GO:0000105
GO:0004400
GO:0030170
AF-A0A6M0K5Q0-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9726 39 363 GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
92.46 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map